--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:46:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1508/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -672.14          -675.56
2       -672.14          -676.34
--------------------------------------
TOTAL     -672.14          -676.02
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.898207    0.094608    0.364984    1.511781    0.872993   1355.40   1428.20    1.001
r(A<->C){all}   0.171384    0.020606    0.000014    0.450323    0.134509    132.79    214.70    1.002
r(A<->G){all}   0.168370    0.020503    0.000008    0.456746    0.135009    165.64    199.56    1.001
r(A<->T){all}   0.165826    0.020934    0.000052    0.462839    0.123981    280.66    307.58    1.000
r(C<->G){all}   0.169307    0.019676    0.000145    0.449158    0.135962    211.98    237.11    1.001
r(C<->T){all}   0.165661    0.018938    0.000088    0.438375    0.133011    168.40    231.42    1.002
r(G<->T){all}   0.159453    0.018659    0.000038    0.440636    0.126055    252.74    297.26    1.000
pi(A){all}      0.197118    0.000314    0.163442    0.232302    0.196943   1229.62   1339.83    1.000
pi(C){all}      0.261371    0.000394    0.224044    0.300942    0.260711   1136.35   1259.49    1.002
pi(G){all}      0.314222    0.000447    0.270770    0.352456    0.314377   1349.40   1379.44    1.001
pi(T){all}      0.227288    0.000350    0.189814    0.261492    0.226805   1286.19   1322.02    1.000
alpha{1,2}      0.403997    0.211337    0.000142    1.346516    0.236889   1150.88   1177.17    1.000
alpha{3}        0.448293    0.225653    0.000370    1.460072    0.291368   1072.07   1160.24    1.000
pinvar{all}     0.996669    0.000016    0.989086    0.999998    0.998000   1187.64   1210.00    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-587.297584
Model 2: PositiveSelection	-587.297542
Model 0: one-ratio	-587.297554
Model 7: beta	-587.297616
Model 8: beta&w>1	-587.297554


Model 0 vs 1	6.000000007588824E-5

Model 2 vs 1	8.400000001529406E-5

Model 8 vs 7	1.2399999991430377E-4
>C1
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C2
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C3
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C4
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C5
MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIRooo
ooooooooooooo
>C6
MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIRooo
ooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=179 

C1              MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C2              MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C3              MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C4              MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C5              ----------------MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C6              ----------------MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
                                **********************************

C1              NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C2              NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C3              NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C4              NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C5              NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C6              NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
                **************************************************

C1              TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C2              TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C3              TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C4              TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C5              TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C6              TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
                **************************************************

C1              PILHVYGLPPGIR----------------
C2              PILHVYGLPPGIR----------------
C3              PILHVYGLPPGIR----------------
C4              PILHVYGLPPGIR----------------
C5              PILHVYGLPPGIRoooooooooooooooo
C6              PILHVYGLPPGIRoooooooooooooooo
                *************                




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  163 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  163 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5434]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5434]--->[5022]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.474 Mb, Max= 30.711 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C2              MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C3              MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C4              MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C5              MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C6              MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
                **************************************************

C1              ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C2              ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C3              ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C4              ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C5              ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C6              ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
                **************************************************

C1              EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C2              EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C3              EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C4              EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C5              EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C6              EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
                ***********************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:94 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
C2              ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
C3              ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
C4              ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
C5              ------------------------------------------------AT
C6              ------------------------------------------------AT
                                                                **

C1              GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C2              GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C3              GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C4              GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C5              GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C6              GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
                **************************************************

C1              CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C2              CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C3              CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C4              CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C5              CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C6              CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
                **************************************************

C1              AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C2              AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C3              AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C4              AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C5              AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C6              AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
                **************************************************

C1              CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C2              CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C3              CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C4              CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C5              CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C6              CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
                **************************************************

C1              CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C2              CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C3              CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C4              CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C5              CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C6              CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
                **************************************************

C1              ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C2              ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C3              ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C4              ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C5              ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C6              ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
                **************************************************

C1              GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C2              GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C3              GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C4              GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C5              GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C6              GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
                **************************************************

C1              ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C2              ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C3              ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C4              ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C5              ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C6              ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
                **************************************************

C1              CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C2              CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C3              CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C4              CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C5              CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C6              CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
                ***************************************           

C1              -------------------------------------
C2              -------------------------------------
C3              -------------------------------------
C4              -------------------------------------
C5              -------------------------------------
C6              -------------------------------------
                                                     



>C1
ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C2
ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C3
ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C4
ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C5
------------------------------------------------AT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C6
------------------------------------------------AT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C1
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C2
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C3
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C4
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C5
ooooooooooooooooMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C6
ooooooooooooooooMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 537 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855471
      Setting output file names to "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1318152605
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5211743013
      Seed = 225627974
      Swapseed = 1579855471
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 9 unique site patterns
      Division 2 has 9 unique site patterns
      Division 3 has 9 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1085.051903 -- -24.965149
         Chain 2 -- -1085.221969 -- -24.965149
         Chain 3 -- -1085.038273 -- -24.965149
         Chain 4 -- -1085.221969 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1085.038273 -- -24.965149
         Chain 2 -- -1085.051903 -- -24.965149
         Chain 3 -- -1085.221969 -- -24.965149
         Chain 4 -- -1085.229474 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1085.052] (-1085.222) (-1085.038) (-1085.222) * [-1085.038] (-1085.052) (-1085.222) (-1085.229) 
        500 -- (-681.866) (-679.004) [-679.679] (-683.209) * (-678.065) [-677.139] (-685.343) (-682.528) -- 0:00:00
       1000 -- (-686.423) (-685.485) [-678.775] (-678.693) * (-681.390) [-681.955] (-685.375) (-684.433) -- 0:00:00
       1500 -- (-684.602) [-677.567] (-685.471) (-682.028) * (-687.755) [-678.385] (-678.909) (-690.065) -- 0:00:00
       2000 -- (-681.874) (-679.753) (-679.372) [-681.757] * (-687.139) (-685.273) (-679.849) [-678.550] -- 0:00:00
       2500 -- (-680.791) (-683.350) [-677.739] (-681.337) * (-683.356) (-677.540) (-684.525) [-682.959] -- 0:00:00
       3000 -- (-685.462) [-681.324] (-687.125) (-679.947) * (-684.277) (-678.958) (-680.844) [-682.109] -- 0:00:00
       3500 -- [-675.578] (-677.141) (-679.111) (-684.653) * (-683.780) (-680.332) (-678.239) [-682.366] -- 0:00:00
       4000 -- (-684.104) (-684.661) (-683.627) [-683.494] * (-681.661) (-686.819) [-683.973] (-690.195) -- 0:00:00
       4500 -- [-675.886] (-691.647) (-687.786) (-684.880) * (-684.668) [-684.675] (-684.471) (-686.524) -- 0:00:00
       5000 -- (-680.075) [-680.753] (-682.171) (-681.652) * [-682.644] (-687.019) (-682.539) (-682.847) -- 0:03:19

      Average standard deviation of split frequencies: 0.081710

       5500 -- (-679.037) (-681.858) (-683.261) [-681.458] * (-678.303) [-680.856] (-685.780) (-683.435) -- 0:03:00
       6000 -- (-682.290) (-687.545) [-677.178] (-678.010) * (-680.904) (-686.792) [-679.565] (-678.676) -- 0:02:45
       6500 -- (-686.829) (-681.491) [-681.411] (-685.113) * (-688.735) [-684.056] (-682.481) (-679.182) -- 0:02:32
       7000 -- [-677.863] (-681.409) (-688.029) (-688.148) * (-679.207) (-688.864) [-682.557] (-686.548) -- 0:02:21
       7500 -- [-678.038] (-683.883) (-677.433) (-675.995) * (-683.602) (-684.461) (-683.631) [-684.142] -- 0:02:12
       8000 -- (-687.883) (-688.624) [-680.252] (-679.097) * (-688.121) [-682.512] (-680.924) (-683.364) -- 0:02:04
       8500 -- [-678.940] (-681.861) (-682.903) (-682.181) * [-679.090] (-683.828) (-683.948) (-683.315) -- 0:01:56
       9000 -- (-691.785) (-686.135) [-681.845] (-680.686) * (-681.826) [-677.019] (-687.427) (-685.058) -- 0:01:50
       9500 -- [-684.563] (-682.389) (-687.481) (-686.832) * (-687.726) (-682.198) [-684.100] (-682.595) -- 0:01:44
      10000 -- [-682.971] (-679.862) (-678.357) (-680.124) * (-690.650) (-685.453) [-684.841] (-680.095) -- 0:01:39

      Average standard deviation of split frequencies: 0.069173

      10500 -- [-680.129] (-681.702) (-681.552) (-682.122) * (-689.465) (-677.950) [-676.695] (-683.350) -- 0:01:34
      11000 -- (-684.918) [-681.226] (-680.578) (-674.491) * [-680.115] (-685.541) (-684.199) (-684.703) -- 0:01:29
      11500 -- (-679.483) [-687.977] (-685.886) (-673.354) * [-683.417] (-678.897) (-683.239) (-686.661) -- 0:01:25
      12000 -- (-687.315) (-679.343) (-683.772) [-672.474] * (-687.642) (-675.344) [-682.047] (-679.744) -- 0:01:22
      12500 -- (-685.429) (-676.817) [-679.782] (-678.457) * (-682.954) [-680.479] (-685.073) (-681.697) -- 0:01:19
      13000 -- (-680.438) [-676.101] (-680.430) (-677.569) * [-680.656] (-679.277) (-700.061) (-683.612) -- 0:01:15
      13500 -- (-688.173) (-685.207) (-683.878) [-671.659] * [-680.770] (-687.031) (-686.604) (-682.139) -- 0:01:13
      14000 -- (-682.471) [-684.950] (-682.822) (-672.635) * (-678.247) (-684.747) (-673.062) [-679.271] -- 0:01:10
      14500 -- [-682.981] (-680.204) (-689.527) (-672.806) * (-713.510) (-686.572) (-674.535) [-675.802] -- 0:01:07
      15000 -- (-689.097) (-680.109) (-679.940) [-673.102] * (-677.369) (-689.639) (-674.361) [-677.310] -- 0:01:05

      Average standard deviation of split frequencies: 0.069780

      15500 -- [-680.124] (-687.031) (-685.640) (-673.331) * [-672.470] (-678.125) (-673.388) (-687.979) -- 0:01:03
      16000 -- (-680.624) [-684.880] (-702.095) (-671.511) * (-676.008) (-679.141) (-674.700) [-678.065] -- 0:01:01
      16500 -- [-678.552] (-685.446) (-700.453) (-672.235) * [-672.705] (-690.529) (-672.745) (-681.008) -- 0:00:59
      17000 -- [-685.059] (-687.878) (-687.446) (-673.508) * (-672.124) (-690.392) [-671.519] (-694.609) -- 0:01:55
      17500 -- (-686.198) [-680.234] (-685.945) (-676.422) * (-672.008) (-685.433) (-672.150) [-679.626] -- 0:01:52
      18000 -- (-680.783) [-680.187] (-675.856) (-674.312) * (-673.442) [-682.929] (-672.336) (-681.943) -- 0:01:49
      18500 -- (-676.970) [-680.325] (-673.812) (-671.800) * (-673.866) [-672.325] (-672.408) (-683.702) -- 0:01:46
      19000 -- (-681.882) [-683.453] (-672.900) (-675.053) * (-673.060) (-673.442) [-674.681] (-681.707) -- 0:01:43
      19500 -- (-684.235) (-681.179) [-672.080] (-676.657) * (-672.456) (-674.639) (-674.478) [-680.999] -- 0:01:40
      20000 -- (-684.664) (-684.971) [-674.000] (-673.010) * (-671.914) (-675.145) [-671.188] (-685.798) -- 0:01:38

      Average standard deviation of split frequencies: 0.057025

      20500 -- (-684.433) (-675.998) (-676.006) [-671.867] * (-671.986) [-671.673] (-671.999) (-681.504) -- 0:01:35
      21000 -- (-690.524) [-681.157] (-671.315) (-673.290) * (-671.566) (-671.837) [-670.824] (-682.720) -- 0:01:33
      21500 -- (-685.770) (-678.822) [-673.294] (-671.841) * (-670.939) [-675.012] (-679.294) (-682.686) -- 0:01:31
      22000 -- (-678.640) (-685.913) (-674.559) [-671.136] * (-673.064) (-672.547) [-675.035] (-685.329) -- 0:01:28
      22500 -- [-686.492] (-681.042) (-674.725) (-672.252) * (-671.179) [-674.080] (-679.559) (-684.521) -- 0:01:26
      23000 -- (-689.013) (-687.059) [-672.645] (-672.320) * (-676.819) (-674.169) [-674.362] (-678.845) -- 0:01:24
      23500 -- (-680.345) (-688.189) [-672.020] (-670.709) * (-674.281) [-671.334] (-671.855) (-681.769) -- 0:01:23
      24000 -- [-682.843] (-690.138) (-671.476) (-672.857) * (-673.423) [-673.912] (-671.791) (-685.400) -- 0:01:21
      24500 -- [-683.423] (-679.448) (-670.990) (-674.399) * (-674.306) (-671.927) [-673.159] (-683.699) -- 0:01:19
      25000 -- (-689.971) [-682.335] (-674.350) (-672.184) * [-675.119] (-675.850) (-672.706) (-675.649) -- 0:01:18

      Average standard deviation of split frequencies: 0.038982

      25500 -- (-696.159) [-679.042] (-673.648) (-672.293) * (-673.320) (-673.020) [-673.885] (-680.385) -- 0:01:16
      26000 -- (-687.103) (-690.289) [-674.323] (-674.072) * [-673.860] (-673.446) (-672.250) (-682.666) -- 0:01:14
      26500 -- (-684.389) [-684.104] (-675.483) (-676.649) * [-671.663] (-672.260) (-673.898) (-691.988) -- 0:01:13
      27000 -- (-680.025) (-688.535) (-673.887) [-671.798] * (-670.924) (-672.959) [-672.838] (-685.932) -- 0:01:12
      27500 -- (-686.937) (-679.454) [-672.324] (-674.108) * (-673.793) (-672.896) [-676.646] (-683.336) -- 0:01:10
      28000 -- (-679.711) [-685.424] (-673.518) (-673.736) * (-675.628) [-671.698] (-674.993) (-685.039) -- 0:01:09
      28500 -- (-680.256) [-681.262] (-676.256) (-675.642) * (-670.908) (-672.216) [-672.736] (-682.230) -- 0:01:08
      29000 -- (-680.249) [-676.489] (-673.722) (-673.263) * (-674.650) (-672.053) (-674.789) [-678.108] -- 0:01:06
      29500 -- (-680.269) [-684.890] (-678.528) (-676.270) * [-672.687] (-672.023) (-672.311) (-680.077) -- 0:01:38
      30000 -- (-681.472) (-684.129) [-673.167] (-678.901) * [-670.705] (-671.878) (-671.534) (-679.890) -- 0:01:37

      Average standard deviation of split frequencies: 0.043810

      30500 -- [-677.730] (-691.741) (-673.342) (-674.056) * (-671.324) (-671.891) [-672.088] (-679.433) -- 0:01:35
      31000 -- [-681.361] (-683.558) (-675.024) (-674.231) * (-672.997) [-671.678] (-673.521) (-682.213) -- 0:01:33
      31500 -- (-678.287) (-681.074) [-671.321] (-676.305) * (-673.734) (-672.176) (-672.187) [-679.100] -- 0:01:32
      32000 -- (-677.269) (-683.859) (-672.333) [-673.537] * (-677.747) [-678.451] (-672.026) (-687.082) -- 0:01:30
      32500 -- (-675.474) (-683.190) (-673.070) [-672.079] * (-673.003) (-674.784) [-675.224] (-685.676) -- 0:01:29
      33000 -- [-673.879] (-681.672) (-673.024) (-673.910) * (-673.832) [-673.953] (-677.740) (-687.034) -- 0:01:27
      33500 -- (-673.800) (-689.576) (-672.485) [-672.749] * [-671.872] (-671.728) (-676.048) (-680.934) -- 0:01:26
      34000 -- (-675.028) (-679.895) [-670.931] (-678.227) * (-671.886) (-670.999) (-674.951) [-686.326] -- 0:01:25
      34500 -- (-672.283) (-691.935) (-672.788) [-677.871] * (-673.042) (-671.140) (-672.691) [-677.409] -- 0:01:23
      35000 -- (-673.971) (-680.764) (-670.661) [-671.700] * (-671.028) (-671.944) (-679.651) [-683.381] -- 0:01:22

      Average standard deviation of split frequencies: 0.030118

      35500 -- (-671.546) (-673.568) [-672.634] (-670.853) * [-671.765] (-674.143) (-672.821) (-691.104) -- 0:01:21
      36000 -- (-675.163) [-675.980] (-674.714) (-675.352) * (-672.722) (-677.211) [-670.940] (-683.901) -- 0:01:20
      36500 -- (-671.615) (-671.759) (-673.087) [-672.287] * (-674.998) (-680.530) (-672.411) [-676.890] -- 0:01:19
      37000 -- (-673.923) (-675.612) [-673.849] (-671.316) * (-673.559) [-673.291] (-674.389) (-684.469) -- 0:01:18
      37500 -- [-673.060] (-673.801) (-671.350) (-673.361) * (-675.496) (-675.670) [-672.562] (-688.543) -- 0:01:17
      38000 -- [-673.069] (-675.661) (-673.214) (-671.532) * [-672.316] (-671.015) (-674.230) (-681.193) -- 0:01:15
      38500 -- (-672.903) [-674.072] (-671.717) (-671.716) * (-675.661) (-670.653) [-673.718] (-683.391) -- 0:01:14
      39000 -- (-676.706) (-674.057) (-673.976) [-673.642] * (-677.573) [-670.742] (-674.423) (-679.576) -- 0:01:13
      39500 -- (-676.060) (-672.425) (-674.739) [-671.635] * (-674.055) [-671.760] (-675.004) (-679.075) -- 0:01:12
      40000 -- (-673.870) [-674.562] (-674.623) (-672.214) * [-672.595] (-671.179) (-671.823) (-687.837) -- 0:01:12

      Average standard deviation of split frequencies: 0.033556

      40500 -- (-671.514) (-671.628) [-672.441] (-673.115) * (-676.825) (-672.898) (-671.829) [-681.323] -- 0:01:11
      41000 -- (-673.908) [-672.975] (-673.406) (-670.831) * (-673.198) [-672.551] (-672.568) (-684.497) -- 0:01:10
      41500 -- [-672.947] (-673.044) (-674.840) (-671.564) * (-671.655) (-671.448) [-671.303] (-688.562) -- 0:01:32
      42000 -- [-672.802] (-672.294) (-672.164) (-673.472) * (-674.485) (-677.422) (-675.317) [-683.250] -- 0:01:31
      42500 -- (-676.783) [-671.281] (-674.629) (-673.209) * (-671.444) (-672.531) [-671.174] (-682.880) -- 0:01:30
      43000 -- [-673.328] (-671.292) (-672.787) (-671.484) * [-674.696] (-672.433) (-672.144) (-684.304) -- 0:01:29
      43500 -- (-671.163) (-673.093) [-673.493] (-671.398) * (-674.465) (-672.195) (-671.703) [-677.816] -- 0:01:27
      44000 -- (-671.551) (-672.995) (-673.367) [-672.991] * (-674.051) [-675.334] (-672.889) (-689.551) -- 0:01:26
      44500 -- [-674.864] (-671.537) (-676.545) (-671.504) * (-676.388) (-672.711) [-673.110] (-681.133) -- 0:01:25
      45000 -- [-674.374] (-673.524) (-674.391) (-674.357) * (-672.685) (-673.791) (-675.420) [-686.256] -- 0:01:24

      Average standard deviation of split frequencies: 0.026840

      45500 -- (-672.783) [-672.459] (-672.727) (-671.753) * [-672.282] (-675.405) (-675.519) (-690.833) -- 0:01:23
      46000 -- (-673.748) [-672.159] (-671.993) (-671.650) * [-672.206] (-674.027) (-674.793) (-689.458) -- 0:01:22
      46500 -- [-674.839] (-673.719) (-672.527) (-671.421) * (-672.103) (-671.496) (-673.028) [-672.127] -- 0:01:22
      47000 -- [-675.375] (-672.945) (-672.117) (-674.112) * (-673.317) (-673.070) (-675.362) [-671.740] -- 0:01:21
      47500 -- (-675.569) (-672.649) [-673.009] (-672.569) * [-671.749] (-673.417) (-674.365) (-671.983) -- 0:01:20
      48000 -- (-672.644) [-674.387] (-672.891) (-675.365) * (-670.788) (-673.540) [-676.084] (-675.849) -- 0:01:19
      48500 -- (-675.576) [-671.298] (-673.001) (-674.362) * [-670.897] (-674.593) (-676.152) (-671.660) -- 0:01:18
      49000 -- (-673.791) [-672.905] (-671.191) (-675.567) * (-674.562) (-674.002) [-674.025] (-671.423) -- 0:01:17
      49500 -- [-672.558] (-674.977) (-672.007) (-676.466) * (-672.784) (-673.187) (-673.976) [-672.669] -- 0:01:16
      50000 -- (-675.341) (-674.515) (-672.452) [-671.510] * (-674.301) (-673.875) [-672.617] (-674.106) -- 0:01:16

      Average standard deviation of split frequencies: 0.038767

      50500 -- (-672.440) (-671.638) (-675.486) [-674.768] * (-673.240) [-672.930] (-675.676) (-672.844) -- 0:01:15
      51000 -- (-671.248) (-671.013) [-676.201] (-673.901) * [-671.155] (-671.110) (-673.017) (-671.290) -- 0:01:14
      51500 -- [-671.200] (-672.534) (-671.306) (-671.650) * [-671.085] (-671.646) (-671.960) (-672.210) -- 0:01:13
      52000 -- (-677.464) (-673.780) [-671.789] (-671.181) * [-671.085] (-671.388) (-671.162) (-672.256) -- 0:01:12
      52500 -- (-676.863) (-672.487) [-673.986] (-674.222) * (-672.626) (-676.070) [-673.142] (-675.686) -- 0:01:12
      53000 -- (-675.403) [-672.443] (-673.489) (-675.701) * [-673.284] (-676.184) (-675.564) (-674.462) -- 0:01:11
      53500 -- (-673.551) (-672.849) (-676.127) [-672.584] * (-673.647) (-673.246) [-674.536] (-672.800) -- 0:01:28
      54000 -- (-674.376) [-674.103] (-674.950) (-673.191) * (-670.896) (-672.706) [-674.262] (-678.714) -- 0:01:27
      54500 -- [-673.187] (-672.756) (-673.182) (-674.133) * [-673.873] (-671.843) (-673.813) (-676.451) -- 0:01:26
      55000 -- (-677.783) (-671.935) (-672.877) [-672.412] * (-676.087) [-671.505] (-673.298) (-675.151) -- 0:01:25

      Average standard deviation of split frequencies: 0.034874

      55500 -- (-680.532) [-672.002] (-674.222) (-673.323) * (-672.201) (-671.091) (-673.796) [-674.521] -- 0:01:25
      56000 -- (-676.542) [-670.815] (-674.908) (-675.569) * (-674.723) (-672.117) [-674.032] (-672.606) -- 0:01:24
      56500 -- (-673.591) [-671.355] (-670.698) (-677.180) * (-672.661) (-672.353) [-674.106] (-672.838) -- 0:01:23
      57000 -- (-675.404) [-671.339] (-672.874) (-672.655) * [-671.705] (-671.481) (-673.031) (-673.145) -- 0:01:22
      57500 -- (-675.209) (-673.411) [-670.819] (-671.868) * [-675.556] (-670.923) (-672.835) (-671.458) -- 0:01:21
      58000 -- (-676.821) [-674.046] (-670.734) (-674.464) * (-672.879) [-670.641] (-676.849) (-671.325) -- 0:01:21
      58500 -- (-673.451) [-672.097] (-671.043) (-672.998) * (-676.227) (-671.929) (-679.767) [-674.379] -- 0:01:20
      59000 -- (-674.571) [-671.976] (-672.027) (-672.185) * (-675.847) (-674.098) (-671.084) [-670.748] -- 0:01:19
      59500 -- (-675.257) (-671.058) [-671.296] (-672.664) * (-674.649) (-673.916) (-676.722) [-672.867] -- 0:01:19
      60000 -- [-674.056] (-674.499) (-672.003) (-677.106) * [-672.899] (-671.673) (-672.817) (-671.725) -- 0:01:18

      Average standard deviation of split frequencies: 0.029232

      60500 -- (-674.716) (-672.939) (-673.059) [-672.083] * (-674.957) (-670.612) [-673.152] (-672.854) -- 0:01:17
      61000 -- (-673.834) (-675.599) (-674.166) [-672.238] * (-673.379) (-670.999) [-671.837] (-674.136) -- 0:01:16
      61500 -- (-674.605) (-674.473) [-672.535] (-673.075) * (-672.581) (-670.626) [-676.910] (-674.261) -- 0:01:16
      62000 -- (-672.498) (-676.510) [-673.289] (-672.635) * [-672.867] (-672.560) (-675.135) (-671.972) -- 0:01:15
      62500 -- [-673.869] (-678.483) (-677.376) (-672.372) * (-673.896) (-672.849) [-671.444] (-673.393) -- 0:01:15
      63000 -- (-675.187) [-675.113] (-679.439) (-671.035) * (-676.094) (-673.069) [-671.227] (-672.963) -- 0:01:14
      63500 -- [-673.870] (-672.058) (-671.544) (-673.719) * [-674.219] (-671.890) (-673.070) (-673.555) -- 0:01:13
      64000 -- (-672.783) (-670.918) (-670.439) [-671.996] * (-674.533) [-673.722] (-672.319) (-673.009) -- 0:01:13
      64500 -- (-675.146) (-676.309) (-671.316) [-670.760] * (-676.338) [-670.952] (-675.951) (-675.044) -- 0:01:12
      65000 -- (-673.180) (-672.094) (-672.196) [-671.005] * [-673.348] (-670.881) (-673.116) (-671.336) -- 0:01:26

      Average standard deviation of split frequencies: 0.023468

      65500 -- (-673.955) (-674.269) [-672.271] (-672.042) * (-673.466) (-671.594) [-671.532] (-673.090) -- 0:01:25
      66000 -- [-673.596] (-671.619) (-675.026) (-671.470) * (-671.893) (-670.871) [-673.067] (-674.130) -- 0:01:24
      66500 -- (-671.111) [-673.533] (-676.034) (-670.850) * (-672.292) [-670.701] (-676.461) (-673.328) -- 0:01:24
      67000 -- (-672.213) [-671.808] (-672.664) (-672.061) * (-672.018) (-671.810) [-673.445] (-673.166) -- 0:01:23
      67500 -- (-674.653) [-673.091] (-675.970) (-675.238) * (-671.946) (-672.997) [-672.331] (-672.064) -- 0:01:22
      68000 -- [-671.251] (-676.819) (-675.170) (-673.648) * (-672.503) (-675.685) (-673.273) [-677.138] -- 0:01:22
      68500 -- [-671.068] (-677.628) (-671.954) (-672.541) * (-673.508) (-673.226) (-671.399) [-673.956] -- 0:01:21
      69000 -- [-671.634] (-673.605) (-670.675) (-671.468) * (-672.601) (-673.535) [-671.313] (-673.349) -- 0:01:20
      69500 -- (-671.456) [-673.592] (-672.569) (-671.403) * (-674.053) [-672.765] (-672.502) (-675.995) -- 0:01:20
      70000 -- [-670.992] (-672.900) (-674.053) (-673.195) * (-671.978) (-673.659) (-674.144) [-672.704] -- 0:01:19

      Average standard deviation of split frequencies: 0.022470

      70500 -- (-672.765) (-672.309) (-671.840) [-673.185] * [-671.487] (-671.477) (-671.932) (-672.817) -- 0:01:19
      71000 -- (-671.500) [-671.515] (-676.267) (-674.647) * (-671.218) (-671.833) [-672.060] (-673.219) -- 0:01:18
      71500 -- (-672.213) [-672.336] (-672.178) (-672.998) * [-673.894] (-671.713) (-671.518) (-673.576) -- 0:01:17
      72000 -- [-671.460] (-673.543) (-675.497) (-671.853) * (-672.489) [-674.602] (-671.790) (-676.373) -- 0:01:17
      72500 -- (-671.079) (-674.824) (-674.973) [-674.222] * (-672.656) (-674.329) [-672.612] (-673.817) -- 0:01:16
      73000 -- (-672.826) [-673.652] (-674.399) (-672.119) * (-674.668) [-671.736] (-672.891) (-673.726) -- 0:01:16
      73500 -- (-671.973) (-671.499) [-672.103] (-673.015) * (-674.871) (-672.643) [-671.433] (-672.662) -- 0:01:15
      74000 -- (-672.281) [-671.260] (-672.103) (-672.132) * [-674.103] (-673.376) (-673.916) (-672.655) -- 0:01:15
      74500 -- (-676.722) (-671.260) (-671.702) [-671.794] * [-671.539] (-674.309) (-672.970) (-672.842) -- 0:01:14
      75000 -- (-672.931) [-672.311] (-671.832) (-671.696) * [-674.573] (-671.660) (-672.141) (-672.908) -- 0:01:14

      Average standard deviation of split frequencies: 0.017149

      75500 -- (-673.041) (-674.624) [-674.673] (-672.850) * (-673.327) [-673.007] (-674.207) (-672.526) -- 0:01:13
      76000 -- [-672.852] (-678.166) (-672.746) (-672.582) * (-671.100) (-672.172) [-673.318] (-672.988) -- 0:01:12
      76500 -- (-672.465) (-676.255) [-672.567] (-677.060) * [-671.885] (-673.643) (-671.986) (-671.124) -- 0:01:24
      77000 -- [-672.517] (-673.684) (-672.546) (-671.793) * (-673.616) (-674.257) (-671.443) [-673.798] -- 0:01:23
      77500 -- (-674.035) [-670.908] (-672.679) (-670.526) * (-672.519) [-673.048] (-673.718) (-679.783) -- 0:01:23
      78000 -- [-675.324] (-672.969) (-675.560) (-671.417) * (-672.745) (-671.780) [-671.100] (-671.993) -- 0:01:22
      78500 -- [-677.377] (-674.723) (-672.432) (-672.990) * (-672.169) [-671.562] (-674.136) (-672.471) -- 0:01:22
      79000 -- (-675.146) (-674.895) [-671.219] (-676.595) * (-671.269) (-673.449) (-670.595) [-672.803] -- 0:01:21
      79500 -- (-673.542) (-676.556) (-673.720) [-674.325] * (-675.599) (-674.767) [-673.216] (-671.585) -- 0:01:21
      80000 -- (-672.259) (-672.754) (-674.796) [-674.077] * (-675.291) [-674.025] (-672.349) (-674.098) -- 0:01:20

      Average standard deviation of split frequencies: 0.018262

      80500 -- (-672.198) [-671.694] (-671.970) (-674.530) * (-671.972) [-674.185] (-673.751) (-673.394) -- 0:01:19
      81000 -- (-673.962) [-671.684] (-670.697) (-671.223) * (-672.884) [-675.833] (-676.664) (-673.629) -- 0:01:19
      81500 -- [-670.836] (-671.823) (-671.485) (-671.157) * (-675.393) [-672.512] (-672.618) (-674.599) -- 0:01:18
      82000 -- (-672.974) (-674.830) (-675.520) [-671.519] * (-674.195) (-672.073) (-671.735) [-677.179] -- 0:01:18
      82500 -- (-672.191) (-674.665) (-671.970) [-674.772] * (-674.361) (-673.465) (-673.826) [-672.332] -- 0:01:17
      83000 -- [-672.996] (-673.996) (-671.805) (-677.556) * (-671.516) [-672.109] (-672.167) (-671.605) -- 0:01:17
      83500 -- (-674.436) (-673.106) [-679.052] (-676.825) * [-672.583] (-673.064) (-671.560) (-672.017) -- 0:01:16
      84000 -- (-672.251) (-673.868) (-673.825) [-673.400] * (-672.704) (-678.079) (-675.187) [-671.928] -- 0:01:16
      84500 -- (-677.701) [-677.964] (-674.492) (-674.224) * (-672.395) (-676.957) (-673.618) [-672.777] -- 0:01:15
      85000 -- (-672.822) (-673.722) [-673.387] (-673.484) * [-671.646] (-673.180) (-673.368) (-671.355) -- 0:01:15

      Average standard deviation of split frequencies: 0.020772

      85500 -- (-671.547) [-673.352] (-672.717) (-677.283) * (-670.861) (-674.748) (-674.212) [-673.934] -- 0:01:14
      86000 -- [-671.442] (-674.354) (-674.514) (-672.104) * (-672.985) (-675.168) [-672.746] (-671.215) -- 0:01:14
      86500 -- (-671.209) (-673.848) (-672.096) [-673.148] * (-673.507) (-672.996) [-673.235] (-673.390) -- 0:01:13
      87000 -- (-671.581) (-677.499) (-673.002) [-671.807] * (-674.578) [-672.629] (-673.317) (-673.993) -- 0:01:13
      87500 -- (-674.126) (-673.557) [-671.964] (-673.412) * (-672.506) (-670.903) [-671.874] (-672.863) -- 0:01:13
      88000 -- (-672.323) [-674.291] (-673.036) (-674.661) * (-672.393) (-670.892) (-673.099) [-671.390] -- 0:01:12
      88500 -- (-673.232) [-673.314] (-678.913) (-673.590) * (-672.461) (-676.714) (-673.302) [-671.390] -- 0:01:12
      89000 -- (-672.495) [-672.555] (-672.290) (-675.506) * [-677.855] (-677.894) (-674.229) (-672.015) -- 0:01:21
      89500 -- [-674.358] (-671.560) (-672.133) (-672.791) * (-672.627) [-672.818] (-674.815) (-674.188) -- 0:01:21
      90000 -- (-671.960) (-676.854) [-671.455] (-671.484) * (-671.904) [-671.150] (-675.804) (-674.253) -- 0:01:20

      Average standard deviation of split frequencies: 0.019642

      90500 -- (-671.994) (-674.166) (-674.243) [-675.492] * (-671.961) [-673.484] (-676.252) (-676.968) -- 0:01:20
      91000 -- (-671.370) [-671.252] (-672.991) (-674.556) * (-672.772) (-676.108) [-673.529] (-673.411) -- 0:01:19
      91500 -- (-671.048) (-673.337) (-671.097) [-672.627] * (-673.513) (-674.584) (-672.881) [-671.245] -- 0:01:19
      92000 -- (-672.895) (-674.710) [-671.782] (-673.424) * [-673.406] (-672.493) (-671.451) (-672.751) -- 0:01:18
      92500 -- [-673.023] (-672.915) (-674.006) (-674.054) * (-672.186) [-671.127] (-671.964) (-672.987) -- 0:01:18
      93000 -- [-671.656] (-671.564) (-675.557) (-674.172) * (-674.886) (-672.795) (-672.588) [-674.512] -- 0:01:18
      93500 -- [-681.511] (-671.441) (-671.382) (-672.130) * [-675.367] (-673.724) (-674.167) (-673.446) -- 0:01:17
      94000 -- (-675.129) [-673.493] (-671.765) (-673.102) * [-672.875] (-675.748) (-675.649) (-671.963) -- 0:01:17
      94500 -- (-672.539) (-672.608) (-671.398) [-673.172] * (-674.040) (-672.561) [-673.614] (-671.674) -- 0:01:16
      95000 -- (-672.506) (-677.564) [-672.687] (-671.074) * (-672.960) (-674.816) [-673.368] (-673.384) -- 0:01:16

      Average standard deviation of split frequencies: 0.020220

      95500 -- [-673.827] (-673.932) (-671.213) (-672.412) * (-675.347) [-673.402] (-671.828) (-673.356) -- 0:01:15
      96000 -- (-670.579) (-673.496) (-673.592) [-675.748] * (-672.378) (-672.577) [-671.744] (-671.756) -- 0:01:15
      96500 -- (-672.328) (-671.693) [-675.983] (-676.089) * (-673.492) (-670.634) [-672.312] (-672.734) -- 0:01:14
      97000 -- (-670.992) (-672.621) (-675.871) [-673.304] * (-672.463) [-672.209] (-674.758) (-674.079) -- 0:01:14
      97500 -- [-672.185] (-671.164) (-676.404) (-675.713) * (-673.662) (-672.482) [-677.125] (-672.900) -- 0:01:14
      98000 -- (-672.334) (-671.497) [-671.216] (-672.108) * (-671.324) (-671.519) [-674.365] (-672.472) -- 0:01:13
      98500 -- (-673.557) (-672.467) (-672.604) [-670.808] * (-672.776) [-673.026] (-672.696) (-674.884) -- 0:01:13
      99000 -- (-674.148) (-671.530) [-671.860] (-672.301) * [-671.468] (-676.104) (-674.711) (-674.950) -- 0:01:12
      99500 -- (-672.280) [-671.027] (-672.639) (-670.766) * (-671.495) [-673.171] (-672.863) (-674.205) -- 0:01:12
      100000 -- (-671.504) (-671.741) (-673.033) [-673.633] * [-671.987] (-675.311) (-675.658) (-673.537) -- 0:01:21

      Average standard deviation of split frequencies: 0.020935

      100500 -- [-671.576] (-671.782) (-671.666) (-677.063) * (-670.942) (-675.362) (-671.950) [-673.892] -- 0:01:20
      101000 -- (-672.028) [-671.544] (-673.116) (-672.417) * (-672.191) [-672.236] (-671.311) (-671.836) -- 0:01:20
      101500 -- (-672.545) (-672.579) (-677.013) [-674.887] * [-672.268] (-673.159) (-671.321) (-674.368) -- 0:01:19
      102000 -- (-671.076) (-674.254) [-674.995] (-671.880) * (-673.530) [-670.905] (-673.310) (-672.213) -- 0:01:19
      102500 -- [-671.699] (-673.020) (-676.704) (-671.626) * (-672.602) (-672.087) (-674.483) [-672.728] -- 0:01:18
      103000 -- [-674.741] (-671.925) (-673.107) (-670.813) * (-672.077) (-671.004) [-673.961] (-672.767) -- 0:01:18
      103500 -- (-673.987) (-672.967) [-672.583] (-671.037) * (-674.148) [-672.620] (-674.900) (-675.164) -- 0:01:17
      104000 -- [-671.957] (-672.201) (-671.190) (-672.023) * (-674.193) [-672.759] (-675.027) (-672.973) -- 0:01:17
      104500 -- (-672.736) (-671.900) (-671.960) [-671.016] * [-678.779] (-671.172) (-672.757) (-672.434) -- 0:01:17
      105000 -- (-673.357) [-673.860] (-672.861) (-675.466) * (-673.293) (-671.250) (-676.993) [-678.466] -- 0:01:16

      Average standard deviation of split frequencies: 0.017295

      105500 -- (-674.211) [-674.273] (-673.315) (-678.270) * [-672.386] (-673.227) (-674.639) (-672.527) -- 0:01:16
      106000 -- (-671.172) [-677.257] (-672.393) (-673.455) * (-675.469) (-672.404) (-672.497) [-674.775] -- 0:01:15
      106500 -- (-675.446) (-677.795) [-672.986] (-674.039) * (-674.440) [-670.544] (-674.429) (-675.493) -- 0:01:15
      107000 -- (-674.737) (-674.919) (-672.694) [-673.514] * [-671.124] (-671.141) (-673.038) (-674.543) -- 0:01:15
      107500 -- [-671.743] (-672.882) (-677.136) (-671.986) * (-672.314) (-674.377) [-671.323] (-673.907) -- 0:01:14
      108000 -- (-671.948) (-672.992) (-673.310) [-671.628] * [-671.666] (-672.384) (-674.261) (-674.392) -- 0:01:14
      108500 -- [-672.459] (-674.595) (-673.530) (-672.565) * (-672.724) [-671.176] (-673.666) (-679.552) -- 0:01:13
      109000 -- (-671.128) (-676.296) (-671.780) [-673.003] * (-675.957) (-671.399) [-674.273] (-676.687) -- 0:01:13
      109500 -- (-672.143) (-671.719) (-672.272) [-675.131] * (-672.649) (-673.854) (-672.621) [-678.768] -- 0:01:13
      110000 -- (-672.890) [-673.144] (-671.349) (-671.175) * (-674.928) (-674.241) (-671.704) [-672.476] -- 0:01:12

      Average standard deviation of split frequencies: 0.018222

      110500 -- (-675.650) [-674.994] (-672.422) (-672.007) * (-675.560) [-672.618] (-674.388) (-672.186) -- 0:01:12
      111000 -- (-670.969) [-671.754] (-671.253) (-672.924) * (-671.065) [-673.173] (-673.123) (-677.471) -- 0:01:12
      111500 -- (-670.727) (-674.251) [-671.665] (-676.065) * [-670.753] (-673.308) (-671.976) (-676.660) -- 0:01:11
      112000 -- (-673.687) [-672.869] (-672.474) (-679.747) * (-674.408) [-673.248] (-674.673) (-674.557) -- 0:01:19
      112500 -- [-672.807] (-671.744) (-673.497) (-674.835) * (-672.312) [-674.993] (-674.652) (-674.048) -- 0:01:18
      113000 -- (-673.766) [-671.893] (-672.686) (-673.056) * (-673.353) [-671.932] (-671.382) (-674.469) -- 0:01:18
      113500 -- (-671.952) (-671.615) [-671.216] (-671.824) * (-675.433) (-674.657) (-676.548) [-675.027] -- 0:01:18
      114000 -- (-672.903) [-674.496] (-673.002) (-673.176) * (-675.137) (-672.115) (-675.603) [-672.506] -- 0:01:17
      114500 -- (-673.367) [-671.492] (-674.753) (-671.648) * (-674.111) (-676.636) (-676.443) [-673.620] -- 0:01:17
      115000 -- (-673.012) (-672.036) (-674.172) [-671.065] * (-672.782) [-673.359] (-671.948) (-674.135) -- 0:01:16

      Average standard deviation of split frequencies: 0.017451

      115500 -- [-673.218] (-673.753) (-671.948) (-674.665) * (-673.929) [-672.630] (-671.878) (-670.623) -- 0:01:16
      116000 -- (-672.973) (-671.352) [-673.474] (-677.152) * (-675.108) [-673.946] (-673.132) (-670.650) -- 0:01:16
      116500 -- (-672.046) (-672.396) [-673.347] (-674.250) * (-674.035) [-673.260] (-674.618) (-675.302) -- 0:01:15
      117000 -- [-672.290] (-672.876) (-677.967) (-676.156) * (-671.842) (-672.155) [-673.024] (-676.502) -- 0:01:15
      117500 -- [-672.031] (-674.303) (-676.647) (-673.588) * (-675.439) [-671.965] (-672.179) (-673.333) -- 0:01:15
      118000 -- (-674.488) (-673.609) (-671.587) [-674.837] * (-671.848) (-674.424) (-672.246) [-674.459] -- 0:01:14
      118500 -- (-674.122) (-673.537) [-672.168] (-673.518) * (-675.597) (-675.467) (-672.511) [-672.633] -- 0:01:14
      119000 -- [-673.293] (-673.018) (-673.987) (-672.149) * (-674.147) [-673.278] (-672.340) (-671.147) -- 0:01:14
      119500 -- [-672.629] (-674.281) (-673.068) (-674.257) * (-671.420) (-676.837) [-673.376] (-672.696) -- 0:01:13
      120000 -- (-671.412) [-672.016] (-671.625) (-672.384) * (-673.856) [-675.934] (-671.312) (-672.486) -- 0:01:13

      Average standard deviation of split frequencies: 0.019289

      120500 -- [-671.377] (-670.707) (-672.629) (-674.129) * (-672.093) (-673.514) [-674.254] (-671.683) -- 0:01:12
      121000 -- (-671.303) [-672.426] (-670.944) (-672.074) * [-671.629] (-672.643) (-671.035) (-673.152) -- 0:01:12
      121500 -- (-673.919) [-674.540] (-672.494) (-674.559) * [-671.851] (-675.220) (-675.027) (-672.020) -- 0:01:12
      122000 -- (-672.360) (-672.334) [-672.639] (-671.029) * [-673.572] (-673.698) (-672.767) (-671.086) -- 0:01:11
      122500 -- (-672.591) (-671.586) [-671.467] (-673.661) * (-674.174) (-672.439) [-675.610] (-671.657) -- 0:01:11
      123000 -- (-672.887) (-673.050) (-673.017) [-677.134] * (-671.961) [-671.471] (-673.796) (-672.469) -- 0:01:11
      123500 -- (-672.585) (-673.405) [-673.054] (-672.831) * (-673.232) [-671.716] (-675.683) (-671.726) -- 0:01:10
      124000 -- (-672.973) (-674.513) [-673.182] (-673.186) * (-671.291) [-672.378] (-673.138) (-671.934) -- 0:01:10
      124500 -- (-676.998) [-675.608] (-673.857) (-675.452) * (-673.600) [-672.151] (-672.303) (-671.257) -- 0:01:17
      125000 -- (-672.874) (-672.257) (-673.147) [-672.323] * (-672.659) (-673.199) (-672.753) [-671.673] -- 0:01:17

      Average standard deviation of split frequencies: 0.014571

      125500 -- (-673.952) (-673.623) (-673.413) [-673.755] * (-671.128) [-671.335] (-671.717) (-671.234) -- 0:01:16
      126000 -- (-673.975) [-674.022] (-674.299) (-673.559) * (-674.553) (-674.891) [-672.397] (-674.545) -- 0:01:16
      126500 -- (-672.697) [-673.178] (-671.212) (-673.766) * (-677.136) [-674.356] (-671.051) (-674.053) -- 0:01:15
      127000 -- (-673.643) [-671.568] (-671.726) (-673.637) * (-672.118) [-673.207] (-676.747) (-670.433) -- 0:01:15
      127500 -- [-671.214] (-676.491) (-670.787) (-672.423) * [-671.550] (-671.968) (-671.407) (-671.609) -- 0:01:15
      128000 -- [-671.529] (-675.627) (-673.955) (-672.051) * [-671.694] (-671.779) (-671.338) (-671.605) -- 0:01:14
      128500 -- (-674.514) (-672.672) (-670.773) [-671.548] * (-671.043) (-672.252) (-671.416) [-671.822] -- 0:01:14
      129000 -- (-675.563) (-673.509) (-672.153) [-670.926] * (-671.091) [-671.355] (-671.868) (-673.069) -- 0:01:14
      129500 -- [-675.436] (-673.604) (-672.603) (-671.941) * (-674.263) [-672.850] (-675.401) (-676.063) -- 0:01:13
      130000 -- (-671.367) (-674.929) (-672.230) [-671.709] * (-678.802) (-671.852) [-671.463] (-676.313) -- 0:01:13

      Average standard deviation of split frequencies: 0.015280

      130500 -- [-671.878] (-671.421) (-673.179) (-671.492) * (-674.161) (-673.047) [-672.127] (-672.533) -- 0:01:13
      131000 -- (-676.197) (-676.065) [-672.304] (-675.161) * (-676.433) [-671.623] (-676.145) (-673.273) -- 0:01:12
      131500 -- [-671.724] (-671.972) (-671.786) (-674.456) * (-677.528) (-672.221) [-673.517] (-676.388) -- 0:01:12
      132000 -- (-671.900) [-672.351] (-672.916) (-674.553) * (-680.036) [-672.889] (-671.736) (-673.876) -- 0:01:12
      132500 -- [-673.007] (-675.099) (-674.332) (-676.704) * [-674.306] (-673.194) (-672.609) (-673.000) -- 0:01:12
      133000 -- [-675.817] (-678.171) (-673.322) (-675.569) * (-679.304) (-675.699) (-675.983) [-674.189] -- 0:01:11
      133500 -- (-673.798) [-671.644] (-671.019) (-678.307) * (-672.123) (-672.856) (-676.122) [-671.567] -- 0:01:11
      134000 -- (-671.857) (-673.084) [-674.914] (-676.041) * (-671.670) [-670.973] (-673.833) (-673.711) -- 0:01:11
      134500 -- (-672.599) [-672.657] (-672.234) (-672.317) * (-674.718) (-674.269) [-670.472] (-674.272) -- 0:01:10
      135000 -- (-677.797) (-672.219) (-673.331) [-673.726] * (-673.914) (-673.728) [-670.915] (-672.246) -- 0:01:10

      Average standard deviation of split frequencies: 0.016561

      135500 -- (-672.097) (-674.759) [-674.976] (-676.469) * [-675.294] (-673.511) (-672.426) (-672.680) -- 0:01:10
      136000 -- (-672.314) [-672.136] (-671.544) (-673.034) * [-676.329] (-673.480) (-671.151) (-675.977) -- 0:01:09
      136500 -- (-675.067) (-673.167) [-674.524] (-674.404) * [-672.053] (-674.032) (-671.159) (-673.393) -- 0:01:15
      137000 -- [-673.129] (-675.137) (-673.906) (-673.417) * (-673.015) (-673.455) [-671.215] (-671.977) -- 0:01:15
      137500 -- [-679.174] (-672.001) (-673.147) (-675.855) * (-672.407) [-672.906] (-676.256) (-671.660) -- 0:01:15
      138000 -- (-676.263) (-671.905) (-676.495) [-670.919] * (-671.407) [-672.096] (-678.113) (-672.719) -- 0:01:14
      138500 -- (-678.493) (-671.466) [-673.427] (-672.684) * [-676.253] (-675.646) (-681.334) (-674.811) -- 0:01:14
      139000 -- (-675.250) (-673.243) (-671.233) [-672.015] * (-672.937) [-673.750] (-675.707) (-672.321) -- 0:01:14
      139500 -- (-673.477) (-673.261) [-674.590] (-677.904) * (-672.830) (-674.732) [-673.777] (-675.011) -- 0:01:14
      140000 -- [-672.636] (-674.992) (-673.144) (-672.754) * (-672.760) (-671.500) [-671.404] (-680.254) -- 0:01:13

      Average standard deviation of split frequencies: 0.016011

      140500 -- (-673.656) (-674.677) [-674.727] (-674.136) * [-675.362] (-671.408) (-671.809) (-671.946) -- 0:01:13
      141000 -- [-671.531] (-672.840) (-671.745) (-675.709) * (-672.095) (-672.611) [-671.067] (-671.888) -- 0:01:13
      141500 -- (-673.325) [-674.474] (-674.575) (-676.609) * (-673.855) (-673.026) (-671.419) [-671.847] -- 0:01:12
      142000 -- (-672.861) [-672.325] (-672.204) (-671.913) * (-674.844) [-672.739] (-672.581) (-671.824) -- 0:01:12
      142500 -- (-674.399) [-672.628] (-671.811) (-673.746) * [-672.260] (-672.079) (-674.580) (-670.985) -- 0:01:12
      143000 -- (-677.802) (-672.409) [-672.492] (-674.913) * (-678.090) (-672.811) (-672.316) [-672.900] -- 0:01:11
      143500 -- [-674.827] (-670.863) (-672.810) (-675.914) * (-672.463) [-673.222] (-677.057) (-671.614) -- 0:01:11
      144000 -- (-673.371) (-673.530) [-672.459] (-672.154) * (-671.726) (-671.413) [-675.429] (-672.232) -- 0:01:11
      144500 -- (-674.347) (-672.335) (-670.673) [-672.981] * (-672.728) (-671.391) (-674.127) [-672.029] -- 0:01:11
      145000 -- (-693.355) [-672.212] (-671.399) (-676.176) * (-675.439) [-674.562] (-672.547) (-672.419) -- 0:01:10

      Average standard deviation of split frequencies: 0.014105

      145500 -- (-678.924) [-671.651] (-673.402) (-672.275) * (-671.061) [-671.698] (-673.948) (-673.038) -- 0:01:10
      146000 -- (-674.174) (-677.194) (-672.408) [-672.230] * (-676.301) (-674.577) (-674.230) [-671.734] -- 0:01:10
      146500 -- (-671.511) (-676.195) [-672.597] (-672.339) * (-673.024) (-679.685) [-674.590] (-670.909) -- 0:01:09
      147000 -- [-672.743] (-674.862) (-672.410) (-675.704) * [-672.024] (-671.750) (-676.641) (-672.370) -- 0:01:09
      147500 -- (-674.872) [-672.408] (-672.821) (-676.406) * (-672.846) (-671.428) (-673.964) [-671.827] -- 0:01:09
      148000 -- (-673.820) (-673.573) (-671.973) [-673.061] * (-678.412) (-671.945) (-673.698) [-671.225] -- 0:01:09
      148500 -- (-672.302) (-671.412) [-673.363] (-672.249) * (-674.929) [-671.026] (-674.149) (-671.278) -- 0:01:08
      149000 -- (-675.935) (-673.497) [-674.361] (-676.466) * [-674.501] (-673.376) (-675.812) (-675.205) -- 0:01:14
      149500 -- (-672.264) (-673.537) (-673.207) [-677.822] * (-674.442) (-672.395) (-673.172) [-675.962] -- 0:01:13
      150000 -- (-671.269) [-674.089] (-670.973) (-673.109) * (-675.012) [-674.616] (-672.528) (-672.118) -- 0:01:13

      Average standard deviation of split frequencies: 0.013906

      150500 -- (-670.929) (-673.712) [-671.684] (-674.350) * (-674.231) (-670.946) (-671.540) [-670.975] -- 0:01:13
      151000 -- (-673.649) [-673.623] (-674.663) (-673.560) * (-672.273) (-671.280) (-673.734) [-671.865] -- 0:01:13
      151500 -- (-675.381) [-674.188] (-676.291) (-672.745) * [-671.522] (-671.269) (-673.381) (-672.289) -- 0:01:12
      152000 -- (-675.409) (-675.334) [-672.760] (-672.532) * (-673.361) (-671.317) (-671.701) [-675.488] -- 0:01:12
      152500 -- (-675.514) (-677.022) [-672.361] (-672.774) * [-670.714] (-672.191) (-672.144) (-674.889) -- 0:01:12
      153000 -- [-675.027] (-672.886) (-673.413) (-673.486) * [-673.133] (-670.947) (-673.130) (-670.741) -- 0:01:11
      153500 -- (-672.032) (-674.433) [-671.842] (-674.335) * [-671.360] (-671.672) (-672.609) (-671.788) -- 0:01:11
      154000 -- (-674.481) [-673.501] (-671.635) (-672.975) * [-671.027] (-672.797) (-670.951) (-675.683) -- 0:01:11
      154500 -- [-672.293] (-673.026) (-673.261) (-672.164) * (-672.153) (-672.012) (-673.552) [-673.687] -- 0:01:11
      155000 -- (-672.291) [-670.902] (-672.609) (-674.380) * (-671.953) [-672.651] (-673.081) (-670.946) -- 0:01:10

      Average standard deviation of split frequencies: 0.014354

      155500 -- (-672.837) (-672.150) (-675.510) [-673.416] * [-672.147] (-672.044) (-671.086) (-674.329) -- 0:01:10
      156000 -- [-672.694] (-672.047) (-678.011) (-672.626) * (-671.489) (-674.335) [-673.810] (-673.235) -- 0:01:10
      156500 -- (-677.164) [-678.088] (-674.968) (-672.604) * (-676.531) [-671.179] (-672.820) (-672.986) -- 0:01:10
      157000 -- (-678.132) (-673.418) [-676.490] (-673.061) * (-672.907) (-671.720) (-672.633) [-673.537] -- 0:01:09
      157500 -- (-678.613) (-675.040) (-674.545) [-673.203] * [-672.312] (-673.383) (-676.929) (-673.853) -- 0:01:09
      158000 -- (-675.545) (-671.248) [-671.704] (-677.538) * (-672.912) [-672.550] (-674.661) (-673.110) -- 0:01:09
      158500 -- (-673.524) (-670.785) [-673.925] (-673.341) * (-672.303) [-672.571] (-671.769) (-671.711) -- 0:01:09
      159000 -- [-671.616] (-679.302) (-676.182) (-671.278) * (-676.161) (-672.426) (-672.558) [-672.526] -- 0:01:08
      159500 -- [-671.765] (-673.370) (-675.716) (-672.803) * (-671.884) (-672.928) [-674.897] (-670.879) -- 0:01:08
      160000 -- (-673.497) (-671.856) [-673.060] (-676.635) * (-674.505) (-672.765) [-673.013] (-671.091) -- 0:01:13

      Average standard deviation of split frequencies: 0.016300

      160500 -- (-674.205) (-671.254) [-673.579] (-673.978) * (-677.847) (-672.013) (-675.107) [-671.601] -- 0:01:13
      161000 -- (-671.228) (-671.377) (-674.277) [-671.463] * (-680.909) (-674.183) (-674.122) [-671.743] -- 0:01:12
      161500 -- (-673.610) (-673.759) [-675.002] (-675.083) * [-673.222] (-674.476) (-673.116) (-672.396) -- 0:01:12
      162000 -- (-673.619) [-672.978] (-673.053) (-676.331) * [-673.697] (-673.358) (-671.757) (-672.403) -- 0:01:12
      162500 -- (-672.260) [-672.261] (-673.143) (-671.893) * [-675.404] (-673.466) (-672.613) (-672.491) -- 0:01:12
      163000 -- (-671.584) (-674.542) [-672.035] (-672.113) * (-675.106) [-672.101] (-676.250) (-671.900) -- 0:01:11
      163500 -- (-671.022) [-672.318] (-672.351) (-674.345) * [-671.248] (-672.823) (-672.158) (-671.323) -- 0:01:11
      164000 -- [-676.477] (-672.125) (-675.174) (-676.468) * (-671.898) [-674.627] (-675.609) (-672.198) -- 0:01:11
      164500 -- (-679.092) (-672.510) [-672.082] (-675.396) * (-672.976) [-673.589] (-674.459) (-674.302) -- 0:01:11
      165000 -- (-678.121) [-672.591] (-673.740) (-674.243) * (-674.091) (-675.348) (-673.152) [-676.539] -- 0:01:10

      Average standard deviation of split frequencies: 0.017935

      165500 -- (-675.742) (-671.236) [-673.618] (-671.539) * (-675.663) (-676.617) [-671.624] (-675.868) -- 0:01:10
      166000 -- (-671.552) (-676.157) (-673.457) [-671.825] * (-672.442) [-677.376] (-672.477) (-673.705) -- 0:01:10
      166500 -- (-673.350) [-674.746] (-673.298) (-673.778) * [-671.112] (-678.238) (-673.487) (-671.201) -- 0:01:10
      167000 -- (-671.260) [-674.270] (-671.718) (-672.378) * (-671.419) (-670.910) [-675.008] (-674.058) -- 0:01:09
      167500 -- [-671.564] (-673.298) (-673.050) (-673.729) * [-675.179] (-671.260) (-673.337) (-676.314) -- 0:01:09
      168000 -- (-671.374) [-674.230] (-675.098) (-677.953) * (-675.058) [-671.198] (-673.603) (-672.616) -- 0:01:09
      168500 -- (-672.003) [-676.198] (-674.553) (-675.984) * (-673.881) (-670.937) (-671.484) [-674.086] -- 0:01:09
      169000 -- (-672.220) (-672.333) (-675.000) [-672.788] * (-673.677) [-673.286] (-671.233) (-675.735) -- 0:01:08
      169500 -- (-673.138) (-672.563) [-671.359] (-671.675) * [-672.732] (-672.366) (-672.939) (-673.528) -- 0:01:08
      170000 -- (-675.621) (-672.140) [-672.503] (-671.489) * (-670.741) (-678.222) [-673.244] (-672.620) -- 0:01:08

      Average standard deviation of split frequencies: 0.018317

      170500 -- [-672.479] (-671.029) (-674.629) (-676.693) * [-671.791] (-674.757) (-673.684) (-671.073) -- 0:01:08
      171000 -- (-673.028) (-673.756) (-672.827) [-674.658] * [-671.015] (-673.240) (-673.410) (-671.461) -- 0:01:12
      171500 -- (-673.917) (-672.824) [-673.932] (-671.526) * [-671.745] (-675.464) (-670.897) (-674.921) -- 0:01:12
      172000 -- [-672.205] (-672.593) (-673.750) (-671.058) * [-671.861] (-675.251) (-674.053) (-674.997) -- 0:01:12
      172500 -- (-671.748) [-672.098] (-671.969) (-672.401) * (-672.822) (-671.290) (-671.477) [-674.227] -- 0:01:11
      173000 -- (-676.207) (-674.075) (-676.818) [-670.822] * (-675.902) (-673.548) (-674.319) [-673.847] -- 0:01:11
      173500 -- (-673.842) (-672.810) [-671.251] (-674.435) * (-673.369) (-675.628) (-671.131) [-672.348] -- 0:01:11
      174000 -- (-673.173) [-671.064] (-671.465) (-673.221) * [-674.585] (-674.925) (-671.458) (-670.861) -- 0:01:11
      174500 -- (-673.185) (-671.212) [-672.490] (-676.525) * (-673.853) (-677.347) [-670.579] (-670.961) -- 0:01:10
      175000 -- (-671.589) (-675.167) [-672.178] (-672.484) * (-671.925) (-671.832) (-673.240) [-671.985] -- 0:01:10

      Average standard deviation of split frequencies: 0.017112

      175500 -- (-671.750) [-676.971] (-672.106) (-671.907) * [-671.900] (-674.414) (-673.119) (-674.420) -- 0:01:10
      176000 -- (-674.151) (-677.085) (-672.579) [-673.526] * [-672.410] (-674.888) (-672.779) (-672.724) -- 0:01:10
      176500 -- [-672.086] (-672.340) (-673.816) (-672.745) * (-673.227) [-674.124] (-673.205) (-672.412) -- 0:01:09
      177000 -- (-671.740) [-671.563] (-675.346) (-678.273) * (-675.232) (-672.223) (-673.875) [-671.854] -- 0:01:09
      177500 -- (-679.451) (-675.567) [-674.520] (-676.022) * (-672.303) (-676.237) (-676.920) [-672.671] -- 0:01:09
      178000 -- [-672.686] (-672.622) (-672.525) (-672.077) * (-671.536) (-674.525) [-672.523] (-671.342) -- 0:01:09
      178500 -- (-674.961) [-672.615] (-674.616) (-673.297) * (-672.599) (-672.726) [-671.996] (-671.871) -- 0:01:09
      179000 -- (-673.770) (-676.604) [-674.580] (-671.526) * [-674.902] (-672.746) (-674.903) (-674.693) -- 0:01:08
      179500 -- (-672.414) [-674.399] (-673.219) (-675.793) * (-673.932) [-674.078] (-674.124) (-672.756) -- 0:01:08
      180000 -- (-674.903) (-674.458) [-674.461] (-671.622) * (-673.455) (-670.766) (-673.091) [-672.130] -- 0:01:08

      Average standard deviation of split frequencies: 0.014786

      180500 -- (-673.711) [-672.161] (-675.739) (-672.870) * [-674.240] (-675.403) (-674.178) (-671.570) -- 0:01:08
      181000 -- (-674.081) [-671.743] (-672.742) (-672.603) * (-674.559) (-674.326) (-671.731) [-671.983] -- 0:01:07
      181500 -- (-672.674) [-671.517] (-673.340) (-672.210) * (-673.712) (-674.375) [-671.415] (-675.979) -- 0:01:07
      182000 -- (-671.912) (-671.776) (-671.482) [-670.974] * (-673.422) (-672.339) (-671.378) [-672.118] -- 0:01:07
      182500 -- [-671.167] (-671.986) (-672.432) (-673.000) * (-673.246) (-675.026) [-671.187] (-672.964) -- 0:01:07
      183000 -- [-671.936] (-673.479) (-672.960) (-673.441) * (-671.771) (-675.626) (-671.137) [-672.436] -- 0:01:06
      183500 -- (-670.648) (-671.972) (-675.546) [-671.764] * [-671.416] (-671.732) (-672.628) (-672.580) -- 0:01:11
      184000 -- [-671.655] (-671.586) (-672.950) (-673.166) * (-672.939) (-671.295) [-672.225] (-673.101) -- 0:01:10
      184500 -- [-676.329] (-673.214) (-672.059) (-672.549) * (-671.593) (-672.422) [-672.678] (-673.119) -- 0:01:10
      185000 -- [-674.983] (-674.377) (-673.134) (-671.782) * (-671.812) (-671.524) [-672.804] (-673.537) -- 0:01:10

      Average standard deviation of split frequencies: 0.014806

      185500 -- [-675.979] (-673.518) (-671.971) (-677.508) * (-677.935) (-673.160) [-676.427] (-675.816) -- 0:01:10
      186000 -- [-673.803] (-670.907) (-673.219) (-673.799) * (-675.389) (-670.969) (-672.545) [-677.204] -- 0:01:10
      186500 -- (-671.764) (-674.637) (-671.184) [-670.730] * (-674.153) [-673.426] (-676.561) (-671.278) -- 0:01:09
      187000 -- (-671.873) (-672.966) [-670.965] (-671.715) * (-672.443) (-671.385) [-671.833] (-671.017) -- 0:01:09
      187500 -- (-672.245) (-671.665) [-675.079] (-672.017) * [-670.635] (-674.707) (-671.176) (-674.803) -- 0:01:09
      188000 -- (-674.785) (-676.250) (-674.001) [-672.672] * [-672.197] (-673.523) (-670.983) (-673.686) -- 0:01:09
      188500 -- (-671.561) [-672.635] (-677.586) (-672.534) * (-672.240) (-672.533) (-672.812) [-672.811] -- 0:01:08
      189000 -- (-671.399) [-671.458] (-677.469) (-673.502) * (-674.605) (-672.896) [-672.725] (-674.396) -- 0:01:08
      189500 -- (-673.234) [-671.871] (-676.557) (-676.507) * (-676.634) (-671.530) (-673.311) [-671.301] -- 0:01:08
      190000 -- (-676.956) (-672.528) [-674.545] (-673.681) * (-673.922) [-673.489] (-676.904) (-672.578) -- 0:01:08

      Average standard deviation of split frequencies: 0.014980

      190500 -- [-671.488] (-671.815) (-673.066) (-678.487) * (-671.415) (-672.906) (-671.037) [-674.286] -- 0:01:07
      191000 -- (-671.745) (-672.797) [-672.211] (-679.934) * (-671.257) (-673.594) [-675.105] (-675.945) -- 0:01:07
      191500 -- (-675.979) (-671.136) [-671.029] (-675.131) * (-674.841) [-671.310] (-671.428) (-672.426) -- 0:01:07
      192000 -- (-674.364) [-672.297] (-674.891) (-671.333) * (-673.284) (-671.161) (-671.086) [-672.717] -- 0:01:07
      192500 -- (-674.316) (-672.648) [-672.649] (-675.409) * (-675.489) (-672.259) [-673.592] (-672.598) -- 0:01:07
      193000 -- (-676.085) (-674.994) [-672.819] (-671.823) * (-674.437) (-670.886) [-673.787] (-674.810) -- 0:01:06
      193500 -- [-673.103] (-672.945) (-672.481) (-671.514) * (-674.454) (-671.193) (-675.905) [-671.189] -- 0:01:06
      194000 -- [-671.103] (-671.793) (-672.654) (-671.552) * [-681.778] (-676.400) (-675.256) (-676.283) -- 0:01:06
      194500 -- [-671.131] (-672.232) (-678.628) (-675.384) * [-673.085] (-677.431) (-674.210) (-673.521) -- 0:01:06
      195000 -- [-672.770] (-672.242) (-675.459) (-671.805) * [-672.365] (-672.671) (-676.258) (-671.231) -- 0:01:06

      Average standard deviation of split frequencies: 0.015280

      195500 -- [-672.821] (-674.058) (-674.102) (-671.250) * [-673.549] (-672.242) (-670.852) (-673.370) -- 0:01:09
      196000 -- [-674.055] (-676.734) (-672.075) (-672.763) * (-673.372) [-671.010] (-672.707) (-672.274) -- 0:01:09
      196500 -- (-675.009) (-675.489) (-671.072) [-673.863] * (-672.535) (-671.655) (-672.282) [-673.342] -- 0:01:09
      197000 -- (-672.045) (-677.916) [-672.329] (-673.270) * (-677.436) (-675.034) (-675.557) [-672.256] -- 0:01:09
      197500 -- (-673.354) (-678.369) [-672.127] (-676.260) * (-674.400) (-672.482) (-671.653) [-671.917] -- 0:01:09
      198000 -- (-673.316) (-672.428) [-671.861] (-673.788) * (-672.881) [-671.972] (-672.286) (-672.031) -- 0:01:08
      198500 -- [-673.863] (-672.771) (-675.010) (-677.560) * (-671.370) [-673.985] (-671.062) (-676.473) -- 0:01:08
      199000 -- (-672.681) [-672.829] (-672.971) (-674.660) * (-671.248) (-671.393) (-674.446) [-675.440] -- 0:01:08
      199500 -- (-673.377) [-670.855] (-672.207) (-674.766) * [-676.727] (-671.355) (-673.127) (-672.929) -- 0:01:08
      200000 -- (-671.119) [-674.219] (-673.454) (-673.161) * (-677.104) (-671.647) (-672.486) [-671.541] -- 0:01:08

      Average standard deviation of split frequencies: 0.016859

      200500 -- (-672.824) [-671.550] (-672.559) (-675.302) * (-672.521) [-671.377] (-671.238) (-673.406) -- 0:01:07
      201000 -- [-672.872] (-670.772) (-670.889) (-679.013) * (-671.851) (-671.323) [-673.935] (-674.285) -- 0:01:07
      201500 -- (-672.914) (-672.160) (-671.407) [-675.056] * (-671.195) (-671.302) [-670.983] (-673.637) -- 0:01:07
      202000 -- [-671.526] (-672.380) (-672.842) (-674.042) * (-678.658) (-673.067) [-673.089] (-671.679) -- 0:01:07
      202500 -- (-671.152) (-672.650) [-674.632] (-674.186) * [-672.741] (-677.751) (-671.370) (-674.508) -- 0:01:06
      203000 -- (-671.077) [-672.905] (-676.407) (-674.770) * (-673.212) (-676.768) [-670.643] (-673.016) -- 0:01:06
      203500 -- (-673.699) (-672.610) (-676.977) [-676.244] * (-673.333) (-673.169) [-670.643] (-674.363) -- 0:01:06
      204000 -- (-672.918) (-672.298) (-671.387) [-672.603] * (-673.119) [-672.835] (-671.874) (-672.828) -- 0:01:06
      204500 -- [-672.036] (-672.663) (-672.555) (-673.196) * (-671.822) (-673.192) [-670.722] (-673.695) -- 0:01:06
      205000 -- (-672.194) (-671.517) [-671.687] (-673.139) * [-673.377] (-673.350) (-672.216) (-675.432) -- 0:01:05

      Average standard deviation of split frequencies: 0.016019

      205500 -- (-674.660) (-670.789) (-671.919) [-671.248] * (-675.885) (-671.871) [-672.191] (-680.768) -- 0:01:05
      206000 -- (-673.610) (-673.182) [-673.041] (-673.001) * [-677.280] (-672.381) (-671.022) (-675.202) -- 0:01:05
      206500 -- (-676.407) [-672.055] (-672.628) (-671.811) * (-675.922) (-672.828) (-672.231) [-674.722] -- 0:01:05
      207000 -- (-673.269) [-672.399] (-674.013) (-672.050) * (-674.403) (-672.292) [-672.144] (-673.632) -- 0:01:05
      207500 -- (-673.164) [-673.070] (-673.350) (-673.122) * (-671.903) (-671.776) [-672.988] (-672.181) -- 0:01:08
      208000 -- (-673.911) (-672.261) (-671.408) [-671.545] * (-672.216) (-672.309) [-672.583] (-671.921) -- 0:01:08
      208500 -- (-672.164) (-675.973) (-670.840) [-672.352] * (-670.910) [-672.560] (-671.554) (-672.580) -- 0:01:08
      209000 -- (-671.830) (-671.502) (-674.361) [-674.348] * (-671.705) [-674.356] (-679.127) (-673.890) -- 0:01:08
      209500 -- [-671.142] (-671.801) (-673.721) (-674.086) * [-673.231] (-672.312) (-677.345) (-672.998) -- 0:01:07
      210000 -- [-671.385] (-673.526) (-671.213) (-672.511) * (-674.056) (-671.861) (-676.464) [-677.710] -- 0:01:07

      Average standard deviation of split frequencies: 0.017375

      210500 -- (-671.464) (-672.241) (-671.980) [-671.202] * (-671.466) (-672.427) (-673.668) [-675.707] -- 0:01:07
      211000 -- (-671.989) (-672.924) (-674.684) [-673.787] * (-671.924) [-671.846] (-677.863) (-674.674) -- 0:01:07
      211500 -- (-673.731) [-672.104] (-671.699) (-673.346) * (-670.804) (-672.944) (-675.208) [-672.172] -- 0:01:07
      212000 -- (-675.972) (-674.609) (-671.332) [-671.564] * (-673.639) (-671.404) (-678.565) [-671.707] -- 0:01:06
      212500 -- (-675.960) (-672.333) (-670.890) [-678.456] * (-676.500) (-671.553) (-681.267) [-672.023] -- 0:01:06
      213000 -- (-670.792) (-677.878) [-670.497] (-672.543) * (-672.407) [-677.768] (-671.130) (-673.655) -- 0:01:06
      213500 -- [-671.400] (-675.804) (-671.747) (-670.844) * [-676.350] (-671.414) (-675.408) (-672.387) -- 0:01:06
      214000 -- (-673.060) [-674.480] (-674.260) (-671.709) * (-674.732) [-672.407] (-672.773) (-672.353) -- 0:01:06
      214500 -- (-671.921) [-673.506] (-671.250) (-673.563) * (-674.597) (-670.801) (-671.701) [-670.761] -- 0:01:05
      215000 -- (-672.095) [-676.757] (-671.278) (-673.097) * (-673.722) (-672.630) (-672.914) [-672.168] -- 0:01:05

      Average standard deviation of split frequencies: 0.018429

      215500 -- (-670.766) [-675.557] (-672.290) (-672.707) * (-674.096) (-671.773) (-673.492) [-671.837] -- 0:01:05
      216000 -- (-670.876) [-672.462] (-672.276) (-673.043) * (-675.670) (-672.411) [-671.985] (-672.042) -- 0:01:05
      216500 -- (-674.147) [-672.035] (-672.224) (-672.417) * (-673.451) (-671.440) (-674.586) [-671.929] -- 0:01:05
      217000 -- (-674.674) [-672.726] (-671.940) (-675.289) * (-671.178) (-671.957) [-671.855] (-672.493) -- 0:01:04
      217500 -- (-675.714) (-672.330) (-671.482) [-673.995] * [-672.924] (-672.871) (-680.036) (-675.889) -- 0:01:04
      218000 -- (-671.255) (-671.271) [-671.180] (-672.896) * (-673.881) (-673.480) (-672.215) [-678.923] -- 0:01:04
      218500 -- [-673.788] (-679.121) (-672.991) (-671.190) * (-671.902) (-671.818) [-674.729] (-672.979) -- 0:01:04
      219000 -- (-674.311) (-673.827) [-671.533] (-674.042) * (-672.115) (-672.723) [-674.016] (-671.255) -- 0:01:04
      219500 -- (-673.226) (-672.672) [-675.787] (-672.391) * (-674.406) [-671.535] (-673.961) (-676.532) -- 0:01:04
      220000 -- [-671.946] (-671.657) (-674.422) (-671.115) * [-671.095] (-673.394) (-675.822) (-672.086) -- 0:01:07

      Average standard deviation of split frequencies: 0.019226

      220500 -- (-674.021) (-672.063) (-676.581) [-670.876] * (-672.575) (-677.994) [-673.649] (-672.369) -- 0:01:07
      221000 -- (-672.186) (-671.652) (-671.477) [-672.503] * (-677.086) [-676.873] (-674.977) (-672.395) -- 0:01:06
      221500 -- [-672.645] (-671.264) (-671.331) (-672.186) * [-671.100] (-671.575) (-673.405) (-675.568) -- 0:01:06
      222000 -- [-674.473] (-672.027) (-674.273) (-671.959) * [-671.434] (-674.151) (-673.953) (-671.577) -- 0:01:06
      222500 -- [-672.147] (-671.634) (-671.534) (-674.690) * (-672.135) (-672.741) (-671.895) [-673.901] -- 0:01:06
      223000 -- [-672.757] (-673.236) (-672.018) (-676.453) * (-672.807) (-673.849) [-675.559] (-672.872) -- 0:01:06
      223500 -- [-672.034] (-672.834) (-674.200) (-672.084) * [-674.630] (-672.197) (-672.732) (-674.620) -- 0:01:06
      224000 -- (-673.321) [-672.879] (-676.283) (-671.751) * [-672.057] (-673.030) (-672.756) (-672.064) -- 0:01:05
      224500 -- (-673.333) (-672.286) (-673.931) [-671.868] * (-673.340) (-673.445) [-672.097] (-673.259) -- 0:01:05
      225000 -- (-673.731) (-672.882) [-674.035] (-671.372) * (-671.977) (-671.214) (-674.406) [-673.137] -- 0:01:05

      Average standard deviation of split frequencies: 0.018077

      225500 -- [-672.247] (-674.890) (-673.942) (-671.350) * [-674.050] (-671.422) (-672.320) (-672.435) -- 0:01:05
      226000 -- (-674.315) (-671.822) (-672.647) [-672.441] * (-678.649) (-672.224) [-671.619] (-672.985) -- 0:01:05
      226500 -- (-675.107) (-671.410) (-674.068) [-671.516] * (-674.209) (-671.607) [-671.152] (-672.113) -- 0:01:04
      227000 -- [-675.703] (-675.986) (-672.281) (-674.894) * (-679.366) (-672.933) [-675.494] (-677.217) -- 0:01:04
      227500 -- (-675.399) [-676.183] (-672.121) (-674.496) * (-673.376) (-673.118) (-673.711) [-677.503] -- 0:01:04
      228000 -- [-673.500] (-674.157) (-672.165) (-674.445) * (-672.526) (-672.803) [-671.215] (-672.237) -- 0:01:04
      228500 -- (-673.280) (-672.058) (-676.731) [-671.367] * [-673.790] (-671.117) (-671.456) (-671.782) -- 0:01:04
      229000 -- [-670.726] (-670.668) (-673.850) (-678.267) * (-676.327) [-671.921] (-672.373) (-673.916) -- 0:01:03
      229500 -- [-672.252] (-673.717) (-674.167) (-671.914) * (-673.601) (-671.199) (-672.255) [-673.620] -- 0:01:03
      230000 -- [-672.911] (-671.787) (-674.576) (-675.242) * (-671.661) (-671.317) (-672.400) [-673.899] -- 0:01:03

      Average standard deviation of split frequencies: 0.017144

      230500 -- (-674.386) (-673.749) (-672.270) [-673.444] * (-671.410) (-676.330) (-673.108) [-670.920] -- 0:01:03
      231000 -- (-672.097) [-675.462] (-672.830) (-674.218) * [-673.941] (-673.690) (-672.723) (-672.413) -- 0:01:03
      231500 -- (-672.929) (-673.386) [-674.049] (-671.764) * (-673.110) (-673.494) [-675.137] (-672.881) -- 0:01:03
      232000 -- [-672.759] (-673.558) (-672.995) (-674.281) * (-672.118) (-671.490) [-671.719] (-674.513) -- 0:01:06
      232500 -- (-675.959) (-671.812) [-672.990] (-674.856) * (-673.080) [-672.699] (-673.258) (-676.625) -- 0:01:06
      233000 -- (-677.958) [-671.238] (-674.442) (-677.880) * [-672.192] (-673.474) (-672.334) (-672.391) -- 0:01:05
      233500 -- (-673.163) (-676.222) [-671.276] (-675.261) * [-675.502] (-677.553) (-676.427) (-671.481) -- 0:01:05
      234000 -- (-676.965) [-671.582] (-672.432) (-673.965) * (-672.523) (-675.654) (-676.711) [-673.092] -- 0:01:05
      234500 -- (-672.989) (-674.599) [-672.853] (-671.469) * (-671.937) (-672.565) (-673.738) [-671.663] -- 0:01:05
      235000 -- (-672.210) (-673.957) (-671.952) [-671.820] * (-670.872) [-671.122] (-674.358) (-672.653) -- 0:01:05

      Average standard deviation of split frequencies: 0.018447

      235500 -- (-671.730) (-672.816) [-672.708] (-671.481) * [-677.135] (-673.686) (-675.948) (-678.304) -- 0:01:04
      236000 -- (-674.217) [-671.781] (-673.060) (-676.278) * [-671.927] (-673.686) (-678.788) (-674.623) -- 0:01:04
      236500 -- (-673.792) (-675.870) (-671.223) [-674.663] * (-674.046) (-672.989) (-673.912) [-673.455] -- 0:01:04
      237000 -- [-673.444] (-676.060) (-672.572) (-681.899) * (-672.680) (-671.281) [-672.701] (-673.759) -- 0:01:04
      237500 -- (-673.539) (-672.238) (-672.353) [-671.710] * (-672.532) (-672.479) [-671.529] (-672.760) -- 0:01:04
      238000 -- (-671.024) (-672.069) (-671.581) [-673.421] * (-672.340) (-672.426) [-671.569] (-673.528) -- 0:01:04
      238500 -- (-671.221) (-672.016) [-671.172] (-673.588) * (-674.442) [-673.562] (-672.051) (-673.089) -- 0:01:03
      239000 -- (-671.342) (-674.845) [-672.735] (-677.561) * [-673.630] (-671.893) (-671.679) (-670.525) -- 0:01:03
      239500 -- (-671.750) [-671.721] (-671.272) (-674.228) * (-672.464) (-672.641) [-671.198] (-671.897) -- 0:01:03
      240000 -- [-672.061] (-673.912) (-671.643) (-676.771) * [-672.587] (-673.395) (-672.289) (-671.729) -- 0:01:03

      Average standard deviation of split frequencies: 0.016758

      240500 -- [-672.554] (-674.150) (-671.420) (-673.526) * (-674.302) [-673.047] (-674.380) (-674.102) -- 0:01:03
      241000 -- [-671.002] (-676.199) (-672.696) (-673.804) * (-673.084) [-676.856] (-673.126) (-672.391) -- 0:01:02
      241500 -- (-671.034) [-671.460] (-673.291) (-673.554) * [-674.488] (-675.975) (-672.597) (-671.811) -- 0:01:02
      242000 -- [-671.311] (-674.523) (-671.625) (-674.360) * [-677.535] (-671.382) (-674.298) (-673.912) -- 0:01:02
      242500 -- (-671.397) (-671.621) [-672.231] (-673.992) * (-678.905) (-672.337) (-676.148) [-674.903] -- 0:01:02
      243000 -- (-674.431) (-672.329) [-673.597] (-671.243) * (-672.735) (-671.396) (-675.656) [-673.337] -- 0:01:02
      243500 -- (-671.342) [-675.527] (-672.193) (-673.137) * [-671.252] (-674.740) (-675.085) (-675.638) -- 0:01:02
      244000 -- (-673.021) (-673.725) (-671.508) [-672.705] * (-675.080) (-676.080) (-674.877) [-671.824] -- 0:01:05
      244500 -- [-672.819] (-675.645) (-671.693) (-672.206) * (-672.619) [-674.400] (-673.883) (-675.785) -- 0:01:04
      245000 -- (-671.281) [-673.854] (-672.308) (-672.749) * (-673.193) (-677.435) (-672.314) [-672.831] -- 0:01:04

      Average standard deviation of split frequencies: 0.015781

      245500 -- (-672.973) (-677.884) [-672.186] (-674.349) * [-672.372] (-675.618) (-674.380) (-673.337) -- 0:01:04
      246000 -- (-677.469) [-673.761] (-674.571) (-671.616) * (-673.008) (-673.000) (-672.814) [-679.084] -- 0:01:04
      246500 -- (-674.866) [-673.390] (-671.473) (-671.748) * (-672.502) (-672.641) [-671.141] (-673.547) -- 0:01:04
      247000 -- [-673.481] (-674.130) (-675.077) (-675.036) * (-672.877) (-672.786) (-676.965) [-673.662] -- 0:01:04
      247500 -- [-673.219] (-676.808) (-672.634) (-677.320) * [-671.007] (-671.896) (-672.358) (-678.581) -- 0:01:03
      248000 -- (-674.395) (-674.300) (-673.587) [-677.074] * (-671.576) (-671.784) (-677.750) [-673.250] -- 0:01:03
      248500 -- (-673.436) [-676.398] (-671.584) (-676.093) * (-673.164) (-674.235) [-674.758] (-677.220) -- 0:01:03
      249000 -- [-672.559] (-670.933) (-672.857) (-675.246) * (-671.802) (-675.770) [-671.685] (-672.083) -- 0:01:03
      249500 -- (-672.242) (-673.401) (-671.161) [-673.372] * (-671.469) (-673.109) (-670.682) [-671.380] -- 0:01:03
      250000 -- (-671.693) (-672.490) [-674.402] (-672.469) * (-672.318) (-675.465) [-672.846] (-672.698) -- 0:01:03

      Average standard deviation of split frequencies: 0.014934

      250500 -- (-673.286) [-671.333] (-672.136) (-673.195) * (-671.673) (-675.043) [-673.200] (-671.460) -- 0:01:02
      251000 -- (-672.604) (-676.652) [-674.523] (-671.935) * (-674.525) [-675.981] (-672.238) (-673.273) -- 0:01:02
      251500 -- [-671.118] (-674.442) (-677.650) (-673.013) * (-672.778) (-672.803) [-674.726] (-671.006) -- 0:01:02
      252000 -- [-672.172] (-672.401) (-672.327) (-671.337) * (-673.580) (-674.160) [-671.298] (-674.353) -- 0:01:02
      252500 -- [-674.196] (-673.955) (-673.466) (-675.590) * (-672.256) [-671.931] (-671.347) (-674.876) -- 0:01:02
      253000 -- (-671.732) [-672.607] (-673.432) (-673.883) * (-672.462) [-670.666] (-676.775) (-673.655) -- 0:01:02
      253500 -- (-673.339) [-673.109] (-673.735) (-674.209) * (-670.894) (-672.661) (-672.751) [-671.845] -- 0:01:01
      254000 -- [-671.505] (-674.176) (-675.560) (-673.711) * [-673.995] (-673.532) (-675.781) (-674.610) -- 0:01:01
      254500 -- [-671.808] (-674.780) (-672.677) (-673.139) * (-678.244) [-671.853] (-679.957) (-673.271) -- 0:01:01
      255000 -- (-671.514) [-671.807] (-673.068) (-673.242) * (-676.940) (-671.835) (-679.613) [-672.053] -- 0:01:01

      Average standard deviation of split frequencies: 0.014081

      255500 -- (-672.062) (-672.926) (-671.617) [-673.406] * (-672.635) (-670.812) (-671.901) [-671.728] -- 0:01:01
      256000 -- (-672.708) (-670.898) (-676.887) [-672.443] * (-672.399) (-671.076) [-670.617] (-671.936) -- 0:01:03
      256500 -- [-671.762] (-671.502) (-678.335) (-672.657) * (-672.516) (-671.739) [-671.759] (-672.904) -- 0:01:03
      257000 -- (-670.537) [-671.241] (-675.748) (-671.242) * [-675.598] (-673.444) (-673.588) (-673.115) -- 0:01:03
      257500 -- (-671.387) [-672.897] (-674.089) (-673.437) * (-673.689) [-674.755] (-674.111) (-671.554) -- 0:01:03
      258000 -- [-671.418] (-671.172) (-674.124) (-678.491) * (-673.796) (-671.015) (-674.301) [-672.659] -- 0:01:03
      258500 -- [-670.645] (-675.548) (-672.276) (-677.342) * (-673.026) (-673.989) [-672.311] (-672.664) -- 0:01:03
      259000 -- (-671.406) (-671.470) [-674.610] (-675.309) * (-673.119) (-675.335) (-672.876) [-673.901] -- 0:01:02
      259500 -- (-675.797) [-673.237] (-673.875) (-673.186) * (-675.562) [-673.744] (-672.805) (-673.158) -- 0:01:02
      260000 -- (-670.660) [-672.145] (-670.955) (-674.364) * [-673.998] (-674.208) (-673.754) (-671.949) -- 0:01:02

      Average standard deviation of split frequencies: 0.013829

      260500 -- (-673.050) (-674.012) [-672.050] (-674.547) * (-671.466) [-671.469] (-673.740) (-676.355) -- 0:01:02
      261000 -- [-671.073] (-673.296) (-672.435) (-672.742) * (-672.050) (-671.628) [-672.611] (-673.134) -- 0:01:02
      261500 -- [-670.782] (-672.651) (-676.304) (-672.565) * [-673.680] (-677.365) (-671.891) (-675.730) -- 0:01:02
      262000 -- (-670.990) [-674.601] (-678.422) (-673.468) * [-671.643] (-679.671) (-671.760) (-672.799) -- 0:01:01
      262500 -- [-673.294] (-674.731) (-671.814) (-672.131) * [-671.794] (-671.485) (-672.838) (-672.392) -- 0:01:01
      263000 -- (-673.159) (-674.942) [-670.976] (-671.824) * (-677.229) (-671.389) [-677.345] (-677.055) -- 0:01:01
      263500 -- [-673.118] (-671.568) (-672.564) (-675.208) * (-675.337) (-673.115) (-675.541) [-673.570] -- 0:01:01
      264000 -- [-673.237] (-672.104) (-674.752) (-673.628) * (-674.291) (-673.311) (-673.273) [-674.622] -- 0:01:01
      264500 -- [-672.698] (-672.143) (-673.796) (-673.541) * [-672.174] (-673.972) (-675.983) (-676.352) -- 0:01:01
      265000 -- [-671.334] (-672.255) (-674.991) (-674.118) * [-673.208] (-671.964) (-674.694) (-677.042) -- 0:01:01

      Average standard deviation of split frequencies: 0.014276

      265500 -- (-674.489) (-672.515) (-674.720) [-678.158] * (-674.738) (-671.135) (-674.896) [-671.598] -- 0:01:00
      266000 -- (-672.302) (-670.991) (-674.571) [-674.731] * [-672.128] (-675.142) (-673.928) (-672.869) -- 0:01:00
      266500 -- (-672.461) (-670.837) [-672.371] (-671.255) * (-677.322) (-672.916) (-673.657) [-671.917] -- 0:01:00
      267000 -- (-673.140) (-670.708) [-675.145] (-670.762) * (-673.613) [-676.875] (-675.179) (-671.732) -- 0:01:00
      267500 -- (-671.809) (-672.579) [-674.670] (-676.212) * (-674.210) (-672.334) [-672.011] (-670.779) -- 0:01:00
      268000 -- (-671.788) (-673.729) (-672.549) [-675.699] * (-675.087) (-674.137) [-673.179] (-673.099) -- 0:01:00
      268500 -- (-673.870) (-674.049) (-672.396) [-672.020] * (-680.634) (-678.321) [-672.759] (-673.588) -- 0:01:02
      269000 -- [-672.539] (-672.182) (-672.339) (-672.326) * (-673.724) [-671.943] (-671.407) (-671.956) -- 0:01:02
      269500 -- (-672.412) [-671.379] (-675.739) (-671.230) * (-673.716) (-673.464) (-674.237) [-675.655] -- 0:01:02
      270000 -- (-671.598) (-672.742) (-673.527) [-671.545] * (-674.468) (-674.100) [-670.895] (-675.322) -- 0:01:02

      Average standard deviation of split frequencies: 0.013011

      270500 -- (-671.429) (-673.569) (-671.592) [-671.123] * (-674.290) (-673.751) (-672.069) [-672.896] -- 0:01:02
      271000 -- [-671.697] (-671.536) (-674.771) (-673.394) * [-674.355] (-673.552) (-672.668) (-676.880) -- 0:01:01
      271500 -- [-671.556] (-674.112) (-674.013) (-673.321) * (-671.481) [-671.935] (-675.467) (-676.884) -- 0:01:01
      272000 -- (-671.006) (-673.687) [-671.425] (-674.133) * (-673.259) [-673.123] (-673.098) (-671.985) -- 0:01:01
      272500 -- [-672.760] (-675.030) (-674.003) (-679.873) * (-675.713) [-672.406] (-671.805) (-673.164) -- 0:01:01
      273000 -- [-673.509] (-674.425) (-673.163) (-674.626) * (-672.454) (-670.726) [-675.394] (-675.733) -- 0:01:01
      273500 -- (-677.707) (-679.801) [-678.957] (-674.388) * (-672.985) (-672.701) (-672.987) [-671.959] -- 0:01:01
      274000 -- (-672.514) (-673.682) (-676.540) [-673.989] * (-672.867) (-674.744) [-672.702] (-674.975) -- 0:01:00
      274500 -- (-674.888) (-674.087) [-677.833] (-674.169) * (-674.392) (-672.987) [-670.806] (-672.729) -- 0:01:00
      275000 -- (-673.911) [-672.995] (-675.794) (-672.139) * (-671.005) (-673.059) [-670.554] (-675.050) -- 0:01:00

      Average standard deviation of split frequencies: 0.013759

      275500 -- (-671.273) [-673.300] (-674.680) (-671.317) * (-674.954) (-673.415) [-673.142] (-673.865) -- 0:01:00
      276000 -- (-674.049) (-674.242) (-675.086) [-674.792] * (-671.856) (-671.945) (-672.063) [-672.297] -- 0:01:00
      276500 -- (-674.317) (-671.235) (-672.639) [-672.194] * (-672.737) (-672.114) [-675.844] (-672.819) -- 0:01:00
      277000 -- (-671.452) (-673.205) [-671.237] (-670.475) * [-675.200] (-671.897) (-676.223) (-674.634) -- 0:01:00
      277500 -- (-671.562) (-671.823) [-675.512] (-670.448) * [-671.952] (-673.705) (-671.471) (-673.930) -- 0:00:59
      278000 -- (-671.518) (-672.355) (-675.659) [-670.635] * (-672.429) (-675.133) (-670.907) [-671.487] -- 0:00:59
      278500 -- (-671.298) (-671.590) [-672.082] (-671.863) * [-672.465] (-676.800) (-670.927) (-672.359) -- 0:00:59
      279000 -- (-673.744) (-673.652) (-671.836) [-671.888] * (-673.662) (-672.891) (-671.013) [-673.437] -- 0:00:59
      279500 -- (-674.903) [-674.030] (-673.601) (-672.091) * (-673.684) (-671.168) (-672.865) [-671.015] -- 0:00:59
      280000 -- (-673.448) (-674.207) [-671.886] (-672.779) * (-672.849) (-671.629) [-671.370] (-674.350) -- 0:00:59

      Average standard deviation of split frequencies: 0.013437

      280500 -- [-674.109] (-678.047) (-673.078) (-672.709) * [-673.079] (-672.887) (-676.861) (-672.941) -- 0:01:01
      281000 -- (-672.350) (-672.246) (-671.571) [-672.398] * (-673.698) (-672.091) [-672.906] (-672.265) -- 0:01:01
      281500 -- (-674.820) (-675.990) [-671.606] (-674.134) * [-670.678] (-670.899) (-673.164) (-671.364) -- 0:01:01
      282000 -- (-674.863) (-677.545) [-672.447] (-674.900) * (-671.282) (-672.180) [-670.699] (-671.425) -- 0:01:01
      282500 -- (-673.472) (-671.818) [-672.168] (-677.018) * (-674.241) (-671.968) (-673.749) [-670.940] -- 0:01:00
      283000 -- (-672.821) [-674.014] (-672.842) (-673.855) * (-676.314) (-671.326) (-673.551) [-673.145] -- 0:01:00
      283500 -- (-673.803) [-674.180] (-675.374) (-673.725) * (-672.444) [-672.222] (-675.902) (-671.791) -- 0:01:00
      284000 -- (-673.749) (-671.832) (-670.643) [-675.259] * (-672.459) (-673.128) [-672.434] (-671.792) -- 0:01:00
      284500 -- (-674.055) (-672.571) [-671.145] (-673.673) * [-674.838] (-672.080) (-671.995) (-671.724) -- 0:01:00
      285000 -- (-673.345) (-671.932) (-671.100) [-673.177] * [-671.436] (-672.426) (-672.041) (-673.294) -- 0:01:00

      Average standard deviation of split frequencies: 0.013369

      285500 -- (-672.455) [-672.610] (-673.701) (-674.479) * [-673.379] (-671.161) (-672.997) (-676.320) -- 0:01:00
      286000 -- (-671.256) (-672.995) [-672.605] (-671.261) * (-672.639) (-672.157) [-672.594] (-675.858) -- 0:00:59
      286500 -- [-672.897] (-673.687) (-672.544) (-672.816) * (-674.652) (-672.817) [-672.043] (-672.251) -- 0:00:59
      287000 -- (-671.840) (-671.154) [-672.232] (-677.880) * [-670.466] (-673.469) (-671.296) (-671.768) -- 0:00:59
      287500 -- (-670.892) (-671.069) (-674.547) [-673.423] * (-673.524) (-671.988) (-673.428) [-672.846] -- 0:00:59
      288000 -- (-674.863) (-672.158) (-674.105) [-671.043] * (-676.986) (-672.433) (-677.834) [-673.665] -- 0:00:59
      288500 -- (-679.165) [-670.579] (-673.248) (-671.805) * (-676.851) [-674.435] (-671.241) (-673.660) -- 0:00:59
      289000 -- [-672.174] (-673.773) (-672.469) (-674.604) * (-675.789) (-678.858) (-673.510) [-674.546] -- 0:00:59
      289500 -- [-674.365] (-671.256) (-674.570) (-672.994) * (-675.004) (-677.528) (-671.074) [-671.276] -- 0:00:58
      290000 -- (-671.518) [-670.642] (-675.335) (-675.003) * (-672.763) (-675.800) (-672.723) [-671.773] -- 0:00:58

      Average standard deviation of split frequencies: 0.013731

      290500 -- (-672.099) [-670.935] (-673.422) (-675.186) * [-673.055] (-672.221) (-675.540) (-675.818) -- 0:00:58
      291000 -- (-672.180) (-671.499) [-672.488] (-673.296) * [-672.534] (-672.149) (-673.700) (-675.167) -- 0:00:58
      291500 -- (-673.540) [-671.610] (-672.551) (-671.095) * [-671.466] (-675.748) (-674.028) (-674.433) -- 0:01:00
      292000 -- (-678.598) [-672.631] (-673.862) (-674.769) * (-676.345) [-675.694] (-673.006) (-671.400) -- 0:01:00
      292500 -- (-673.310) (-671.265) (-673.904) [-674.146] * (-673.173) (-672.620) (-674.732) [-676.067] -- 0:01:00
      293000 -- (-673.933) (-672.852) (-671.732) [-675.428] * [-675.363] (-674.939) (-675.557) (-671.377) -- 0:01:00
      293500 -- [-675.334] (-671.745) (-673.076) (-672.047) * [-674.246] (-672.324) (-671.884) (-674.480) -- 0:01:00
      294000 -- [-672.643] (-670.774) (-671.668) (-671.773) * (-673.972) [-671.630] (-672.467) (-672.194) -- 0:01:00
      294500 -- [-672.517] (-674.751) (-671.960) (-672.148) * (-672.818) (-672.588) (-671.723) [-672.390] -- 0:00:59
      295000 -- [-673.051] (-674.784) (-672.191) (-670.931) * [-672.468] (-672.268) (-673.282) (-675.540) -- 0:00:59

      Average standard deviation of split frequencies: 0.014546

      295500 -- (-673.122) [-670.660] (-672.388) (-674.449) * (-673.101) (-672.807) (-676.216) [-675.900] -- 0:00:59
      296000 -- (-674.233) (-672.588) (-672.564) [-678.143] * (-671.827) (-673.553) [-673.397] (-674.592) -- 0:00:59
      296500 -- (-675.939) (-674.755) [-673.404] (-674.590) * [-671.620] (-670.856) (-674.537) (-671.235) -- 0:00:59
      297000 -- (-673.280) (-672.690) [-672.357] (-674.382) * (-671.704) (-671.727) [-673.452] (-672.940) -- 0:00:59
      297500 -- (-672.780) [-672.097] (-672.246) (-672.988) * (-671.659) (-676.204) (-672.633) [-673.751] -- 0:00:59
      298000 -- (-672.208) (-671.511) (-672.575) [-670.679] * (-671.888) (-673.776) [-675.992] (-675.042) -- 0:00:58
      298500 -- (-674.661) [-671.659] (-672.646) (-670.725) * [-673.951] (-672.821) (-674.604) (-671.302) -- 0:00:58
      299000 -- (-671.796) (-671.356) (-672.258) [-677.408] * (-672.236) [-672.950] (-674.236) (-673.397) -- 0:00:58
      299500 -- (-673.759) [-673.246] (-671.955) (-672.708) * (-672.790) (-672.873) (-672.547) [-671.250] -- 0:00:58
      300000 -- (-673.902) [-674.173] (-671.274) (-674.593) * (-671.477) (-674.136) (-672.896) [-673.678] -- 0:00:58

      Average standard deviation of split frequencies: 0.014738

      300500 -- (-672.323) (-672.149) (-676.276) [-671.371] * [-671.292] (-672.341) (-671.753) (-671.638) -- 0:00:58
      301000 -- (-674.052) [-672.623] (-673.824) (-672.949) * (-673.829) [-670.954] (-672.431) (-671.069) -- 0:00:58
      301500 -- (-673.291) (-674.677) (-672.510) [-671.431] * [-672.141] (-671.067) (-671.596) (-670.815) -- 0:00:57
      302000 -- [-674.213] (-674.104) (-674.576) (-673.265) * (-674.328) (-672.304) [-674.234] (-674.345) -- 0:00:57
      302500 -- (-672.728) (-672.666) (-673.573) [-672.899] * [-672.358] (-672.850) (-675.384) (-674.841) -- 0:00:57
      303000 -- (-672.591) [-672.730] (-674.162) (-672.821) * [-673.152] (-676.446) (-672.574) (-673.695) -- 0:00:57
      303500 -- (-674.470) (-672.761) [-673.469] (-673.749) * (-674.613) (-673.725) (-673.217) [-671.377] -- 0:00:57
      304000 -- (-674.110) [-673.846] (-672.456) (-672.104) * (-672.773) (-671.659) (-670.607) [-671.474] -- 0:00:59
      304500 -- (-677.021) (-673.982) (-671.659) [-672.245] * (-671.276) [-673.271] (-671.018) (-671.498) -- 0:00:59
      305000 -- (-676.364) [-672.986] (-672.116) (-671.500) * (-672.272) (-673.030) [-672.269] (-677.128) -- 0:00:59

      Average standard deviation of split frequencies: 0.014995

      305500 -- (-674.873) [-672.303] (-675.292) (-673.615) * [-675.043] (-680.778) (-674.703) (-675.290) -- 0:00:59
      306000 -- (-675.281) (-674.464) (-671.817) [-671.985] * (-674.516) (-672.076) (-673.333) [-672.573] -- 0:00:58
      306500 -- [-672.316] (-670.875) (-671.305) (-671.704) * (-670.655) (-674.654) (-672.405) [-673.023] -- 0:00:58
      307000 -- (-671.818) (-672.662) [-670.913] (-670.888) * (-671.811) (-674.388) [-671.016] (-673.581) -- 0:00:58
      307500 -- (-673.326) (-672.269) [-673.260] (-673.609) * (-673.577) (-672.136) [-673.680] (-671.963) -- 0:00:58
      308000 -- (-676.468) (-671.723) [-671.187] (-675.377) * (-671.462) (-675.252) [-671.776] (-673.548) -- 0:00:58
      308500 -- (-673.673) (-670.896) [-672.969] (-672.535) * (-676.440) [-671.779] (-671.961) (-672.153) -- 0:00:58
      309000 -- [-672.539] (-672.933) (-670.986) (-673.511) * (-674.292) (-670.945) (-675.158) [-672.825] -- 0:00:58
      309500 -- [-671.508] (-673.734) (-671.817) (-672.240) * (-674.600) (-671.745) [-670.574] (-673.039) -- 0:00:58
      310000 -- [-672.923] (-672.252) (-673.229) (-673.683) * (-672.273) [-673.404] (-670.833) (-675.416) -- 0:00:57

      Average standard deviation of split frequencies: 0.015073

      310500 -- (-673.811) (-674.070) [-673.087] (-673.007) * (-680.543) [-671.561] (-671.948) (-682.231) -- 0:00:57
      311000 -- (-673.499) [-673.972] (-671.413) (-675.090) * (-673.797) (-671.778) [-674.282] (-677.645) -- 0:00:57
      311500 -- (-672.070) (-671.779) (-672.459) [-672.521] * (-673.035) (-672.158) (-671.835) [-677.451] -- 0:00:57
      312000 -- (-671.962) (-674.223) [-671.761] (-671.510) * (-673.800) [-672.133] (-671.778) (-673.137) -- 0:00:57
      312500 -- (-672.731) (-673.909) (-671.174) [-670.798] * (-671.558) (-674.675) (-671.707) [-673.014] -- 0:00:57
      313000 -- (-670.911) (-672.851) [-673.890] (-673.319) * (-673.836) [-674.250] (-672.624) (-675.524) -- 0:00:57
      313500 -- (-675.163) (-672.889) [-672.503] (-671.421) * (-673.758) (-671.841) (-672.314) [-672.145] -- 0:00:56
      314000 -- (-672.160) (-673.660) (-672.574) [-674.848] * (-675.163) (-671.916) [-672.492] (-672.549) -- 0:00:56
      314500 -- (-672.084) (-674.578) [-672.935] (-673.775) * [-671.882] (-674.618) (-672.777) (-674.551) -- 0:00:56
      315000 -- (-672.658) (-674.172) (-674.109) [-672.567] * (-671.341) [-673.546] (-674.007) (-675.373) -- 0:00:56

      Average standard deviation of split frequencies: 0.014918

      315500 -- [-672.522] (-673.871) (-672.808) (-672.448) * (-673.737) (-672.080) [-671.539] (-671.865) -- 0:00:56
      316000 -- (-671.561) [-674.086] (-674.645) (-671.605) * (-673.039) [-672.954] (-670.948) (-670.917) -- 0:00:58
      316500 -- (-671.221) (-671.890) (-673.597) [-676.879] * (-673.227) (-671.213) (-673.794) [-675.029] -- 0:00:58
      317000 -- [-672.384] (-671.941) (-672.327) (-673.912) * (-676.008) (-671.264) [-670.985] (-674.591) -- 0:00:58
      317500 -- [-672.150] (-671.418) (-674.931) (-673.287) * (-679.530) [-671.048] (-673.335) (-674.014) -- 0:00:58
      318000 -- (-674.362) (-672.625) [-671.839] (-679.429) * (-673.385) [-670.908] (-671.791) (-677.378) -- 0:00:57
      318500 -- [-674.601] (-676.349) (-676.239) (-678.170) * [-673.998] (-674.254) (-671.134) (-672.651) -- 0:00:57
      319000 -- [-673.416] (-671.791) (-673.883) (-678.629) * [-672.258] (-673.227) (-672.279) (-671.757) -- 0:00:57
      319500 -- (-674.188) [-672.426] (-676.115) (-672.185) * [-673.026] (-676.509) (-674.250) (-674.499) -- 0:00:57
      320000 -- (-673.374) (-672.609) [-672.159] (-673.589) * [-671.943] (-673.517) (-674.353) (-672.735) -- 0:00:57

      Average standard deviation of split frequencies: 0.013917

      320500 -- (-671.425) (-673.295) (-674.260) [-672.450] * (-673.681) (-671.291) [-675.165] (-672.838) -- 0:00:57
      321000 -- (-673.710) (-672.125) [-673.503] (-673.842) * [-671.085] (-671.815) (-672.135) (-674.766) -- 0:00:57
      321500 -- [-673.252] (-670.813) (-671.560) (-673.922) * (-670.984) (-671.348) [-673.782] (-672.334) -- 0:00:56
      322000 -- (-673.513) (-672.226) (-670.880) [-670.856] * (-672.538) (-676.529) [-670.739] (-674.773) -- 0:00:56
      322500 -- (-673.058) (-670.689) (-670.898) [-675.042] * (-672.947) (-675.441) (-671.219) [-674.192] -- 0:00:56
      323000 -- (-674.544) (-671.820) (-676.216) [-672.828] * (-675.897) [-673.526] (-671.712) (-673.440) -- 0:00:56
      323500 -- [-674.575] (-673.274) (-678.055) (-673.176) * (-674.570) (-672.657) (-673.985) [-673.111] -- 0:00:56
      324000 -- (-674.187) (-671.451) [-673.336] (-674.945) * (-672.106) [-674.210] (-672.454) (-674.097) -- 0:00:56
      324500 -- (-674.278) (-673.540) [-674.930] (-674.618) * [-671.789] (-674.233) (-673.840) (-673.569) -- 0:00:56
      325000 -- (-671.472) (-675.307) (-672.119) [-675.998] * (-671.461) (-676.527) (-671.909) [-672.125] -- 0:00:56

      Average standard deviation of split frequencies: 0.013014

      325500 -- (-673.191) (-672.871) (-672.350) [-674.510] * (-673.809) (-672.839) [-671.567] (-672.100) -- 0:00:55
      326000 -- (-673.832) [-671.104] (-671.677) (-678.551) * (-671.708) [-673.911] (-671.767) (-671.451) -- 0:00:55
      326500 -- [-672.993] (-672.824) (-672.531) (-674.233) * [-672.845] (-672.025) (-671.725) (-675.936) -- 0:00:55
      327000 -- [-670.813] (-673.122) (-671.675) (-675.132) * (-677.450) (-672.977) [-671.184] (-678.417) -- 0:00:55
      327500 -- [-671.448] (-672.808) (-671.612) (-673.039) * [-670.987] (-672.377) (-671.423) (-671.298) -- 0:00:55
      328000 -- (-672.692) (-675.712) (-673.293) [-671.544] * [-671.598] (-672.358) (-673.018) (-673.445) -- 0:00:55
      328500 -- (-670.917) (-674.957) [-673.482] (-675.616) * (-671.244) [-672.225] (-674.047) (-678.295) -- 0:00:57
      329000 -- [-670.983] (-672.668) (-673.865) (-671.834) * (-672.876) [-675.681] (-673.863) (-671.335) -- 0:00:57
      329500 -- (-671.077) (-677.247) (-676.092) [-671.429] * [-673.391] (-674.291) (-671.755) (-672.852) -- 0:00:56
      330000 -- (-673.438) (-673.292) (-673.151) [-672.336] * (-675.816) [-675.100] (-672.800) (-676.754) -- 0:00:56

      Average standard deviation of split frequencies: 0.013989

      330500 -- (-671.842) (-674.119) (-673.554) [-671.687] * [-673.566] (-673.306) (-671.502) (-676.419) -- 0:00:56
      331000 -- (-673.974) (-671.988) [-673.584] (-679.979) * (-676.047) (-671.836) (-671.252) [-676.300] -- 0:00:56
      331500 -- (-671.110) (-671.262) [-671.541] (-672.100) * (-673.215) (-673.902) (-678.306) [-671.851] -- 0:00:56
      332000 -- [-670.886] (-672.553) (-671.447) (-676.243) * (-673.556) [-674.878] (-676.640) (-671.387) -- 0:00:56
      332500 -- [-673.556] (-671.212) (-671.357) (-673.659) * (-674.355) [-674.153] (-673.175) (-672.490) -- 0:00:56
      333000 -- [-672.142] (-672.693) (-672.728) (-674.731) * (-672.362) (-675.381) [-672.733] (-672.458) -- 0:00:56
      333500 -- (-671.475) (-671.943) (-673.395) [-671.393] * (-672.025) [-671.411] (-671.436) (-673.672) -- 0:00:55
      334000 -- [-673.072] (-672.264) (-673.146) (-672.584) * [-675.649] (-671.112) (-671.668) (-670.896) -- 0:00:55
      334500 -- (-671.943) (-672.569) (-671.879) [-672.902] * [-672.195] (-671.884) (-674.138) (-676.139) -- 0:00:55
      335000 -- [-671.659] (-671.084) (-671.924) (-671.971) * (-672.196) (-671.600) (-673.748) [-675.988] -- 0:00:55

      Average standard deviation of split frequencies: 0.014404

      335500 -- [-672.146] (-674.538) (-671.463) (-675.821) * (-672.029) (-674.441) [-673.235] (-673.306) -- 0:00:55
      336000 -- [-671.612] (-674.596) (-672.044) (-672.230) * (-673.382) [-674.137] (-674.726) (-676.205) -- 0:00:55
      336500 -- (-671.071) (-671.163) (-672.115) [-671.893] * (-675.405) (-673.793) (-671.287) [-672.876] -- 0:00:55
      337000 -- (-671.072) [-673.509] (-672.772) (-672.595) * [-671.977] (-672.225) (-672.406) (-674.008) -- 0:00:55
      337500 -- (-672.301) (-672.415) (-671.717) [-676.736] * (-672.790) (-675.005) (-672.595) [-673.896] -- 0:00:54
      338000 -- (-672.978) [-673.121] (-671.044) (-673.080) * (-674.555) (-676.737) (-671.329) [-674.989] -- 0:00:54
      338500 -- (-673.431) (-671.345) (-674.422) [-671.822] * [-671.482] (-672.008) (-676.056) (-673.229) -- 0:00:54
      339000 -- (-673.586) [-673.087] (-672.193) (-673.693) * (-675.463) (-673.384) (-673.485) [-674.402] -- 0:00:54
      339500 -- (-672.627) (-672.438) [-672.068] (-670.773) * (-676.883) [-674.053] (-676.602) (-671.978) -- 0:00:54
      340000 -- (-672.789) (-675.688) (-671.785) [-671.686] * (-673.302) (-673.668) [-673.974] (-674.215) -- 0:00:54

      Average standard deviation of split frequencies: 0.013561

      340500 -- [-671.295] (-672.107) (-671.675) (-672.133) * (-671.346) [-674.407] (-671.676) (-672.160) -- 0:00:56
      341000 -- (-671.437) [-671.526] (-675.354) (-671.339) * (-671.572) [-672.660] (-672.756) (-674.814) -- 0:00:56
      341500 -- (-671.020) (-671.368) [-672.129] (-675.144) * (-671.607) (-670.785) [-674.701] (-672.977) -- 0:00:55
      342000 -- (-671.233) (-672.262) [-671.946] (-676.343) * (-673.412) (-672.181) (-672.771) [-677.346] -- 0:00:55
      342500 -- [-672.286] (-673.319) (-672.789) (-673.652) * (-672.392) (-674.597) (-673.578) [-673.135] -- 0:00:55
      343000 -- (-673.633) (-676.523) (-671.913) [-673.188] * (-671.161) (-672.768) (-671.417) [-674.065] -- 0:00:55
      343500 -- (-677.236) [-672.379] (-671.144) (-670.818) * (-671.281) (-672.253) (-672.595) [-671.235] -- 0:00:55
      344000 -- (-674.204) (-671.686) [-678.335] (-675.562) * (-671.981) (-675.467) (-676.687) [-673.240] -- 0:00:55
      344500 -- (-673.757) (-671.789) [-672.506] (-672.860) * (-672.801) (-677.227) [-672.644] (-676.084) -- 0:00:55
      345000 -- [-675.152] (-673.935) (-674.838) (-673.617) * (-671.581) (-678.537) [-674.812] (-671.894) -- 0:00:55

      Average standard deviation of split frequencies: 0.013369

      345500 -- [-672.053] (-671.992) (-671.753) (-673.993) * (-672.760) (-673.874) (-676.095) [-674.708] -- 0:00:54
      346000 -- (-675.149) [-672.432] (-679.283) (-672.412) * [-672.078] (-670.953) (-678.203) (-672.369) -- 0:00:54
      346500 -- (-671.892) [-673.457] (-679.827) (-672.885) * (-673.244) [-670.659] (-671.472) (-673.907) -- 0:00:54
      347000 -- [-671.314] (-671.276) (-672.649) (-675.091) * (-672.327) (-671.440) [-672.722] (-675.574) -- 0:00:54
      347500 -- [-673.755] (-673.014) (-672.805) (-674.990) * (-673.533) [-671.648] (-671.865) (-674.249) -- 0:00:54
      348000 -- (-674.306) [-671.475] (-672.983) (-675.260) * (-672.260) [-672.372] (-672.359) (-677.461) -- 0:00:54
      348500 -- [-673.372] (-673.569) (-673.934) (-673.347) * [-676.139] (-671.721) (-672.359) (-673.247) -- 0:00:54
      349000 -- (-674.360) [-675.136] (-673.699) (-676.066) * (-675.119) (-672.345) [-671.610] (-674.901) -- 0:00:54
      349500 -- [-672.567] (-675.000) (-675.613) (-673.489) * (-674.094) [-672.563] (-677.451) (-673.235) -- 0:00:53
      350000 -- [-673.466] (-672.545) (-673.675) (-674.510) * (-673.393) (-672.903) [-677.797] (-673.938) -- 0:00:53

      Average standard deviation of split frequencies: 0.012969

      350500 -- (-674.258) [-671.152] (-672.180) (-672.762) * (-672.032) [-671.312] (-684.898) (-674.467) -- 0:00:53
      351000 -- (-673.299) [-672.672] (-674.101) (-674.068) * (-671.357) (-674.744) (-673.346) [-672.909] -- 0:00:53
      351500 -- (-673.869) (-674.116) (-671.722) [-671.346] * (-674.682) (-674.563) [-675.839] (-674.959) -- 0:00:53
      352000 -- (-671.494) (-673.267) [-676.976] (-672.399) * (-671.214) (-676.492) [-671.414] (-673.229) -- 0:00:53
      352500 -- (-675.790) (-671.272) [-673.939] (-673.800) * [-672.593] (-671.628) (-672.083) (-675.619) -- 0:00:53
      353000 -- [-672.277] (-672.557) (-673.853) (-681.384) * (-673.493) [-673.820] (-672.906) (-672.268) -- 0:00:54
      353500 -- [-671.520] (-673.469) (-674.857) (-673.610) * (-672.813) (-672.452) [-671.826] (-671.729) -- 0:00:54
      354000 -- (-672.407) (-672.562) [-671.716] (-672.027) * [-672.310] (-672.887) (-671.545) (-672.366) -- 0:00:54
      354500 -- (-673.832) [-671.718] (-671.112) (-671.159) * (-675.593) (-671.050) (-671.427) [-673.334] -- 0:00:54
      355000 -- (-672.322) (-673.242) [-675.720] (-672.865) * (-672.760) [-670.844] (-671.464) (-674.753) -- 0:00:54

      Average standard deviation of split frequencies: 0.013242

      355500 -- (-672.236) [-671.018] (-674.529) (-675.823) * (-672.099) [-671.698] (-670.754) (-674.897) -- 0:00:54
      356000 -- [-673.013] (-674.085) (-671.893) (-672.183) * (-672.368) [-671.058] (-671.534) (-674.545) -- 0:00:54
      356500 -- [-672.285] (-675.812) (-670.961) (-672.005) * (-672.511) (-671.183) (-672.456) [-670.785] -- 0:00:54
      357000 -- (-677.201) (-676.594) (-671.484) [-672.997] * [-673.677] (-676.320) (-676.416) (-672.089) -- 0:00:54
      357500 -- (-676.455) [-672.871] (-676.307) (-674.204) * (-677.988) (-672.562) (-671.361) [-674.395] -- 0:00:53
      358000 -- (-673.526) [-674.080] (-672.515) (-671.322) * (-677.496) (-675.393) [-673.966] (-675.193) -- 0:00:53
      358500 -- (-677.582) (-677.496) [-672.634] (-673.479) * (-675.107) (-670.924) (-674.392) [-672.335] -- 0:00:53
      359000 -- [-673.965] (-671.630) (-671.928) (-672.639) * (-674.258) [-670.767] (-671.251) (-670.939) -- 0:00:53
      359500 -- (-673.001) (-672.986) (-671.662) [-671.934] * (-677.257) [-672.713] (-681.554) (-673.029) -- 0:00:53
      360000 -- (-671.158) [-670.795] (-671.224) (-671.886) * (-677.300) (-673.321) (-674.623) [-671.091] -- 0:00:53

      Average standard deviation of split frequencies: 0.012809

      360500 -- [-672.637] (-674.076) (-673.322) (-671.169) * (-672.377) [-673.561] (-672.586) (-673.354) -- 0:00:53
      361000 -- [-673.037] (-671.638) (-672.143) (-676.118) * (-670.993) (-672.126) [-673.582] (-672.970) -- 0:00:53
      361500 -- (-672.475) [-673.021] (-671.116) (-671.620) * (-671.107) [-673.927] (-673.331) (-671.774) -- 0:00:52
      362000 -- [-673.710] (-672.584) (-672.438) (-673.795) * (-672.348) (-672.268) [-677.047] (-671.374) -- 0:00:52
      362500 -- (-672.616) (-671.637) (-674.560) [-673.295] * (-673.332) (-672.221) (-672.670) [-672.876] -- 0:00:52
      363000 -- [-671.862] (-674.845) (-675.171) (-673.048) * (-673.343) [-672.224] (-672.329) (-674.500) -- 0:00:52
      363500 -- (-671.997) (-671.536) [-673.952] (-673.514) * (-672.940) [-674.614] (-673.346) (-674.997) -- 0:00:52
      364000 -- [-670.883] (-671.998) (-671.038) (-674.509) * (-673.629) (-673.484) [-672.985] (-672.292) -- 0:00:52
      364500 -- (-673.859) (-674.539) (-671.503) [-673.106] * [-672.921] (-671.304) (-671.511) (-673.065) -- 0:00:52
      365000 -- (-671.488) (-670.999) [-672.133] (-677.997) * (-672.065) [-670.476] (-672.134) (-673.344) -- 0:00:52

      Average standard deviation of split frequencies: 0.011592

      365500 -- (-673.768) (-671.561) (-676.971) [-672.597] * [-673.006] (-670.401) (-674.773) (-671.752) -- 0:00:53
      366000 -- [-672.128] (-671.983) (-672.100) (-675.600) * (-670.443) (-670.964) (-674.638) [-670.889] -- 0:00:53
      366500 -- (-675.903) [-670.846] (-671.665) (-673.771) * (-670.639) (-671.090) (-677.064) [-671.733] -- 0:00:53
      367000 -- [-671.894] (-672.412) (-672.257) (-672.683) * (-671.386) [-673.364] (-676.629) (-674.884) -- 0:00:53
      367500 -- (-676.586) (-672.460) (-674.995) [-671.494] * [-673.525] (-672.483) (-680.261) (-672.622) -- 0:00:53
      368000 -- (-672.160) (-672.121) (-672.849) [-672.393] * (-675.584) [-671.694] (-673.390) (-674.954) -- 0:00:53
      368500 -- (-673.581) (-674.583) (-675.188) [-672.453] * (-671.444) (-678.739) [-670.844] (-677.471) -- 0:00:53
      369000 -- (-673.720) (-674.125) [-676.022] (-673.447) * (-675.179) (-673.939) [-674.954] (-677.666) -- 0:00:53
      369500 -- (-675.084) (-674.096) [-676.349] (-674.236) * (-676.060) (-671.125) (-674.639) [-671.060] -- 0:00:52
      370000 -- (-674.446) (-674.648) (-672.728) [-672.415] * (-676.503) (-673.185) [-673.749] (-673.122) -- 0:00:52

      Average standard deviation of split frequencies: 0.012643

      370500 -- [-676.206] (-675.525) (-672.207) (-676.697) * (-671.185) (-671.214) (-675.067) [-671.246] -- 0:00:52
      371000 -- (-676.770) (-674.438) [-672.283] (-671.366) * (-672.991) (-674.486) [-673.041] (-671.584) -- 0:00:52
      371500 -- [-671.677] (-675.039) (-671.279) (-671.869) * (-673.365) (-670.699) (-674.580) [-672.953] -- 0:00:52
      372000 -- [-671.654] (-674.444) (-674.326) (-674.190) * (-671.420) (-673.552) (-672.393) [-673.381] -- 0:00:52
      372500 -- (-671.537) (-676.342) [-674.898] (-671.134) * (-671.841) [-673.168] (-677.818) (-674.003) -- 0:00:52
      373000 -- (-674.305) [-671.580] (-673.769) (-674.128) * [-674.935] (-673.979) (-674.573) (-673.992) -- 0:00:52
      373500 -- (-671.710) (-672.158) (-674.330) [-671.835] * (-672.874) (-671.985) [-676.926] (-670.745) -- 0:00:51
      374000 -- (-671.608) (-675.598) (-672.801) [-673.970] * [-671.206] (-674.633) (-671.879) (-671.969) -- 0:00:51
      374500 -- (-672.147) (-677.550) (-678.076) [-674.721] * (-670.912) (-673.820) (-672.327) [-671.869] -- 0:00:51
      375000 -- (-673.740) (-677.696) (-676.824) [-671.827] * (-671.539) (-671.744) (-673.103) [-673.222] -- 0:00:51

      Average standard deviation of split frequencies: 0.012169

      375500 -- (-676.740) [-675.562] (-673.102) (-677.717) * (-671.339) (-673.803) (-672.659) [-671.694] -- 0:00:51
      376000 -- (-673.100) (-676.072) (-672.933) [-674.890] * (-673.457) (-670.873) [-676.485] (-671.562) -- 0:00:51
      376500 -- [-671.955] (-675.527) (-680.051) (-675.260) * (-672.049) [-672.571] (-673.593) (-671.871) -- 0:00:51
      377000 -- (-676.507) (-675.772) [-675.500] (-672.749) * (-673.317) [-671.024] (-672.213) (-676.180) -- 0:00:51
      377500 -- (-679.727) (-672.391) (-672.746) [-672.357] * (-673.292) [-672.052] (-671.888) (-673.911) -- 0:00:52
      378000 -- (-673.014) (-672.887) [-672.774] (-678.056) * [-674.092] (-675.627) (-673.309) (-672.578) -- 0:00:52
      378500 -- (-672.416) [-671.217] (-675.472) (-671.996) * (-671.939) (-678.905) [-671.928] (-670.806) -- 0:00:52
      379000 -- [-671.223] (-672.463) (-671.392) (-674.419) * [-671.566] (-677.914) (-671.226) (-672.216) -- 0:00:52
      379500 -- [-671.711] (-671.597) (-672.220) (-674.946) * (-674.071) [-674.080] (-674.839) (-674.412) -- 0:00:52
      380000 -- [-672.886] (-673.177) (-672.162) (-673.429) * [-671.360] (-679.613) (-673.670) (-671.402) -- 0:00:52

      Average standard deviation of split frequencies: 0.011582

      380500 -- [-672.934] (-673.540) (-673.600) (-674.350) * [-671.990] (-671.218) (-673.672) (-674.069) -- 0:00:52
      381000 -- (-672.131) (-670.786) [-672.835] (-671.518) * (-677.164) [-674.459] (-674.296) (-671.003) -- 0:00:51
      381500 -- (-672.342) [-671.943] (-677.133) (-670.571) * (-673.386) (-674.611) [-672.292] (-671.173) -- 0:00:51
      382000 -- (-672.034) [-671.853] (-671.689) (-674.424) * [-675.210] (-674.397) (-680.597) (-671.527) -- 0:00:51
      382500 -- (-670.958) [-672.141] (-673.797) (-671.486) * [-673.365] (-676.121) (-675.006) (-672.897) -- 0:00:51
      383000 -- (-673.961) (-671.831) (-672.323) [-672.105] * (-671.318) (-672.734) (-674.022) [-672.290] -- 0:00:51
      383500 -- (-671.433) [-671.788] (-674.290) (-672.363) * (-672.811) (-675.381) (-671.272) [-671.323] -- 0:00:51
      384000 -- [-671.923] (-671.582) (-679.825) (-671.444) * (-678.743) [-671.379] (-673.426) (-672.841) -- 0:00:51
      384500 -- (-675.971) [-673.605] (-676.600) (-673.149) * [-678.810] (-671.216) (-671.985) (-672.320) -- 0:00:51
      385000 -- (-678.461) (-675.079) [-671.289] (-673.431) * (-677.941) (-671.419) [-672.475] (-671.970) -- 0:00:51

      Average standard deviation of split frequencies: 0.011710

      385500 -- [-672.641] (-671.599) (-673.740) (-672.588) * (-674.484) (-675.018) [-675.326] (-671.250) -- 0:00:51
      386000 -- (-674.923) [-672.243] (-679.023) (-673.289) * (-672.985) (-675.337) [-671.632] (-675.073) -- 0:00:50
      386500 -- (-670.813) (-672.871) (-673.456) [-676.096] * [-673.120] (-675.713) (-671.600) (-670.964) -- 0:00:50
      387000 -- (-672.533) (-675.210) (-673.205) [-672.383] * (-673.958) [-674.808] (-671.124) (-676.123) -- 0:00:50
      387500 -- (-671.837) [-672.138] (-674.316) (-675.149) * (-672.442) [-672.162] (-672.388) (-676.266) -- 0:00:50
      388000 -- [-671.769] (-674.600) (-674.177) (-675.410) * [-671.879] (-679.456) (-675.091) (-671.997) -- 0:00:50
      388500 -- [-673.149] (-677.935) (-673.589) (-676.268) * (-674.113) (-672.470) (-670.789) [-672.928] -- 0:00:50
      389000 -- (-671.329) (-673.056) (-675.964) [-673.864] * (-674.536) [-672.235] (-672.017) (-673.349) -- 0:00:50
      389500 -- [-672.808] (-672.210) (-673.687) (-673.261) * (-674.379) [-671.480] (-672.202) (-675.160) -- 0:00:51
      390000 -- [-671.922] (-673.356) (-673.216) (-673.863) * (-670.994) (-672.182) (-672.423) [-671.994] -- 0:00:51

      Average standard deviation of split frequencies: 0.011783

      390500 -- (-671.330) [-672.711] (-675.890) (-675.076) * (-672.444) (-674.888) (-672.125) [-672.385] -- 0:00:51
      391000 -- (-673.283) (-679.244) [-673.417] (-674.399) * (-674.352) (-672.505) (-671.995) [-671.259] -- 0:00:51
      391500 -- (-671.517) (-673.761) [-672.367] (-676.844) * (-671.042) (-671.315) [-671.464] (-671.788) -- 0:00:51
      392000 -- (-672.651) (-672.241) [-672.740] (-674.602) * [-670.969] (-672.255) (-675.784) (-671.999) -- 0:00:51
      392500 -- (-673.425) (-672.714) (-673.445) [-672.911] * (-671.288) [-670.899] (-673.360) (-672.362) -- 0:00:51
      393000 -- (-671.600) (-672.577) [-672.402] (-674.369) * (-671.432) [-675.283] (-671.130) (-671.086) -- 0:00:50
      393500 -- (-671.148) (-671.511) (-671.219) [-671.074] * (-673.933) (-677.444) [-672.765] (-673.438) -- 0:00:50
      394000 -- (-674.858) (-675.154) (-673.634) [-673.208] * (-673.018) (-674.840) [-672.223] (-671.296) -- 0:00:50
      394500 -- [-672.964] (-676.921) (-671.295) (-675.086) * (-672.226) (-673.082) [-670.956] (-671.221) -- 0:00:50
      395000 -- (-673.876) (-674.296) [-670.517] (-673.452) * (-672.074) [-672.723] (-674.571) (-672.890) -- 0:00:50

      Average standard deviation of split frequencies: 0.011694

      395500 -- (-672.903) (-676.172) (-672.908) [-672.533] * [-672.989] (-671.191) (-671.385) (-672.145) -- 0:00:50
      396000 -- (-671.365) (-673.318) [-670.964] (-676.235) * (-672.600) (-672.974) [-671.127] (-670.877) -- 0:00:50
      396500 -- (-671.364) [-673.458] (-676.165) (-670.941) * (-674.488) (-672.454) (-673.196) [-673.389] -- 0:00:50
      397000 -- [-673.036] (-672.498) (-672.404) (-672.171) * [-671.703] (-673.013) (-676.947) (-672.352) -- 0:00:50
      397500 -- (-673.331) (-671.356) [-671.934] (-672.729) * (-674.090) [-672.320] (-675.373) (-672.024) -- 0:00:50
      398000 -- (-671.637) (-672.929) [-671.891] (-671.628) * (-672.549) (-671.075) (-674.455) [-675.261] -- 0:00:49
      398500 -- (-671.313) (-673.689) (-672.840) [-670.846] * (-671.504) (-672.244) [-671.644] (-672.233) -- 0:00:49
      399000 -- [-671.264] (-672.652) (-676.174) (-672.849) * (-672.551) (-674.514) [-678.831] (-672.880) -- 0:00:49
      399500 -- [-672.959] (-674.745) (-672.870) (-672.060) * (-671.426) [-673.770] (-679.824) (-672.164) -- 0:00:49
      400000 -- (-671.191) (-671.274) (-679.127) [-673.229] * (-673.539) [-673.234] (-673.082) (-670.837) -- 0:00:49

      Average standard deviation of split frequencies: 0.011489

      400500 -- [-671.086] (-670.892) (-673.704) (-672.503) * [-673.691] (-673.742) (-674.008) (-672.887) -- 0:00:49
      401000 -- [-672.658] (-676.400) (-674.279) (-671.627) * (-674.740) [-675.434] (-671.291) (-673.056) -- 0:00:49
      401500 -- (-671.514) (-675.415) (-673.408) [-671.517] * [-674.527] (-674.671) (-673.718) (-671.283) -- 0:00:50
      402000 -- [-671.908] (-674.634) (-674.734) (-671.640) * (-671.434) (-671.726) [-670.775] (-671.691) -- 0:00:50
      402500 -- [-673.854] (-677.959) (-673.332) (-671.926) * [-671.943] (-673.412) (-671.954) (-672.668) -- 0:00:50
      403000 -- [-671.866] (-673.460) (-674.245) (-672.168) * (-672.859) (-672.731) [-671.592] (-673.626) -- 0:00:50
      403500 -- (-672.616) [-671.184] (-674.886) (-671.985) * [-671.499] (-673.790) (-672.244) (-671.502) -- 0:00:50
      404000 -- (-671.724) (-675.630) (-674.158) [-673.924] * (-674.098) (-673.585) (-673.749) [-673.187] -- 0:00:50
      404500 -- (-675.724) (-671.726) (-675.120) [-672.989] * [-674.719] (-675.689) (-674.389) (-670.691) -- 0:00:50
      405000 -- (-673.739) (-677.854) (-672.168) [-671.879] * [-672.875] (-673.633) (-674.004) (-673.654) -- 0:00:49

      Average standard deviation of split frequencies: 0.010966

      405500 -- (-675.840) (-671.707) [-674.112] (-675.613) * (-674.945) (-671.901) (-673.507) [-672.815] -- 0:00:49
      406000 -- (-675.969) (-674.146) [-674.714] (-671.881) * (-671.637) (-671.517) (-673.009) [-675.467] -- 0:00:49
      406500 -- [-676.107] (-672.322) (-673.562) (-670.868) * [-673.273] (-674.237) (-675.192) (-672.353) -- 0:00:49
      407000 -- (-671.654) [-673.327] (-672.161) (-671.427) * [-672.383] (-670.802) (-674.240) (-672.080) -- 0:00:49
      407500 -- [-671.774] (-672.735) (-671.691) (-671.054) * (-673.632) [-671.774] (-673.494) (-672.006) -- 0:00:49
      408000 -- (-670.961) (-671.915) [-672.132] (-673.276) * (-673.649) (-671.605) (-672.981) [-672.356] -- 0:00:49
      408500 -- (-677.350) (-672.375) [-673.627] (-674.724) * (-679.006) (-671.980) (-672.962) [-672.158] -- 0:00:49
      409000 -- (-671.487) (-671.119) [-674.505] (-675.411) * [-671.279] (-673.399) (-672.124) (-672.230) -- 0:00:49
      409500 -- (-673.312) [-671.800] (-672.007) (-673.949) * (-672.653) (-671.574) (-673.189) [-676.242] -- 0:00:49
      410000 -- (-673.327) (-673.771) (-680.383) [-673.406] * (-674.341) (-671.741) (-671.617) [-675.167] -- 0:00:48

      Average standard deviation of split frequencies: 0.010669

      410500 -- (-675.054) (-673.625) [-673.376] (-671.007) * (-671.060) (-673.220) [-671.505] (-672.413) -- 0:00:48
      411000 -- (-678.451) (-673.081) (-672.910) [-671.548] * (-672.114) (-676.093) (-670.924) [-673.586] -- 0:00:48
      411500 -- (-674.033) (-671.968) [-672.788] (-672.242) * (-672.800) [-675.499] (-677.365) (-671.938) -- 0:00:48
      412000 -- (-674.307) [-672.529] (-671.724) (-682.434) * (-675.041) [-672.713] (-672.097) (-673.974) -- 0:00:48
      412500 -- (-678.806) (-670.680) [-672.331] (-674.786) * [-673.021] (-672.964) (-671.516) (-671.752) -- 0:00:48
      413000 -- (-674.174) [-671.427] (-672.294) (-672.069) * (-673.200) (-675.669) [-674.439] (-671.684) -- 0:00:48
      413500 -- (-675.511) (-670.733) (-672.516) [-672.496] * [-674.599] (-672.164) (-673.822) (-671.223) -- 0:00:48
      414000 -- (-672.069) (-673.242) [-673.223] (-676.121) * (-672.281) [-674.512] (-673.546) (-670.481) -- 0:00:49
      414500 -- [-671.958] (-673.575) (-674.171) (-673.374) * (-672.704) (-670.549) (-672.559) [-672.666] -- 0:00:49
      415000 -- (-671.265) (-674.717) (-671.763) [-671.772] * [-672.294] (-673.151) (-674.420) (-672.911) -- 0:00:49

      Average standard deviation of split frequencies: 0.009999

      415500 -- [-673.625] (-675.331) (-673.564) (-673.097) * (-676.297) (-676.818) [-671.561] (-675.737) -- 0:00:49
      416000 -- [-678.657] (-673.638) (-673.634) (-673.836) * (-674.292) [-674.650] (-672.583) (-672.545) -- 0:00:49
      416500 -- (-676.101) [-671.876] (-670.932) (-671.872) * (-676.254) [-673.207] (-671.728) (-672.118) -- 0:00:49
      417000 -- [-673.976] (-671.811) (-671.586) (-672.614) * (-673.010) (-672.060) [-672.048] (-672.018) -- 0:00:48
      417500 -- [-671.850] (-674.728) (-672.521) (-673.104) * [-672.454] (-672.292) (-675.435) (-672.729) -- 0:00:48
      418000 -- (-675.552) (-673.246) [-673.212] (-673.612) * (-672.471) (-673.413) [-673.828] (-671.349) -- 0:00:48
      418500 -- (-673.949) (-674.414) [-672.802] (-677.342) * (-671.757) (-671.141) (-673.242) [-672.589] -- 0:00:48
      419000 -- [-673.323] (-674.784) (-672.293) (-671.964) * (-670.768) (-674.729) [-677.509] (-671.626) -- 0:00:48
      419500 -- [-673.265] (-672.689) (-672.026) (-672.951) * (-670.847) (-672.179) (-671.455) [-673.286] -- 0:00:48
      420000 -- (-672.895) [-673.593] (-671.493) (-674.721) * (-671.898) (-671.858) (-671.986) [-671.166] -- 0:00:48

      Average standard deviation of split frequencies: 0.009945

      420500 -- (-673.689) (-673.152) (-670.949) [-671.414] * (-671.622) (-672.834) [-673.481] (-671.978) -- 0:00:48
      421000 -- (-680.213) [-672.373] (-670.982) (-672.428) * [-675.084] (-674.920) (-672.001) (-673.651) -- 0:00:48
      421500 -- (-671.083) (-672.982) (-671.878) [-671.146] * (-672.898) (-676.316) [-674.759] (-671.331) -- 0:00:48
      422000 -- (-671.170) [-672.214] (-672.476) (-671.039) * (-670.956) (-672.996) [-672.286] (-671.230) -- 0:00:47
      422500 -- (-671.170) (-670.879) (-679.737) [-671.397] * (-673.842) [-678.171] (-673.328) (-672.547) -- 0:00:47
      423000 -- (-672.133) [-673.316] (-678.685) (-673.756) * [-674.458] (-672.817) (-673.291) (-673.013) -- 0:00:47
      423500 -- (-671.696) (-675.566) [-672.253] (-672.369) * (-674.365) [-674.519] (-672.523) (-673.869) -- 0:00:47
      424000 -- (-671.164) [-672.491] (-672.576) (-672.569) * (-672.308) (-672.237) [-673.805] (-677.785) -- 0:00:47
      424500 -- (-672.698) (-673.241) [-672.052] (-671.761) * [-672.447] (-671.750) (-674.533) (-674.707) -- 0:00:47
      425000 -- (-671.267) (-672.467) [-674.849] (-674.604) * (-673.543) (-671.059) [-672.338] (-670.843) -- 0:00:47

      Average standard deviation of split frequencies: 0.010167

      425500 -- (-671.455) (-672.584) [-671.935] (-674.132) * [-673.030] (-670.976) (-674.534) (-670.936) -- 0:00:47
      426000 -- (-672.413) [-671.378] (-675.121) (-673.490) * (-672.313) (-671.726) [-671.765] (-671.713) -- 0:00:48
      426500 -- (-674.196) (-674.625) [-677.649] (-673.057) * (-674.003) [-674.238] (-670.765) (-671.508) -- 0:00:48
      427000 -- [-670.635] (-672.869) (-673.259) (-673.202) * [-674.334] (-672.485) (-676.412) (-676.673) -- 0:00:48
      427500 -- (-670.927) (-672.942) (-673.282) [-671.768] * (-675.130) (-674.635) [-673.118] (-671.664) -- 0:00:48
      428000 -- (-672.441) [-673.731] (-678.213) (-673.597) * (-676.715) (-671.560) [-673.131] (-670.645) -- 0:00:48
      428500 -- (-672.049) (-672.687) (-674.253) [-672.839] * (-671.764) (-673.581) [-673.060] (-671.927) -- 0:00:48
      429000 -- (-672.296) (-674.726) [-671.902] (-673.957) * [-673.726] (-674.769) (-673.777) (-673.258) -- 0:00:47
      429500 -- (-674.608) [-672.770] (-671.444) (-671.413) * (-675.428) (-673.021) (-671.955) [-673.887] -- 0:00:47
      430000 -- (-674.028) (-673.080) (-673.668) [-672.501] * (-675.878) (-673.175) [-671.902] (-671.585) -- 0:00:47

      Average standard deviation of split frequencies: 0.009465

      430500 -- (-674.896) [-672.384] (-672.373) (-672.321) * (-672.050) (-674.848) [-671.280] (-671.706) -- 0:00:47
      431000 -- [-674.327] (-672.481) (-674.259) (-673.047) * (-682.976) [-672.512] (-671.437) (-672.588) -- 0:00:47
      431500 -- (-675.598) (-673.775) [-672.983] (-673.007) * [-673.808] (-671.786) (-672.903) (-672.876) -- 0:00:47
      432000 -- (-671.808) (-673.608) [-672.849] (-672.814) * (-670.871) (-671.517) (-672.596) [-671.159] -- 0:00:47
      432500 -- (-674.255) (-673.567) (-671.783) [-671.590] * (-671.367) (-672.190) [-672.325] (-671.755) -- 0:00:47
      433000 -- [-674.137] (-671.415) (-672.433) (-672.853) * (-674.406) [-671.855] (-672.881) (-676.753) -- 0:00:47
      433500 -- [-674.895] (-674.181) (-672.377) (-675.840) * (-678.761) [-673.131] (-673.658) (-674.952) -- 0:00:47
      434000 -- (-673.744) [-673.134] (-673.099) (-681.183) * [-672.230] (-670.568) (-671.736) (-671.520) -- 0:00:46
      434500 -- [-670.707] (-673.133) (-673.800) (-672.492) * [-672.413] (-670.801) (-673.526) (-672.536) -- 0:00:46
      435000 -- (-672.537) (-672.905) [-674.223] (-672.807) * (-672.823) (-675.017) (-672.782) [-671.809] -- 0:00:46

      Average standard deviation of split frequencies: 0.009958

      435500 -- [-673.701] (-673.608) (-672.293) (-673.078) * (-672.601) (-675.436) (-673.134) [-673.167] -- 0:00:46
      436000 -- (-672.327) [-675.858] (-672.122) (-672.858) * [-673.799] (-671.603) (-674.559) (-672.900) -- 0:00:46
      436500 -- (-675.963) (-672.216) [-674.486] (-674.295) * (-670.821) (-670.888) (-674.168) [-671.046] -- 0:00:46
      437000 -- [-676.553] (-674.774) (-675.002) (-672.985) * (-671.985) (-673.470) [-673.223] (-670.669) -- 0:00:46
      437500 -- (-672.593) (-671.850) [-671.347] (-671.968) * [-672.843] (-673.610) (-673.243) (-670.669) -- 0:00:46
      438000 -- (-673.266) (-674.723) (-670.911) [-671.113] * [-672.997] (-673.704) (-671.679) (-672.316) -- 0:00:47
      438500 -- (-672.927) (-671.272) [-671.431] (-671.361) * (-671.706) [-672.299] (-673.976) (-672.683) -- 0:00:47
      439000 -- (-675.045) (-676.433) [-672.098] (-671.261) * (-674.557) (-671.166) (-671.936) [-672.362] -- 0:00:47
      439500 -- (-672.517) [-671.824] (-673.096) (-673.219) * (-675.897) (-670.693) (-673.585) [-672.545] -- 0:00:47
      440000 -- (-673.325) [-671.498] (-670.826) (-671.210) * (-676.072) (-672.951) (-673.113) [-671.158] -- 0:00:47

      Average standard deviation of split frequencies: 0.009925

      440500 -- (-671.205) [-672.955] (-672.578) (-671.585) * (-674.599) [-670.696] (-674.614) (-674.609) -- 0:00:46
      441000 -- (-670.807) (-673.524) [-676.149] (-672.650) * [-673.410] (-671.710) (-675.255) (-670.939) -- 0:00:46
      441500 -- (-671.511) (-674.200) (-678.942) [-671.778] * [-675.416] (-671.377) (-672.253) (-670.955) -- 0:00:46
      442000 -- [-670.538] (-676.737) (-673.465) (-671.135) * [-674.106] (-671.215) (-671.317) (-671.664) -- 0:00:46
      442500 -- [-671.575] (-680.227) (-677.117) (-674.251) * (-676.060) (-673.741) [-672.295] (-671.191) -- 0:00:46
      443000 -- (-671.527) (-673.492) [-672.623] (-674.914) * (-670.867) (-673.613) (-674.709) [-673.516] -- 0:00:46
      443500 -- [-671.645] (-674.078) (-671.508) (-675.888) * [-671.667] (-676.560) (-673.053) (-675.121) -- 0:00:46
      444000 -- (-672.770) (-675.666) (-671.126) [-672.069] * [-672.106] (-674.315) (-676.696) (-671.087) -- 0:00:46
      444500 -- (-674.529) (-674.052) (-675.499) [-671.535] * (-672.448) (-674.826) [-675.307] (-672.059) -- 0:00:46
      445000 -- [-675.064] (-673.031) (-671.857) (-671.446) * [-674.693] (-673.288) (-673.512) (-673.121) -- 0:00:46

      Average standard deviation of split frequencies: 0.010217

      445500 -- (-672.505) (-670.879) [-673.629] (-671.611) * (-671.196) [-672.471] (-673.917) (-671.714) -- 0:00:46
      446000 -- (-672.896) (-673.583) [-672.780] (-671.999) * (-670.734) (-672.059) [-672.913] (-671.177) -- 0:00:45
      446500 -- (-672.174) [-671.796] (-671.484) (-671.728) * [-671.564] (-671.265) (-673.269) (-671.276) -- 0:00:45
      447000 -- (-675.632) (-673.531) (-671.604) [-671.573] * (-671.826) (-672.767) [-671.655] (-675.795) -- 0:00:45
      447500 -- [-676.384] (-671.083) (-670.632) (-672.171) * (-673.209) (-672.772) [-671.279] (-673.141) -- 0:00:45
      448000 -- (-673.487) (-671.756) [-673.405] (-671.606) * (-672.837) [-673.175] (-677.499) (-673.749) -- 0:00:45
      448500 -- (-673.593) [-671.224] (-676.790) (-671.987) * [-672.167] (-678.263) (-675.900) (-672.444) -- 0:00:45
      449000 -- (-670.780) (-674.814) (-676.020) [-671.642] * (-674.196) (-673.768) [-673.856] (-671.273) -- 0:00:45
      449500 -- (-674.067) [-673.321] (-672.023) (-681.967) * (-674.094) (-672.912) (-670.873) [-673.773] -- 0:00:45
      450000 -- (-674.762) (-672.056) (-673.019) [-672.580] * (-676.001) [-674.708] (-673.004) (-674.074) -- 0:00:45

      Average standard deviation of split frequencies: 0.010228

      450500 -- (-672.957) (-674.966) [-671.780] (-672.881) * (-671.907) (-673.786) (-671.563) [-671.299] -- 0:00:46
      451000 -- (-676.390) (-672.165) [-672.950] (-673.657) * [-673.463] (-673.770) (-675.496) (-675.129) -- 0:00:46
      451500 -- (-677.130) (-675.394) [-672.248] (-678.844) * (-672.652) (-675.168) (-678.320) [-672.465] -- 0:00:46
      452000 -- [-677.425] (-673.727) (-672.139) (-675.677) * (-671.586) (-671.540) (-674.021) [-673.574] -- 0:00:46
      452500 -- [-673.069] (-671.038) (-673.596) (-671.371) * (-671.023) (-674.202) (-675.342) [-671.367] -- 0:00:45
      453000 -- (-673.018) (-671.679) (-674.134) [-672.255] * [-671.819] (-671.650) (-674.013) (-672.968) -- 0:00:45
      453500 -- (-673.014) [-672.310] (-674.850) (-672.213) * (-672.244) (-672.105) (-676.776) [-671.461] -- 0:00:45
      454000 -- [-670.967] (-673.070) (-672.145) (-673.140) * (-676.973) (-672.864) (-673.829) [-672.058] -- 0:00:45
      454500 -- (-672.844) [-673.696] (-671.091) (-671.722) * (-672.349) (-674.780) [-672.167] (-674.445) -- 0:00:45
      455000 -- [-673.469] (-673.782) (-671.362) (-672.600) * (-674.651) (-671.348) (-672.092) [-678.844] -- 0:00:45

      Average standard deviation of split frequencies: 0.009247

      455500 -- (-672.356) (-672.637) (-670.608) [-673.434] * (-670.676) (-676.208) [-674.943] (-674.501) -- 0:00:45
      456000 -- (-671.520) [-672.082] (-670.709) (-672.989) * (-672.235) [-673.573] (-671.661) (-674.373) -- 0:00:45
      456500 -- [-671.208] (-673.151) (-674.375) (-672.584) * [-670.584] (-673.194) (-674.580) (-672.704) -- 0:00:45
      457000 -- [-675.139] (-672.449) (-672.424) (-671.913) * (-670.619) (-673.827) (-672.795) [-674.333] -- 0:00:45
      457500 -- (-672.544) (-673.529) [-671.465] (-674.174) * (-673.762) (-672.198) (-678.915) [-673.786] -- 0:00:45
      458000 -- (-673.161) (-672.285) (-671.980) [-675.422] * (-673.625) [-672.165] (-673.872) (-675.665) -- 0:00:44
      458500 -- [-674.728] (-672.493) (-672.819) (-675.325) * (-673.698) [-671.040] (-673.622) (-671.620) -- 0:00:44
      459000 -- (-673.699) (-675.544) [-672.936] (-672.169) * (-671.249) (-673.757) (-671.746) [-672.066] -- 0:00:44
      459500 -- (-673.540) [-672.349] (-675.845) (-672.881) * (-672.956) [-672.864] (-675.394) (-672.049) -- 0:00:44
      460000 -- [-672.674] (-679.423) (-671.285) (-672.287) * (-674.324) [-673.607] (-672.212) (-671.079) -- 0:00:44

      Average standard deviation of split frequencies: 0.009082

      460500 -- [-676.168] (-676.551) (-675.688) (-676.217) * (-672.715) [-673.291] (-671.564) (-670.986) -- 0:00:44
      461000 -- (-674.356) (-673.330) [-673.935] (-674.952) * (-671.873) (-678.108) (-672.728) [-671.927] -- 0:00:44
      461500 -- (-674.021) [-675.369] (-679.390) (-674.724) * (-673.599) (-676.384) (-674.426) [-670.915] -- 0:00:44
      462000 -- (-672.924) (-672.918) [-673.723] (-673.887) * (-672.043) [-680.162] (-672.378) (-672.907) -- 0:00:44
      462500 -- (-673.687) (-675.867) [-673.722] (-671.707) * (-671.747) [-675.339] (-671.824) (-675.943) -- 0:00:45
      463000 -- (-672.175) (-674.266) (-673.684) [-673.348] * [-673.277] (-674.484) (-671.642) (-676.306) -- 0:00:45
      463500 -- [-670.700] (-671.793) (-672.525) (-671.831) * (-671.416) [-672.803] (-674.913) (-672.480) -- 0:00:45
      464000 -- (-672.856) (-674.258) [-671.620] (-671.025) * (-671.589) (-671.646) [-675.696] (-681.600) -- 0:00:45
      464500 -- (-676.781) (-671.886) (-674.285) [-671.598] * (-675.338) [-673.101] (-671.106) (-676.512) -- 0:00:44
      465000 -- [-672.986] (-671.739) (-672.142) (-674.620) * [-672.507] (-677.320) (-673.629) (-674.628) -- 0:00:44

      Average standard deviation of split frequencies: 0.009878

      465500 -- [-671.320] (-671.362) (-675.656) (-672.953) * (-675.424) (-675.666) (-671.574) [-671.127] -- 0:00:44
      466000 -- [-670.913] (-672.437) (-674.744) (-673.691) * (-676.450) (-672.724) [-673.303] (-670.934) -- 0:00:44
      466500 -- (-671.133) (-671.161) [-671.293] (-672.012) * [-674.136] (-671.800) (-672.355) (-671.737) -- 0:00:44
      467000 -- (-671.643) (-672.302) (-673.423) [-674.769] * (-674.385) (-672.390) [-672.970] (-671.668) -- 0:00:44
      467500 -- (-671.235) [-672.127] (-675.008) (-672.670) * (-679.327) [-673.710] (-671.536) (-671.868) -- 0:00:44
      468000 -- (-671.142) (-671.217) [-673.082] (-671.036) * [-672.271] (-673.711) (-671.682) (-670.790) -- 0:00:44
      468500 -- (-672.634) (-672.902) [-672.659] (-672.079) * (-674.561) (-673.281) [-671.906] (-672.294) -- 0:00:44
      469000 -- (-676.708) (-673.955) (-672.770) [-676.052] * [-671.972] (-674.997) (-672.435) (-674.013) -- 0:00:44
      469500 -- [-672.889] (-673.459) (-675.002) (-677.390) * (-671.211) [-672.599] (-670.620) (-673.472) -- 0:00:44
      470000 -- (-671.645) (-675.424) [-672.088] (-671.269) * (-674.347) [-674.373] (-673.747) (-672.295) -- 0:00:43

      Average standard deviation of split frequencies: 0.009682

      470500 -- [-673.442] (-675.111) (-674.073) (-671.751) * [-673.579] (-673.038) (-673.404) (-672.318) -- 0:00:43
      471000 -- (-672.043) (-672.383) (-671.740) [-670.966] * (-670.630) [-673.522] (-671.882) (-671.643) -- 0:00:43
      471500 -- (-673.819) (-673.190) (-671.146) [-672.822] * [-671.045] (-673.807) (-672.839) (-679.614) -- 0:00:43
      472000 -- (-675.019) (-671.883) (-673.689) [-675.651] * (-673.344) (-676.552) [-671.867] (-673.633) -- 0:00:43
      472500 -- (-671.219) (-673.297) [-671.658] (-676.338) * [-672.807] (-672.130) (-673.122) (-673.862) -- 0:00:43
      473000 -- [-673.497] (-672.522) (-673.352) (-673.375) * (-675.743) [-671.027] (-674.808) (-672.022) -- 0:00:43
      473500 -- (-673.738) [-673.182] (-676.076) (-674.815) * (-672.639) [-671.999] (-675.376) (-672.264) -- 0:00:43
      474000 -- (-673.854) [-675.060] (-678.260) (-674.635) * (-674.309) (-671.564) [-675.889] (-672.959) -- 0:00:43
      474500 -- (-673.686) [-672.519] (-672.974) (-676.306) * (-671.865) (-672.506) [-673.149] (-672.864) -- 0:00:44
      475000 -- (-677.268) (-672.929) [-680.153] (-674.465) * (-674.217) (-673.853) [-671.679] (-678.456) -- 0:00:44

      Average standard deviation of split frequencies: 0.009379

      475500 -- (-677.823) (-671.467) [-674.264] (-673.149) * (-673.223) (-676.783) [-672.831] (-675.036) -- 0:00:44
      476000 -- (-674.418) (-674.660) [-672.195] (-672.585) * [-674.501] (-673.087) (-674.190) (-680.348) -- 0:00:44
      476500 -- [-671.169] (-674.822) (-673.892) (-672.483) * (-675.412) (-674.349) (-673.005) [-672.815] -- 0:00:43
      477000 -- [-675.091] (-672.667) (-677.908) (-677.975) * (-673.085) (-672.380) [-674.020] (-674.961) -- 0:00:43
      477500 -- (-678.275) [-672.539] (-676.755) (-675.584) * (-678.852) (-675.031) (-671.252) [-671.731] -- 0:00:43
      478000 -- (-673.634) [-672.794] (-672.052) (-672.182) * (-674.713) (-672.297) [-672.799] (-672.768) -- 0:00:43
      478500 -- (-672.371) (-674.649) [-673.602] (-672.497) * (-673.884) (-671.364) (-671.994) [-672.069] -- 0:00:43
      479000 -- (-670.713) [-675.374] (-671.730) (-674.370) * (-672.849) [-673.411] (-671.405) (-670.612) -- 0:00:43
      479500 -- (-674.546) [-674.648] (-671.524) (-672.261) * [-671.072] (-674.338) (-671.883) (-672.120) -- 0:00:43
      480000 -- [-672.459] (-672.162) (-674.245) (-672.694) * (-671.118) (-673.915) [-672.933] (-671.865) -- 0:00:43

      Average standard deviation of split frequencies: 0.009317

      480500 -- (-674.206) [-671.331] (-675.532) (-672.120) * [-671.225] (-673.530) (-674.055) (-672.749) -- 0:00:43
      481000 -- (-672.661) (-677.817) [-674.282] (-674.221) * [-671.430] (-674.402) (-671.672) (-672.308) -- 0:00:43
      481500 -- (-671.577) [-672.107] (-672.811) (-674.139) * (-670.955) [-672.280] (-672.094) (-673.891) -- 0:00:43
      482000 -- [-672.156] (-673.443) (-673.734) (-673.268) * (-671.463) [-671.516] (-670.945) (-677.584) -- 0:00:42
      482500 -- (-672.017) (-672.916) (-672.801) [-671.522] * (-674.550) [-672.695] (-673.654) (-674.544) -- 0:00:42
      483000 -- [-673.903] (-672.618) (-673.314) (-672.379) * (-674.299) (-673.594) (-675.540) [-673.921] -- 0:00:42
      483500 -- (-680.652) (-673.656) (-671.385) [-674.140] * (-671.404) (-672.237) [-671.059] (-671.990) -- 0:00:42
      484000 -- (-676.806) [-673.648] (-671.099) (-671.167) * (-671.799) (-678.996) (-673.824) [-671.094] -- 0:00:42
      484500 -- (-672.605) (-675.296) (-673.205) [-671.864] * (-671.842) (-677.153) (-673.569) [-671.542] -- 0:00:42
      485000 -- (-674.413) (-675.136) [-676.081] (-676.231) * (-673.065) (-674.056) [-674.211] (-671.788) -- 0:00:43

      Average standard deviation of split frequencies: 0.009186

      485500 -- [-675.241] (-672.619) (-673.013) (-675.506) * (-672.550) (-673.317) (-672.814) [-672.755] -- 0:00:43
      486000 -- (-671.508) [-672.004] (-674.203) (-675.667) * (-671.174) [-670.839] (-671.951) (-671.766) -- 0:00:43
      486500 -- (-671.505) (-674.586) (-673.544) [-670.655] * [-674.012] (-671.715) (-671.387) (-673.774) -- 0:00:43
      487000 -- [-672.197] (-675.543) (-672.536) (-672.973) * (-673.307) (-672.472) (-674.849) [-673.352] -- 0:00:43
      487500 -- [-673.243] (-673.461) (-676.418) (-673.679) * (-675.214) [-673.698] (-674.433) (-671.457) -- 0:00:43
      488000 -- [-671.162] (-680.458) (-673.023) (-671.203) * (-672.945) [-672.289] (-673.370) (-674.013) -- 0:00:43
      488500 -- (-675.724) (-671.716) (-674.767) [-673.068] * (-672.613) (-672.315) [-672.127] (-671.937) -- 0:00:42
      489000 -- (-674.230) (-671.985) [-671.037] (-674.313) * (-671.676) [-675.516] (-672.373) (-671.841) -- 0:00:42
      489500 -- (-673.240) (-676.480) (-672.526) [-674.697] * [-670.886] (-673.348) (-671.639) (-673.135) -- 0:00:42
      490000 -- [-672.311] (-671.398) (-671.910) (-676.018) * (-674.040) (-671.694) [-672.616] (-672.761) -- 0:00:42

      Average standard deviation of split frequencies: 0.008816

      490500 -- (-671.527) (-672.256) (-672.512) [-673.989] * (-673.405) (-671.725) [-671.250] (-673.200) -- 0:00:42
      491000 -- (-673.601) [-672.028] (-673.234) (-672.324) * (-677.587) (-679.751) [-672.110] (-673.206) -- 0:00:42
      491500 -- (-672.379) [-672.435] (-672.697) (-671.784) * (-672.345) (-674.803) [-671.630] (-675.284) -- 0:00:42
      492000 -- (-671.460) (-672.653) (-674.195) [-672.300] * [-672.950] (-675.691) (-672.536) (-675.672) -- 0:00:42
      492500 -- (-671.474) (-673.869) (-671.383) [-673.979] * (-672.349) [-673.545] (-672.478) (-672.082) -- 0:00:42
      493000 -- (-675.360) (-672.821) [-672.521] (-677.127) * [-672.084] (-674.547) (-674.032) (-672.609) -- 0:00:42
      493500 -- (-671.539) (-673.199) (-672.799) [-671.086] * [-672.084] (-673.138) (-674.004) (-674.486) -- 0:00:42
      494000 -- (-674.600) (-672.199) (-676.192) [-672.288] * (-674.519) (-672.146) [-671.858] (-678.510) -- 0:00:41
      494500 -- [-674.162] (-673.375) (-675.013) (-671.372) * [-675.742] (-675.146) (-673.039) (-676.630) -- 0:00:41
      495000 -- (-673.377) (-675.007) [-672.803] (-673.989) * (-677.167) (-671.799) [-673.285] (-672.323) -- 0:00:41

      Average standard deviation of split frequencies: 0.008777

      495500 -- (-675.372) (-675.148) [-676.512] (-671.120) * (-674.698) (-673.306) [-671.055] (-672.052) -- 0:00:41
      496000 -- (-671.399) (-672.197) (-673.836) [-673.139] * (-673.003) (-672.286) (-674.412) [-675.696] -- 0:00:41
      496500 -- (-674.132) [-672.825] (-674.264) (-675.893) * (-672.671) (-673.024) (-677.615) [-672.011] -- 0:00:41
      497000 -- [-674.002] (-674.355) (-679.433) (-676.018) * (-672.255) (-672.143) [-672.646] (-676.149) -- 0:00:42
      497500 -- (-671.227) (-677.617) [-674.839] (-671.032) * (-673.683) (-671.372) [-672.252] (-671.724) -- 0:00:42
      498000 -- (-673.120) (-670.815) (-671.271) [-672.829] * (-671.687) (-671.365) [-672.162] (-672.019) -- 0:00:42
      498500 -- (-673.446) (-670.885) (-671.874) [-672.389] * (-673.755) [-671.473] (-672.160) (-676.206) -- 0:00:42
      499000 -- (-672.546) [-672.408] (-673.519) (-672.171) * (-673.347) [-673.918] (-672.845) (-671.934) -- 0:00:42
      499500 -- [-673.028] (-673.830) (-672.681) (-673.489) * [-671.710] (-673.025) (-672.969) (-675.679) -- 0:00:42
      500000 -- (-673.307) [-676.932] (-673.667) (-672.084) * (-673.792) [-673.087] (-674.763) (-679.782) -- 0:00:42

      Average standard deviation of split frequencies: 0.009180

      500500 -- (-674.961) (-671.548) [-672.649] (-672.720) * [-675.685] (-671.951) (-675.961) (-678.722) -- 0:00:41
      501000 -- (-673.125) (-679.527) (-675.420) [-672.471] * (-674.126) [-674.086] (-672.375) (-672.169) -- 0:00:41
      501500 -- (-671.651) (-671.139) (-672.717) [-671.385] * (-677.771) [-675.849] (-676.327) (-672.999) -- 0:00:41
      502000 -- [-674.017] (-670.898) (-671.265) (-676.940) * [-674.094] (-673.226) (-671.243) (-673.297) -- 0:00:41
      502500 -- (-673.806) [-671.651] (-672.309) (-676.177) * (-675.386) (-671.329) [-671.976] (-672.853) -- 0:00:41
      503000 -- [-673.618] (-679.759) (-672.429) (-672.017) * (-672.541) (-672.109) [-672.188] (-673.715) -- 0:00:41
      503500 -- [-672.098] (-673.404) (-671.715) (-671.312) * (-673.075) [-672.167] (-675.836) (-672.304) -- 0:00:41
      504000 -- (-674.153) [-671.729] (-673.110) (-671.906) * (-674.605) (-673.351) [-673.715] (-673.351) -- 0:00:41
      504500 -- (-671.963) (-673.997) [-676.107] (-672.736) * (-675.435) [-671.774] (-671.765) (-672.995) -- 0:00:41
      505000 -- [-672.348] (-672.924) (-678.684) (-671.208) * (-671.496) [-674.154] (-673.704) (-673.043) -- 0:00:41

      Average standard deviation of split frequencies: 0.009261

      505500 -- (-675.857) [-671.893] (-675.969) (-672.324) * (-673.621) [-671.769] (-675.699) (-675.071) -- 0:00:41
      506000 -- (-673.935) (-675.282) (-674.562) [-671.755] * (-672.806) (-674.697) [-672.054] (-671.925) -- 0:00:41
      506500 -- (-672.724) (-674.551) (-674.918) [-673.383] * (-671.475) (-673.190) (-674.969) [-674.617] -- 0:00:40
      507000 -- [-673.390] (-671.996) (-673.199) (-672.562) * (-673.473) (-673.062) [-674.405] (-675.524) -- 0:00:40
      507500 -- (-671.938) [-671.982] (-672.376) (-673.776) * [-672.825] (-674.884) (-673.562) (-670.667) -- 0:00:40
      508000 -- [-671.786] (-674.826) (-671.147) (-672.470) * [-671.171] (-672.740) (-674.541) (-673.088) -- 0:00:40
      508500 -- (-671.791) (-672.696) [-673.854] (-674.084) * (-671.741) [-672.909] (-672.350) (-679.388) -- 0:00:40
      509000 -- [-671.853] (-674.258) (-672.112) (-673.126) * (-670.805) (-672.000) [-673.857] (-672.500) -- 0:00:40
      509500 -- (-672.293) (-672.091) [-672.155] (-675.940) * (-675.303) [-670.772] (-673.534) (-674.234) -- 0:00:41
      510000 -- [-671.947] (-677.395) (-672.349) (-671.482) * (-673.690) [-673.798] (-673.357) (-671.683) -- 0:00:41

      Average standard deviation of split frequencies: 0.009828

      510500 -- (-673.041) (-674.353) [-674.242] (-674.868) * (-676.201) (-673.057) (-674.094) [-674.316] -- 0:00:41
      511000 -- [-672.209] (-672.963) (-686.367) (-679.700) * (-672.388) [-672.025] (-672.919) (-673.749) -- 0:00:41
      511500 -- (-672.458) [-673.883] (-690.227) (-673.828) * (-672.911) (-671.100) [-671.145] (-671.655) -- 0:00:41
      512000 -- (-672.143) (-671.663) (-681.703) [-675.163] * (-672.875) (-673.570) (-671.512) [-671.824] -- 0:00:40
      512500 -- [-677.550] (-671.941) (-679.215) (-671.946) * [-674.856] (-673.392) (-672.216) (-674.603) -- 0:00:40
      513000 -- [-673.542] (-674.151) (-679.028) (-672.048) * (-673.432) (-675.504) [-672.443] (-675.635) -- 0:00:40
      513500 -- (-674.667) [-672.431] (-674.137) (-674.831) * [-670.857] (-673.908) (-678.085) (-672.885) -- 0:00:40
      514000 -- (-675.258) (-674.109) [-673.922] (-671.180) * (-671.868) (-672.544) (-677.453) [-672.392] -- 0:00:40
      514500 -- (-675.772) (-673.263) [-672.139] (-672.566) * (-671.473) (-672.094) (-671.056) [-671.224] -- 0:00:40
      515000 -- (-674.185) [-674.716] (-672.800) (-676.371) * (-672.886) (-672.563) [-672.518] (-673.699) -- 0:00:40

      Average standard deviation of split frequencies: 0.009727

      515500 -- (-672.795) [-672.207] (-674.087) (-674.242) * (-672.960) (-672.724) (-676.193) [-673.680] -- 0:00:40
      516000 -- (-671.871) [-671.564] (-675.601) (-675.771) * [-673.989] (-673.254) (-671.596) (-673.497) -- 0:00:40
      516500 -- (-671.703) (-672.347) (-673.385) [-674.392] * [-671.788] (-674.287) (-674.642) (-674.199) -- 0:00:40
      517000 -- (-672.963) [-671.339] (-671.651) (-673.696) * (-670.928) (-674.803) (-675.177) [-673.429] -- 0:00:40
      517500 -- (-672.044) (-672.061) [-674.496] (-671.472) * [-672.172] (-672.298) (-672.933) (-673.900) -- 0:00:40
      518000 -- (-673.114) (-674.202) (-675.172) [-675.462] * (-673.031) (-679.823) (-673.794) [-672.349] -- 0:00:40
      518500 -- [-674.790] (-679.099) (-677.124) (-673.059) * [-671.779] (-673.026) (-671.859) (-676.063) -- 0:00:39
      519000 -- (-674.435) (-675.988) [-672.145] (-672.950) * (-673.195) (-676.538) (-672.326) [-671.921] -- 0:00:39
      519500 -- (-672.706) [-676.361] (-671.913) (-672.616) * [-672.659] (-673.822) (-676.202) (-671.722) -- 0:00:39
      520000 -- (-673.204) (-673.839) (-672.973) [-672.957] * [-671.798] (-671.874) (-671.089) (-672.760) -- 0:00:39

      Average standard deviation of split frequencies: 0.009906

      520500 -- (-671.531) (-673.191) (-673.498) [-675.266] * (-673.409) (-673.403) (-672.406) [-674.351] -- 0:00:39
      521000 -- (-671.526) (-671.803) (-672.692) [-674.057] * (-674.097) (-671.471) (-677.001) [-672.458] -- 0:00:39
      521500 -- [-673.175] (-674.430) (-675.203) (-672.535) * (-675.299) [-672.336] (-673.815) (-673.364) -- 0:00:40
      522000 -- (-675.009) [-672.297] (-671.825) (-671.895) * (-674.080) (-675.043) (-673.036) [-675.559] -- 0:00:40
      522500 -- (-673.276) (-671.919) (-672.684) [-670.629] * (-671.036) [-672.891] (-675.081) (-671.355) -- 0:00:40
      523000 -- (-674.494) (-674.629) (-673.368) [-673.636] * (-671.856) [-673.612] (-671.792) (-671.692) -- 0:00:40
      523500 -- (-672.791) (-673.717) [-672.954] (-673.068) * (-677.434) (-671.553) (-673.339) [-671.869] -- 0:00:40
      524000 -- [-672.913] (-674.621) (-672.373) (-671.122) * (-673.759) (-675.378) [-671.475] (-672.834) -- 0:00:39
      524500 -- (-675.514) [-672.187] (-675.140) (-671.881) * [-671.849] (-671.911) (-671.621) (-673.120) -- 0:00:39
      525000 -- (-673.325) (-673.346) [-673.265] (-675.227) * [-672.233] (-671.550) (-676.190) (-672.044) -- 0:00:39

      Average standard deviation of split frequencies: 0.010069

      525500 -- (-673.101) [-671.080] (-674.146) (-674.331) * (-676.266) [-670.815] (-679.034) (-675.648) -- 0:00:39
      526000 -- (-671.945) (-673.208) (-673.912) [-670.708] * [-672.138] (-672.001) (-674.398) (-674.695) -- 0:00:39
      526500 -- [-673.534] (-672.963) (-672.222) (-677.337) * [-671.638] (-671.749) (-674.018) (-672.091) -- 0:00:39
      527000 -- [-672.619] (-675.543) (-672.124) (-676.916) * (-673.417) (-674.525) [-672.368] (-674.998) -- 0:00:39
      527500 -- [-671.397] (-673.735) (-672.029) (-671.275) * [-672.690] (-672.337) (-675.362) (-675.270) -- 0:00:39
      528000 -- [-671.827] (-673.269) (-671.782) (-671.448) * (-671.576) (-670.725) [-674.096] (-673.348) -- 0:00:39
      528500 -- (-674.716) (-671.243) (-671.230) [-672.729] * [-672.991] (-674.159) (-672.182) (-672.532) -- 0:00:39
      529000 -- (-671.750) (-672.499) [-670.775] (-672.832) * (-672.435) (-674.228) [-672.727] (-673.841) -- 0:00:39
      529500 -- [-673.595] (-672.069) (-670.779) (-672.288) * (-674.801) (-672.092) [-672.597] (-671.665) -- 0:00:39
      530000 -- [-674.744] (-672.285) (-671.417) (-672.032) * (-675.286) [-672.884] (-671.783) (-673.197) -- 0:00:39

      Average standard deviation of split frequencies: 0.009667

      530500 -- (-672.997) [-671.038] (-672.457) (-672.109) * (-674.333) (-671.946) (-671.672) [-676.708] -- 0:00:38
      531000 -- (-673.867) (-670.944) [-671.811] (-672.178) * (-673.402) (-673.470) (-675.768) [-672.918] -- 0:00:38
      531500 -- (-674.802) [-671.688] (-673.249) (-672.335) * (-674.251) [-671.387] (-671.818) (-674.837) -- 0:00:38
      532000 -- (-675.197) (-673.868) (-673.144) [-671.220] * (-675.313) (-674.477) [-671.277] (-673.173) -- 0:00:38
      532500 -- (-674.882) (-673.139) [-673.727] (-674.623) * (-673.315) (-673.783) (-677.549) [-676.252] -- 0:00:38
      533000 -- (-673.697) (-671.168) [-674.681] (-672.686) * (-674.334) [-672.454] (-670.896) (-675.720) -- 0:00:38
      533500 -- [-676.015] (-672.981) (-672.788) (-671.369) * (-672.733) [-672.643] (-671.784) (-671.517) -- 0:00:38
      534000 -- [-671.855] (-672.883) (-671.375) (-672.643) * (-673.522) (-675.006) [-671.134] (-672.095) -- 0:00:39
      534500 -- [-673.024] (-676.456) (-671.498) (-673.570) * (-675.098) (-671.443) [-671.159] (-671.817) -- 0:00:39
      535000 -- (-671.493) (-673.049) [-674.447] (-677.236) * [-680.530] (-673.302) (-673.694) (-671.531) -- 0:00:39

      Average standard deviation of split frequencies: 0.009674

      535500 -- (-671.506) (-674.360) [-671.836] (-673.457) * [-670.906] (-670.664) (-674.510) (-673.149) -- 0:00:39
      536000 -- (-677.015) (-674.210) [-673.054] (-673.364) * (-671.251) (-671.840) [-670.993] (-674.752) -- 0:00:38
      536500 -- (-672.456) (-672.188) [-671.327] (-675.428) * (-674.949) (-672.970) [-671.536] (-670.719) -- 0:00:38
      537000 -- (-672.747) (-673.662) [-671.249] (-674.026) * [-671.786] (-675.785) (-671.574) (-672.158) -- 0:00:38
      537500 -- [-673.017] (-682.598) (-671.359) (-674.319) * [-672.190] (-672.852) (-672.513) (-672.627) -- 0:00:38
      538000 -- (-677.983) (-674.332) [-671.416] (-671.620) * (-671.517) (-673.421) [-674.090] (-672.743) -- 0:00:38
      538500 -- (-671.266) (-671.145) [-673.027] (-673.789) * [-670.734] (-674.753) (-674.266) (-673.869) -- 0:00:38
      539000 -- (-673.176) [-671.347] (-674.142) (-680.653) * (-673.789) (-673.790) [-671.384] (-671.712) -- 0:00:38
      539500 -- (-675.550) [-673.511] (-672.451) (-675.053) * (-672.866) (-672.126) [-672.778] (-671.990) -- 0:00:38
      540000 -- (-674.438) [-671.401] (-674.786) (-673.375) * (-675.139) (-672.761) [-674.376] (-671.690) -- 0:00:38

      Average standard deviation of split frequencies: 0.009334

      540500 -- (-671.028) (-671.895) (-672.090) [-672.251] * [-674.799] (-673.099) (-673.234) (-671.825) -- 0:00:38
      541000 -- (-671.825) (-672.794) [-673.317] (-674.013) * [-672.561] (-674.789) (-671.432) (-672.468) -- 0:00:38
      541500 -- (-673.364) (-671.551) (-674.102) [-671.813] * (-671.707) [-676.126] (-672.683) (-673.976) -- 0:00:38
      542000 -- (-672.339) (-671.906) (-675.685) [-674.585] * (-674.336) (-672.327) (-671.368) [-671.598] -- 0:00:38
      542500 -- [-672.014] (-675.185) (-674.917) (-671.689) * (-672.189) [-671.444] (-672.234) (-678.068) -- 0:00:37
      543000 -- [-673.313] (-672.979) (-671.674) (-673.354) * (-673.379) (-671.047) (-670.892) [-672.246] -- 0:00:37
      543500 -- (-671.512) (-671.794) [-674.163] (-671.381) * (-671.632) (-671.264) [-672.518] (-675.540) -- 0:00:37
      544000 -- (-671.998) (-673.495) [-674.373] (-671.919) * (-672.203) [-671.544] (-671.139) (-675.050) -- 0:00:37
      544500 -- (-670.834) (-671.601) (-675.946) [-673.397] * (-671.563) (-672.905) [-671.102] (-673.128) -- 0:00:37
      545000 -- (-674.013) [-671.813] (-673.385) (-673.019) * [-672.696] (-672.973) (-671.638) (-673.477) -- 0:00:37

      Average standard deviation of split frequencies: 0.009689

      545500 -- [-673.306] (-673.030) (-674.376) (-674.927) * (-671.732) [-680.852] (-673.482) (-670.788) -- 0:00:37
      546000 -- (-671.581) (-675.636) (-670.911) [-671.854] * (-672.630) [-676.595] (-677.618) (-673.404) -- 0:00:38
      546500 -- [-677.061] (-672.920) (-671.325) (-673.141) * (-673.977) (-676.195) (-677.671) [-673.054] -- 0:00:38
      547000 -- (-673.226) (-672.178) (-671.393) [-672.121] * (-675.812) (-675.759) (-676.309) [-671.439] -- 0:00:38
      547500 -- [-675.082] (-673.087) (-671.204) (-673.050) * (-674.215) (-671.769) (-674.555) [-671.499] -- 0:00:38
      548000 -- (-675.026) [-673.882] (-672.763) (-678.854) * (-674.260) [-673.622] (-671.978) (-674.474) -- 0:00:37
      548500 -- (-678.953) [-672.758] (-672.452) (-675.382) * (-672.312) (-674.167) [-670.618] (-676.178) -- 0:00:37
      549000 -- (-672.838) [-675.898] (-675.656) (-674.416) * (-673.156) (-670.937) (-671.755) [-672.740] -- 0:00:37
      549500 -- [-671.708] (-672.939) (-674.190) (-670.903) * (-678.850) (-672.374) [-671.399] (-674.560) -- 0:00:37
      550000 -- [-673.242] (-673.295) (-672.892) (-671.198) * [-675.089] (-672.717) (-672.315) (-674.098) -- 0:00:37

      Average standard deviation of split frequencies: 0.009845

      550500 -- (-671.944) [-672.011] (-673.804) (-670.928) * [-675.345] (-671.328) (-671.734) (-671.512) -- 0:00:37
      551000 -- (-676.728) [-672.474] (-673.996) (-672.289) * [-673.179] (-672.570) (-672.460) (-673.133) -- 0:00:37
      551500 -- (-674.926) (-671.494) [-674.539] (-673.382) * [-672.461] (-672.259) (-672.870) (-673.323) -- 0:00:37
      552000 -- [-670.599] (-673.812) (-674.868) (-672.177) * [-671.242] (-675.030) (-674.562) (-672.813) -- 0:00:37
      552500 -- (-670.900) (-674.801) [-673.514] (-673.528) * [-671.047] (-673.310) (-675.115) (-672.306) -- 0:00:37
      553000 -- [-671.028] (-674.160) (-672.274) (-672.300) * (-670.957) (-671.372) [-670.789] (-673.304) -- 0:00:37
      553500 -- (-671.278) (-675.396) [-672.025] (-673.026) * (-674.404) (-670.999) [-673.515] (-674.223) -- 0:00:37
      554000 -- (-671.635) (-673.292) (-674.721) [-672.135] * (-674.740) [-671.491] (-671.980) (-671.689) -- 0:00:37
      554500 -- (-671.583) (-673.268) [-672.582] (-673.710) * (-671.895) [-673.574] (-671.605) (-671.240) -- 0:00:36
      555000 -- [-671.179] (-671.902) (-672.763) (-671.741) * [-672.775] (-672.421) (-685.304) (-675.911) -- 0:00:36

      Average standard deviation of split frequencies: 0.009426

      555500 -- (-673.416) (-674.806) [-673.463] (-676.210) * (-671.565) (-673.406) [-677.509] (-672.458) -- 0:00:36
      556000 -- (-672.201) (-675.683) [-671.728] (-677.535) * (-671.119) [-677.651] (-676.042) (-677.467) -- 0:00:36
      556500 -- (-672.117) (-681.807) (-676.161) [-681.431] * (-670.655) [-678.436] (-672.214) (-675.520) -- 0:00:36
      557000 -- [-674.246] (-675.627) (-674.699) (-683.882) * (-674.679) [-676.884] (-672.300) (-672.090) -- 0:00:36
      557500 -- (-673.641) (-674.456) (-680.767) [-672.507] * (-674.920) [-672.776] (-672.103) (-673.039) -- 0:00:36
      558000 -- (-671.552) (-673.124) [-680.498] (-674.403) * (-672.095) (-675.851) (-672.252) [-673.576] -- 0:00:36
      558500 -- [-670.855] (-674.335) (-676.062) (-673.429) * (-673.469) (-678.901) (-676.677) [-673.841] -- 0:00:37
      559000 -- [-674.595] (-674.518) (-676.766) (-674.801) * [-672.039] (-673.294) (-671.695) (-672.693) -- 0:00:37
      559500 -- (-674.071) [-672.920] (-679.195) (-672.906) * (-671.786) (-671.369) [-672.147] (-672.759) -- 0:00:37
      560000 -- [-673.625] (-672.323) (-673.301) (-677.021) * (-671.321) [-671.389] (-674.271) (-673.833) -- 0:00:36

      Average standard deviation of split frequencies: 0.009100

      560500 -- (-672.003) [-671.112] (-672.475) (-677.240) * [-671.526] (-671.796) (-672.298) (-673.150) -- 0:00:36
      561000 -- (-671.499) (-672.701) [-671.722] (-672.691) * [-674.991] (-672.595) (-677.244) (-677.048) -- 0:00:36
      561500 -- (-672.712) (-672.763) (-672.505) [-675.854] * (-674.468) (-675.786) (-674.145) [-671.963] -- 0:00:36
      562000 -- (-671.463) [-672.768] (-676.575) (-674.496) * (-671.564) (-672.208) [-670.810] (-670.997) -- 0:00:36
      562500 -- [-672.136] (-671.942) (-672.991) (-672.948) * (-671.841) (-673.595) (-676.520) [-674.888] -- 0:00:36
      563000 -- [-674.358] (-670.763) (-671.665) (-672.925) * (-671.279) (-672.644) (-676.158) [-674.817] -- 0:00:36
      563500 -- (-673.572) [-671.673] (-672.354) (-673.193) * (-673.867) (-672.640) [-672.057] (-670.903) -- 0:00:36
      564000 -- (-674.522) (-672.277) [-674.219] (-677.531) * [-671.055] (-675.298) (-673.746) (-677.764) -- 0:00:36
      564500 -- (-673.981) (-672.981) [-673.310] (-671.549) * (-671.284) (-675.881) (-672.094) [-672.282] -- 0:00:36
      565000 -- (-675.312) (-674.838) (-679.158) [-672.076] * [-671.815] (-674.050) (-671.502) (-671.849) -- 0:00:36

      Average standard deviation of split frequencies: 0.009717

      565500 -- [-670.928] (-673.269) (-671.392) (-672.762) * (-671.947) (-671.640) (-674.361) [-674.641] -- 0:00:36
      566000 -- (-671.436) [-672.660] (-675.873) (-675.306) * (-674.126) (-672.023) (-673.374) [-674.952] -- 0:00:36
      566500 -- (-672.896) (-671.877) [-673.161] (-676.246) * (-672.109) [-672.453] (-673.913) (-672.190) -- 0:00:35
      567000 -- (-671.770) (-673.980) [-675.253] (-673.401) * (-670.947) (-671.333) [-672.094] (-672.357) -- 0:00:35
      567500 -- [-673.456] (-673.982) (-674.354) (-672.073) * (-673.595) (-673.253) [-672.733] (-678.798) -- 0:00:35
      568000 -- (-671.032) (-672.226) [-673.668] (-672.830) * (-672.470) [-678.319] (-671.094) (-672.132) -- 0:00:35
      568500 -- (-673.009) (-670.990) [-674.939] (-676.003) * (-674.435) (-675.201) (-672.993) [-676.697] -- 0:00:35
      569000 -- (-675.095) (-672.419) (-672.729) [-673.564] * (-674.980) (-675.757) [-674.526] (-673.272) -- 0:00:35
      569500 -- (-674.039) (-674.002) (-676.142) [-671.668] * (-671.586) (-674.115) [-670.736] (-672.603) -- 0:00:35
      570000 -- (-673.902) (-674.670) (-671.765) [-672.080] * (-671.549) (-673.093) [-671.220] (-672.396) -- 0:00:35

      Average standard deviation of split frequencies: 0.009224

      570500 -- [-671.985] (-673.742) (-674.610) (-671.581) * (-672.601) [-673.352] (-674.558) (-672.239) -- 0:00:36
      571000 -- (-674.584) [-672.258] (-672.444) (-673.207) * (-675.067) (-671.109) (-674.340) [-671.705] -- 0:00:36
      571500 -- (-674.547) [-670.918] (-672.307) (-672.294) * (-671.442) (-671.522) [-674.488] (-674.162) -- 0:00:35
      572000 -- (-677.261) (-671.379) [-678.208] (-673.169) * (-672.358) (-671.584) [-674.551] (-672.252) -- 0:00:35
      572500 -- (-675.949) (-673.253) (-672.795) [-674.510] * (-671.387) (-673.004) [-671.364] (-671.658) -- 0:00:35
      573000 -- [-670.783] (-673.922) (-672.588) (-671.791) * (-671.540) [-673.303] (-671.741) (-671.672) -- 0:00:35
      573500 -- (-671.513) [-673.937] (-674.142) (-674.956) * (-675.610) (-673.400) (-671.942) [-674.411] -- 0:00:35
      574000 -- (-672.723) [-673.464] (-673.393) (-674.739) * (-670.603) [-674.979] (-671.838) (-671.716) -- 0:00:35
      574500 -- (-674.973) [-674.841] (-671.046) (-672.156) * (-672.059) (-672.645) (-673.409) [-674.416] -- 0:00:35
      575000 -- (-672.532) (-675.472) [-674.310] (-674.145) * (-677.519) (-672.251) (-671.724) [-673.762] -- 0:00:35

      Average standard deviation of split frequencies: 0.009639

      575500 -- (-673.567) (-671.291) (-675.081) [-672.897] * (-673.854) (-671.141) (-673.329) [-671.729] -- 0:00:35
      576000 -- (-675.311) [-671.664] (-676.091) (-675.712) * (-672.059) (-671.129) (-673.477) [-673.428] -- 0:00:35
      576500 -- (-673.947) (-672.036) [-672.667] (-673.503) * [-671.394] (-672.182) (-672.383) (-672.516) -- 0:00:35
      577000 -- [-673.131] (-670.799) (-672.449) (-679.490) * (-671.072) (-674.334) [-672.784] (-673.110) -- 0:00:35
      577500 -- [-671.798] (-673.647) (-673.222) (-673.762) * (-673.342) (-670.974) (-672.565) [-670.732] -- 0:00:35
      578000 -- (-674.314) (-677.515) (-673.595) [-675.303] * (-673.427) (-674.155) (-673.613) [-671.729] -- 0:00:35
      578500 -- [-673.112] (-672.056) (-671.713) (-675.850) * [-673.213] (-671.244) (-671.563) (-672.906) -- 0:00:34
      579000 -- (-674.186) (-671.719) [-673.338] (-671.650) * (-672.211) [-670.846] (-674.091) (-673.414) -- 0:00:34
      579500 -- (-673.147) [-674.505] (-673.333) (-674.394) * (-671.952) [-674.486] (-672.557) (-672.629) -- 0:00:34
      580000 -- (-671.345) (-673.996) (-672.629) [-670.765] * (-674.147) (-671.613) [-672.855] (-673.345) -- 0:00:34

      Average standard deviation of split frequencies: 0.009169

      580500 -- [-675.184] (-674.395) (-671.304) (-672.864) * [-673.014] (-674.921) (-673.823) (-671.708) -- 0:00:34
      581000 -- (-675.825) [-673.926] (-671.173) (-674.259) * [-673.376] (-671.553) (-673.695) (-672.745) -- 0:00:34
      581500 -- (-671.508) (-675.194) [-671.254] (-674.625) * [-674.554] (-671.917) (-671.626) (-673.931) -- 0:00:34
      582000 -- (-677.830) (-673.502) (-673.302) [-673.399] * [-671.434] (-673.650) (-673.718) (-671.581) -- 0:00:34
      582500 -- (-682.162) (-671.246) (-675.615) [-671.253] * (-672.793) (-672.458) (-674.172) [-672.760] -- 0:00:34
      583000 -- (-682.208) (-671.692) [-672.491] (-673.988) * (-670.844) (-671.354) (-672.211) [-672.318] -- 0:00:35
      583500 -- (-673.803) (-673.645) [-671.770] (-673.032) * (-671.497) (-675.760) [-672.069] (-671.339) -- 0:00:34
      584000 -- (-672.508) (-678.491) [-675.761] (-671.261) * (-673.606) (-672.777) [-672.216] (-671.215) -- 0:00:34
      584500 -- (-671.251) (-673.237) (-671.900) [-671.429] * (-672.915) (-672.840) (-672.407) [-672.288] -- 0:00:34
      585000 -- [-673.957] (-674.949) (-672.933) (-674.629) * [-674.867] (-674.862) (-679.059) (-673.564) -- 0:00:34

      Average standard deviation of split frequencies: 0.009475

      585500 -- (-674.131) (-674.242) [-671.024] (-671.061) * (-672.428) [-674.335] (-678.056) (-673.322) -- 0:00:34
      586000 -- [-670.988] (-673.646) (-671.704) (-671.540) * (-673.432) (-670.881) (-676.606) [-676.541] -- 0:00:34
      586500 -- (-671.375) (-671.770) [-671.891] (-676.735) * [-671.933] (-672.559) (-673.992) (-671.713) -- 0:00:34
      587000 -- (-671.550) [-676.389] (-672.306) (-675.992) * [-673.996] (-672.960) (-674.501) (-674.391) -- 0:00:34
      587500 -- (-671.327) (-670.766) [-672.274] (-671.896) * [-675.807] (-677.282) (-671.791) (-673.366) -- 0:00:34
      588000 -- (-672.036) (-671.995) (-672.255) [-675.981] * (-673.132) [-673.780] (-672.863) (-674.569) -- 0:00:34
      588500 -- [-673.875] (-671.218) (-671.909) (-673.092) * [-672.149] (-671.643) (-673.025) (-672.485) -- 0:00:34
      589000 -- (-673.872) (-673.251) (-674.168) [-672.941] * (-673.217) [-672.311] (-672.825) (-672.533) -- 0:00:34
      589500 -- (-675.722) (-671.378) [-673.562] (-672.216) * (-672.014) (-672.465) [-671.972] (-674.911) -- 0:00:34
      590000 -- [-672.065] (-674.507) (-674.199) (-672.714) * (-674.297) (-673.428) (-673.483) [-675.283] -- 0:00:34

      Average standard deviation of split frequencies: 0.009444

      590500 -- [-672.267] (-674.301) (-671.484) (-674.542) * (-672.193) (-672.384) (-672.037) [-673.256] -- 0:00:33
      591000 -- (-675.714) (-673.109) (-673.816) [-671.088] * (-670.933) (-673.629) (-671.704) [-672.962] -- 0:00:33
      591500 -- (-671.789) [-671.866] (-674.443) (-673.308) * (-671.064) (-670.873) [-672.356] (-670.813) -- 0:00:33
      592000 -- (-673.413) (-673.472) (-674.187) [-676.827] * [-670.772] (-672.918) (-671.856) (-672.436) -- 0:00:33
      592500 -- [-677.496] (-674.212) (-675.037) (-679.387) * (-671.053) [-679.463] (-675.116) (-673.220) -- 0:00:33
      593000 -- (-673.463) (-672.542) (-673.963) [-676.105] * (-671.169) (-672.902) [-672.671] (-675.610) -- 0:00:33
      593500 -- [-671.205] (-671.465) (-676.163) (-672.181) * [-671.917] (-674.102) (-675.063) (-673.291) -- 0:00:33
      594000 -- (-672.157) [-671.381] (-674.015) (-672.699) * (-670.903) (-673.766) [-672.652] (-672.535) -- 0:00:33
      594500 -- (-672.323) [-673.297] (-673.899) (-671.918) * (-671.427) (-673.212) [-672.205] (-672.984) -- 0:00:33
      595000 -- [-676.184] (-673.297) (-673.393) (-679.035) * (-672.789) [-672.372] (-672.892) (-675.577) -- 0:00:33

      Average standard deviation of split frequencies: 0.009259

      595500 -- (-673.136) (-677.059) [-672.868] (-676.714) * (-672.717) (-671.670) [-671.888] (-672.339) -- 0:00:33
      596000 -- (-673.269) (-680.477) (-673.260) [-677.993] * (-673.501) (-672.492) [-671.257] (-673.048) -- 0:00:33
      596500 -- (-673.564) (-679.336) [-671.035] (-681.293) * (-672.542) (-672.134) [-673.155] (-673.375) -- 0:00:33
      597000 -- (-674.085) (-672.233) [-670.592] (-673.048) * (-672.444) (-671.168) [-673.794] (-672.915) -- 0:00:33
      597500 -- (-672.507) (-672.538) [-673.395] (-677.173) * (-672.497) [-672.404] (-676.216) (-671.773) -- 0:00:33
      598000 -- (-672.323) (-673.497) [-672.784] (-672.083) * (-672.373) [-672.783] (-674.725) (-671.350) -- 0:00:33
      598500 -- (-672.304) (-671.311) (-679.455) [-670.779] * [-673.707] (-671.339) (-675.495) (-672.020) -- 0:00:33
      599000 -- (-671.878) [-674.265] (-675.931) (-675.237) * (-672.119) [-674.220] (-673.200) (-671.991) -- 0:00:33
      599500 -- (-676.084) (-672.634) [-675.345] (-671.363) * (-671.270) (-672.384) (-671.591) [-671.670] -- 0:00:33
      600000 -- [-675.097] (-672.579) (-672.077) (-676.288) * (-672.838) [-671.466] (-672.528) (-672.271) -- 0:00:33

      Average standard deviation of split frequencies: 0.009464

      600500 -- (-675.218) [-672.073] (-671.333) (-673.435) * (-673.975) (-672.783) (-672.805) [-673.683] -- 0:00:33
      601000 -- [-672.224] (-671.583) (-677.641) (-676.691) * (-673.286) (-671.167) (-676.142) [-676.297] -- 0:00:33
      601500 -- [-673.696] (-672.277) (-674.021) (-679.763) * (-674.552) [-670.590] (-672.785) (-679.477) -- 0:00:33
      602000 -- (-680.445) [-671.911] (-675.362) (-674.075) * (-672.719) (-671.884) [-671.332] (-675.881) -- 0:00:33
      602500 -- (-676.385) (-674.318) (-680.831) [-672.671] * [-674.787] (-674.075) (-674.077) (-675.420) -- 0:00:32
      603000 -- [-672.149] (-672.361) (-674.378) (-674.128) * (-674.773) (-672.634) (-673.728) [-673.652] -- 0:00:32
      603500 -- [-672.462] (-676.174) (-673.529) (-674.081) * [-673.078] (-672.387) (-674.053) (-672.116) -- 0:00:32
      604000 -- (-671.857) (-672.749) [-672.488] (-674.870) * (-671.268) [-674.220] (-672.400) (-672.115) -- 0:00:32
      604500 -- (-673.604) (-670.875) [-672.717] (-674.266) * (-672.148) (-674.800) (-671.404) [-673.411] -- 0:00:32
      605000 -- (-672.380) (-671.439) [-672.168] (-671.037) * (-672.271) (-675.358) [-673.881] (-672.868) -- 0:00:32

      Average standard deviation of split frequencies: 0.009564

      605500 -- (-673.590) [-673.007] (-670.858) (-673.908) * [-670.920] (-670.591) (-673.284) (-672.716) -- 0:00:32
      606000 -- (-672.232) (-673.201) [-670.948] (-672.637) * (-673.928) [-670.593] (-673.882) (-671.784) -- 0:00:32
      606500 -- [-672.393] (-672.572) (-674.185) (-677.776) * [-674.517] (-673.222) (-673.386) (-672.491) -- 0:00:32
      607000 -- (-675.831) [-671.408] (-672.306) (-673.427) * [-671.430] (-672.424) (-671.543) (-671.022) -- 0:00:32
      607500 -- (-676.862) (-672.247) [-671.867] (-673.705) * [-671.208] (-672.826) (-671.196) (-670.926) -- 0:00:32
      608000 -- (-673.078) (-672.112) [-675.929] (-672.675) * (-679.024) [-672.313] (-672.047) (-672.005) -- 0:00:32
      608500 -- (-672.475) (-673.434) [-676.718] (-671.711) * [-671.966] (-673.895) (-671.459) (-677.382) -- 0:00:32
      609000 -- (-674.326) (-674.535) [-678.471] (-670.999) * (-671.321) (-672.309) (-678.053) [-677.452] -- 0:00:32
      609500 -- (-673.577) [-672.064] (-674.782) (-673.445) * (-671.254) (-676.370) [-672.745] (-672.439) -- 0:00:32
      610000 -- (-674.051) [-671.664] (-674.989) (-671.975) * [-671.254] (-672.275) (-673.859) (-673.252) -- 0:00:32

      Average standard deviation of split frequencies: 0.009354

      610500 -- (-673.887) [-671.783] (-679.544) (-670.837) * [-671.806] (-676.909) (-674.100) (-674.647) -- 0:00:32
      611000 -- [-675.327] (-671.982) (-675.616) (-670.917) * [-673.544] (-677.082) (-673.616) (-672.721) -- 0:00:32
      611500 -- (-672.434) (-674.392) [-673.198] (-672.775) * (-673.421) (-671.969) [-673.678] (-674.691) -- 0:00:32
      612000 -- (-670.868) [-672.429] (-670.883) (-672.316) * [-671.249] (-673.967) (-675.153) (-674.002) -- 0:00:32
      612500 -- (-673.488) (-671.511) [-671.751] (-671.529) * (-672.677) (-678.939) [-673.063] (-673.945) -- 0:00:32
      613000 -- [-673.035] (-671.693) (-670.892) (-672.763) * [-673.597] (-673.620) (-672.226) (-670.948) -- 0:00:32
      613500 -- (-671.250) [-672.081] (-671.676) (-672.270) * (-675.783) (-672.889) [-672.467] (-673.361) -- 0:00:32
      614000 -- (-671.070) [-672.419] (-672.884) (-671.822) * (-671.566) (-673.330) [-673.311] (-671.780) -- 0:00:32
      614500 -- [-671.047] (-671.987) (-670.706) (-672.323) * [-675.219] (-673.554) (-673.207) (-672.894) -- 0:00:31
      615000 -- [-671.841] (-672.775) (-670.612) (-672.040) * [-673.697] (-674.323) (-672.318) (-674.863) -- 0:00:31

      Average standard deviation of split frequencies: 0.009228

      615500 -- (-671.842) (-674.412) [-674.571] (-677.350) * (-673.742) (-678.527) (-676.595) [-670.862] -- 0:00:31
      616000 -- (-675.659) [-674.786] (-673.607) (-675.600) * (-671.205) (-673.077) [-671.381] (-671.160) -- 0:00:31
      616500 -- (-674.747) [-670.918] (-672.025) (-672.395) * [-673.511] (-678.527) (-671.964) (-671.415) -- 0:00:31
      617000 -- (-672.587) [-670.918] (-671.108) (-671.798) * (-675.112) (-678.928) (-674.624) [-672.199] -- 0:00:31
      617500 -- (-674.558) (-673.182) [-671.323] (-674.731) * [-671.820] (-672.549) (-671.837) (-676.473) -- 0:00:31
      618000 -- [-671.736] (-673.150) (-671.699) (-672.069) * [-672.162] (-672.465) (-676.971) (-671.206) -- 0:00:31
      618500 -- [-673.747] (-676.434) (-673.115) (-671.835) * (-672.435) (-674.340) [-674.952] (-677.510) -- 0:00:31
      619000 -- (-674.038) (-677.245) [-674.453] (-672.791) * (-672.419) (-672.231) (-673.058) [-676.333] -- 0:00:31
      619500 -- (-673.067) (-674.052) [-672.488] (-672.343) * [-673.661] (-673.261) (-671.772) (-672.223) -- 0:00:31
      620000 -- (-673.960) (-671.642) [-672.246] (-676.108) * (-676.005) (-671.430) (-671.517) [-670.948] -- 0:00:31

      Average standard deviation of split frequencies: 0.009410

      620500 -- (-674.555) (-673.254) (-673.150) [-675.385] * (-672.046) (-674.737) (-678.725) [-671.311] -- 0:00:31
      621000 -- (-671.294) (-671.638) (-672.722) [-673.414] * (-672.617) (-677.919) (-674.516) [-672.247] -- 0:00:31
      621500 -- (-673.974) (-673.110) [-673.667] (-670.945) * [-673.710] (-679.232) (-671.137) (-671.690) -- 0:00:31
      622000 -- (-673.455) (-674.232) (-674.023) [-671.237] * (-674.060) (-674.734) [-670.763] (-671.805) -- 0:00:31
      622500 -- (-671.669) (-673.341) [-671.546] (-672.618) * (-670.751) (-674.581) [-671.733] (-673.267) -- 0:00:31
      623000 -- (-671.262) (-679.403) [-672.492] (-672.649) * (-674.193) [-670.926] (-672.311) (-675.735) -- 0:00:31
      623500 -- (-671.663) (-675.556) (-675.133) [-671.120] * [-672.751] (-672.004) (-672.417) (-676.531) -- 0:00:31
      624000 -- [-671.972] (-672.886) (-675.531) (-672.158) * (-673.352) (-676.876) (-671.834) [-672.348] -- 0:00:31
      624500 -- (-672.580) [-672.640] (-672.928) (-684.060) * (-677.355) (-675.919) (-673.932) [-673.036] -- 0:00:31
      625000 -- (-673.474) [-671.965] (-673.242) (-673.837) * (-678.357) [-671.797] (-673.982) (-677.404) -- 0:00:31

      Average standard deviation of split frequencies: 0.009204

      625500 -- [-671.130] (-673.590) (-672.355) (-678.649) * (-679.853) (-672.743) (-671.144) [-672.669] -- 0:00:31
      626000 -- (-672.112) (-674.028) [-672.309] (-677.575) * (-675.814) (-672.712) [-671.585] (-674.765) -- 0:00:31
      626500 -- (-672.138) (-675.456) (-673.827) [-671.586] * (-673.181) [-672.085] (-671.106) (-672.690) -- 0:00:31
      627000 -- (-672.111) (-678.130) (-675.881) [-673.444] * (-676.874) [-671.654] (-671.498) (-675.714) -- 0:00:30
      627500 -- (-671.668) (-670.641) [-672.421] (-674.582) * [-673.368] (-670.851) (-673.305) (-674.098) -- 0:00:30
      628000 -- (-672.927) [-672.212] (-671.780) (-677.704) * [-670.700] (-671.114) (-671.387) (-673.313) -- 0:00:30
      628500 -- (-672.782) (-675.992) (-674.348) [-671.898] * (-672.312) [-671.252] (-671.519) (-672.344) -- 0:00:30
      629000 -- (-676.315) (-671.653) (-672.637) [-674.519] * (-671.314) (-671.751) (-671.915) [-673.361] -- 0:00:30
      629500 -- [-676.256] (-672.383) (-672.471) (-671.854) * (-671.288) (-672.665) (-674.694) [-672.987] -- 0:00:30
      630000 -- (-670.936) (-674.260) (-672.034) [-672.709] * (-670.871) (-672.776) (-674.444) [-672.602] -- 0:00:30

      Average standard deviation of split frequencies: 0.009509

      630500 -- [-672.490] (-672.647) (-674.524) (-675.772) * (-672.451) [-671.029] (-674.241) (-672.230) -- 0:00:30
      631000 -- [-674.163] (-673.641) (-672.355) (-673.294) * (-672.892) (-671.291) (-671.355) [-671.378] -- 0:00:30
      631500 -- (-671.871) (-672.075) (-673.731) [-672.572] * (-672.378) (-671.910) [-674.348] (-679.861) -- 0:00:30
      632000 -- (-672.891) (-676.367) [-671.358] (-672.558) * (-671.489) (-673.849) (-674.045) [-673.480] -- 0:00:30
      632500 -- (-672.548) (-672.807) (-673.034) [-671.432] * (-672.346) (-671.381) (-673.573) [-672.456] -- 0:00:30
      633000 -- (-679.211) (-676.414) (-672.790) [-671.052] * (-673.818) (-672.370) (-674.432) [-671.359] -- 0:00:30
      633500 -- (-672.819) (-675.549) [-676.779] (-673.806) * (-673.146) (-672.729) (-672.588) [-671.177] -- 0:00:30
      634000 -- (-672.785) (-679.701) (-677.138) [-676.610] * (-671.685) [-672.488] (-673.151) (-671.765) -- 0:00:30
      634500 -- (-672.921) (-679.444) (-674.762) [-675.341] * (-671.659) [-671.848] (-674.051) (-672.195) -- 0:00:30
      635000 -- [-672.378] (-678.421) (-672.295) (-675.313) * [-673.355] (-676.877) (-674.889) (-675.737) -- 0:00:30

      Average standard deviation of split frequencies: 0.009594

      635500 -- [-671.326] (-672.735) (-670.750) (-673.712) * [-674.615] (-672.656) (-672.365) (-674.579) -- 0:00:30
      636000 -- (-674.526) (-672.078) (-671.824) [-670.671] * [-672.123] (-673.291) (-676.512) (-673.301) -- 0:00:30
      636500 -- (-671.058) (-672.331) [-672.093] (-671.963) * (-671.958) [-672.248] (-673.377) (-674.307) -- 0:00:30
      637000 -- (-672.450) (-672.188) (-671.438) [-672.036] * (-672.454) (-672.004) [-676.623] (-677.156) -- 0:00:30
      637500 -- (-672.813) (-673.718) (-672.371) [-671.835] * (-671.759) (-671.600) (-675.369) [-674.871] -- 0:00:30
      638000 -- [-673.398] (-673.297) (-672.371) (-671.805) * (-673.103) (-671.522) (-674.528) [-671.755] -- 0:00:30
      638500 -- (-674.007) (-672.545) [-673.437] (-671.654) * [-676.028] (-674.035) (-673.872) (-672.194) -- 0:00:30
      639000 -- [-679.781] (-674.554) (-671.715) (-673.314) * (-671.881) (-671.771) (-675.231) [-671.009] -- 0:00:29
      639500 -- (-674.142) (-671.140) [-676.236] (-670.886) * (-674.299) (-674.808) (-673.193) [-671.007] -- 0:00:29
      640000 -- (-672.083) [-672.027] (-671.828) (-671.455) * (-673.669) (-678.752) (-671.166) [-674.850] -- 0:00:29

      Average standard deviation of split frequencies: 0.008911

      640500 -- (-676.402) (-673.058) (-671.979) [-670.804] * (-674.135) (-672.292) [-670.917] (-677.788) -- 0:00:29
      641000 -- (-674.208) (-673.280) (-671.810) [-670.961] * (-672.969) [-676.573] (-674.163) (-676.602) -- 0:00:29
      641500 -- (-678.990) (-672.773) [-671.622] (-671.478) * [-671.392] (-673.479) (-675.943) (-672.936) -- 0:00:29
      642000 -- [-673.645] (-672.346) (-671.626) (-674.085) * (-674.603) (-672.090) (-671.059) [-673.425] -- 0:00:29
      642500 -- (-673.198) (-671.535) [-673.241] (-673.845) * (-673.272) (-677.574) [-673.936] (-674.482) -- 0:00:29
      643000 -- [-671.136] (-681.782) (-671.764) (-674.984) * [-670.537] (-681.518) (-674.429) (-671.002) -- 0:00:29
      643500 -- (-675.425) [-672.765] (-673.487) (-672.885) * [-671.644] (-677.598) (-677.100) (-675.556) -- 0:00:29
      644000 -- [-672.562] (-673.768) (-671.834) (-676.517) * [-673.049] (-671.944) (-673.020) (-673.131) -- 0:00:29
      644500 -- (-672.683) [-672.313] (-671.570) (-673.199) * (-671.120) (-670.722) (-671.796) [-671.416] -- 0:00:29
      645000 -- (-674.451) [-671.942] (-672.277) (-675.331) * (-674.399) [-673.606] (-671.861) (-677.453) -- 0:00:29

      Average standard deviation of split frequencies: 0.008554

      645500 -- (-680.695) [-670.947] (-672.718) (-673.654) * (-675.458) [-672.719] (-671.897) (-673.480) -- 0:00:29
      646000 -- (-676.083) (-672.773) (-671.858) [-671.339] * [-671.779] (-673.226) (-672.436) (-674.243) -- 0:00:29
      646500 -- (-673.105) (-673.152) [-672.505] (-672.945) * [-673.258] (-671.077) (-672.323) (-672.516) -- 0:00:29
      647000 -- (-676.119) (-672.685) (-673.362) [-674.662] * [-671.410] (-671.605) (-673.001) (-674.903) -- 0:00:29
      647500 -- (-673.455) [-674.497] (-675.456) (-672.905) * [-673.626] (-672.640) (-674.666) (-672.037) -- 0:00:29
      648000 -- [-671.418] (-671.518) (-671.474) (-672.414) * (-672.968) (-673.160) [-671.469] (-672.451) -- 0:00:29
      648500 -- (-672.384) [-674.416] (-671.091) (-674.778) * (-673.563) (-674.886) [-674.131] (-672.249) -- 0:00:29
      649000 -- (-673.308) [-672.173] (-673.034) (-674.030) * (-673.068) [-670.670] (-673.434) (-670.824) -- 0:00:29
      649500 -- (-672.534) [-671.541] (-674.621) (-671.992) * (-673.331) (-672.395) (-671.875) [-672.356] -- 0:00:29
      650000 -- [-673.186] (-673.162) (-672.703) (-672.899) * [-675.109] (-673.194) (-671.720) (-671.150) -- 0:00:29

      Average standard deviation of split frequencies: 0.008895

      650500 -- [-672.774] (-676.623) (-671.918) (-675.121) * [-670.990] (-673.521) (-676.867) (-672.468) -- 0:00:29
      651000 -- [-671.113] (-674.224) (-671.322) (-672.125) * (-673.404) [-673.386] (-671.152) (-672.179) -- 0:00:28
      651500 -- (-671.712) (-671.365) (-670.959) [-671.563] * (-673.836) (-671.903) (-674.341) [-673.129] -- 0:00:28
      652000 -- [-672.778] (-674.196) (-671.692) (-672.886) * [-672.162] (-672.718) (-673.425) (-676.312) -- 0:00:28
      652500 -- [-674.400] (-672.547) (-671.545) (-672.712) * (-672.651) [-672.834] (-671.607) (-673.731) -- 0:00:28
      653000 -- (-673.553) (-674.973) (-673.529) [-671.846] * [-675.752] (-673.713) (-673.211) (-673.153) -- 0:00:28
      653500 -- (-672.548) (-671.650) (-672.498) [-670.855] * (-672.272) (-674.183) [-673.816] (-674.278) -- 0:00:28
      654000 -- (-672.723) (-672.821) (-671.843) [-671.020] * (-673.061) (-672.597) [-671.301] (-676.130) -- 0:00:28
      654500 -- (-674.383) (-671.343) (-672.354) [-671.130] * (-671.500) [-672.853] (-676.838) (-674.286) -- 0:00:28
      655000 -- (-678.142) [-671.125] (-677.147) (-673.464) * (-671.440) (-672.935) [-672.147] (-672.808) -- 0:00:28

      Average standard deviation of split frequencies: 0.009062

      655500 -- (-676.450) (-677.512) (-670.867) [-672.761] * (-676.957) [-672.853] (-672.305) (-672.015) -- 0:00:28
      656000 -- [-674.464] (-674.325) (-671.230) (-674.191) * (-673.817) (-674.107) (-671.299) [-672.664] -- 0:00:28
      656500 -- [-672.144] (-672.562) (-672.016) (-673.664) * [-673.185] (-678.050) (-672.056) (-671.803) -- 0:00:28
      657000 -- [-671.384] (-673.431) (-673.506) (-672.153) * (-671.879) (-675.125) [-672.925] (-671.094) -- 0:00:28
      657500 -- (-673.398) (-673.594) [-672.171] (-672.828) * (-672.356) (-671.953) [-674.358] (-671.265) -- 0:00:28
      658000 -- (-675.521) [-673.252] (-677.058) (-671.847) * (-673.895) (-671.793) [-674.942] (-672.248) -- 0:00:28
      658500 -- (-672.755) [-672.888] (-676.144) (-673.412) * [-671.587] (-675.588) (-678.101) (-672.487) -- 0:00:28
      659000 -- (-671.626) (-673.271) [-671.570] (-673.826) * (-674.354) (-671.696) [-680.394] (-675.510) -- 0:00:28
      659500 -- [-671.390] (-674.776) (-672.516) (-672.155) * [-670.672] (-672.757) (-679.226) (-674.398) -- 0:00:28
      660000 -- [-672.038] (-671.440) (-671.836) (-671.305) * (-671.608) [-672.894] (-673.075) (-672.519) -- 0:00:28

      Average standard deviation of split frequencies: 0.008562

      660500 -- (-672.779) (-673.808) [-673.003] (-670.984) * (-673.316) [-672.923] (-673.327) (-674.226) -- 0:00:28
      661000 -- (-672.950) [-675.265] (-674.110) (-673.378) * [-673.428] (-671.940) (-672.611) (-671.931) -- 0:00:28
      661500 -- (-672.014) [-671.560] (-674.066) (-673.475) * [-673.223] (-676.330) (-676.819) (-674.848) -- 0:00:28
      662000 -- (-672.924) (-672.687) (-671.380) [-673.273] * (-672.901) [-675.901] (-679.180) (-673.319) -- 0:00:28
      662500 -- (-675.496) (-672.361) [-670.701] (-672.408) * (-671.197) [-673.639] (-671.495) (-673.642) -- 0:00:28
      663000 -- [-672.929] (-671.067) (-670.541) (-672.443) * (-673.198) (-672.071) (-678.723) [-672.312] -- 0:00:27
      663500 -- (-673.290) (-671.096) [-670.692] (-671.748) * [-674.132] (-672.899) (-672.807) (-674.250) -- 0:00:27
      664000 -- (-674.525) [-673.072] (-671.855) (-673.164) * (-672.425) (-675.731) [-674.478] (-672.751) -- 0:00:27
      664500 -- (-675.223) (-671.993) (-675.765) [-671.598] * (-671.532) (-674.589) (-671.552) [-672.664] -- 0:00:27
      665000 -- (-677.214) (-671.884) [-673.383] (-671.994) * [-671.072] (-673.564) (-671.613) (-672.655) -- 0:00:27

      Average standard deviation of split frequencies: 0.008651

      665500 -- (-672.943) [-672.183] (-678.517) (-674.325) * (-672.750) (-672.669) [-674.400] (-670.913) -- 0:00:27
      666000 -- [-673.486] (-673.356) (-673.205) (-673.421) * (-679.049) [-673.471] (-672.213) (-671.495) -- 0:00:27
      666500 -- [-671.780] (-672.115) (-672.390) (-672.555) * (-675.919) (-675.418) [-672.413] (-675.623) -- 0:00:27
      667000 -- (-671.676) [-673.459] (-672.514) (-670.653) * [-672.426] (-674.187) (-675.274) (-672.299) -- 0:00:27
      667500 -- (-671.687) (-672.007) [-673.177] (-672.240) * [-672.753] (-674.730) (-671.859) (-677.493) -- 0:00:27
      668000 -- (-671.952) (-671.718) [-672.560] (-674.714) * (-673.924) [-670.891] (-672.175) (-675.025) -- 0:00:27
      668500 -- (-672.263) (-672.335) [-676.124] (-670.856) * [-673.261] (-672.044) (-671.670) (-671.725) -- 0:00:27
      669000 -- (-674.671) (-677.622) [-673.332] (-672.938) * (-673.078) [-673.218] (-670.811) (-676.344) -- 0:00:27
      669500 -- (-680.534) [-675.654] (-672.233) (-672.700) * (-674.384) (-672.278) (-675.414) [-673.414] -- 0:00:27
      670000 -- [-673.224] (-672.886) (-674.399) (-671.144) * (-681.637) (-670.621) (-676.345) [-672.801] -- 0:00:27

      Average standard deviation of split frequencies: 0.008630

      670500 -- [-670.695] (-673.084) (-674.276) (-672.797) * (-676.342) [-671.832] (-671.679) (-674.312) -- 0:00:27
      671000 -- (-670.665) [-672.199] (-674.870) (-672.195) * (-673.593) (-674.592) [-672.471] (-674.365) -- 0:00:27
      671500 -- (-673.880) (-672.290) (-671.539) [-671.565] * (-680.097) (-671.637) (-672.845) [-672.415] -- 0:00:27
      672000 -- (-670.862) [-673.894] (-670.902) (-670.758) * (-672.177) (-671.543) [-671.499] (-671.806) -- 0:00:27
      672500 -- (-671.258) (-675.184) (-672.851) [-672.520] * (-672.006) (-671.381) [-671.654] (-673.902) -- 0:00:27
      673000 -- (-671.163) (-672.649) (-673.755) [-671.147] * (-671.683) (-674.567) (-673.969) [-673.583] -- 0:00:27
      673500 -- (-671.742) (-672.095) (-672.708) [-672.262] * [-673.078] (-673.298) (-671.097) (-675.171) -- 0:00:27
      674000 -- [-671.821] (-671.461) (-673.461) (-672.456) * [-672.636] (-672.884) (-672.504) (-673.511) -- 0:00:27
      674500 -- (-672.221) (-671.399) [-671.062] (-676.969) * [-675.568] (-671.892) (-672.445) (-671.110) -- 0:00:27
      675000 -- [-672.147] (-671.947) (-674.729) (-672.020) * (-676.127) [-675.613] (-671.038) (-671.768) -- 0:00:26

      Average standard deviation of split frequencies: 0.008252

      675500 -- (-670.869) (-677.182) (-674.926) [-676.406] * (-673.521) (-674.613) [-671.078] (-671.310) -- 0:00:26
      676000 -- (-671.223) (-672.079) (-673.791) [-671.999] * (-671.452) [-672.324] (-671.023) (-671.669) -- 0:00:26
      676500 -- [-673.858] (-670.907) (-676.063) (-673.048) * (-674.262) (-673.930) (-671.566) [-672.364] -- 0:00:26
      677000 -- (-673.683) (-670.971) [-672.626] (-673.375) * (-672.556) [-674.321] (-671.559) (-672.844) -- 0:00:26
      677500 -- (-673.311) (-672.542) (-675.635) [-677.755] * (-672.664) (-672.480) [-671.518] (-672.892) -- 0:00:26
      678000 -- (-673.587) (-672.385) [-674.130] (-671.753) * (-672.649) (-674.015) [-673.299] (-673.818) -- 0:00:26
      678500 -- (-672.120) (-671.190) (-680.353) [-672.140] * (-673.748) (-675.243) [-672.599] (-671.154) -- 0:00:26
      679000 -- (-672.346) (-671.969) [-673.494] (-671.599) * (-678.732) (-672.335) (-671.101) [-670.862] -- 0:00:26
      679500 -- (-675.116) (-675.822) [-672.907] (-672.916) * (-671.387) (-673.055) (-672.172) [-670.867] -- 0:00:26
      680000 -- (-672.492) (-672.913) [-672.281] (-674.425) * (-673.481) [-674.498] (-671.484) (-674.928) -- 0:00:26

      Average standard deviation of split frequencies: 0.008542

      680500 -- (-671.767) (-675.645) [-671.244] (-672.906) * (-673.125) [-670.782] (-670.698) (-672.893) -- 0:00:26
      681000 -- [-672.947] (-672.624) (-674.280) (-670.686) * [-673.082] (-671.167) (-670.545) (-672.687) -- 0:00:26
      681500 -- (-675.563) (-672.233) [-674.293] (-672.930) * [-673.642] (-671.922) (-676.076) (-676.470) -- 0:00:26
      682000 -- (-672.721) [-672.691] (-674.418) (-675.912) * (-677.167) (-676.135) [-671.271] (-673.126) -- 0:00:26
      682500 -- [-671.801] (-670.888) (-672.596) (-672.191) * (-673.578) (-677.053) (-671.636) [-672.439] -- 0:00:26
      683000 -- (-671.392) [-671.712] (-670.931) (-675.176) * [-672.295] (-672.556) (-673.117) (-672.588) -- 0:00:26
      683500 -- (-672.291) [-671.635] (-672.101) (-673.658) * (-671.924) (-670.970) (-672.698) [-672.396] -- 0:00:26
      684000 -- (-672.069) (-671.886) (-672.031) [-672.668] * (-673.012) (-673.043) [-672.423] (-675.276) -- 0:00:26
      684500 -- (-672.573) (-672.030) (-673.413) [-673.228] * (-671.598) (-673.967) [-671.018] (-674.445) -- 0:00:26
      685000 -- (-674.681) [-671.247] (-671.721) (-673.977) * (-671.125) (-671.183) [-671.780] (-672.332) -- 0:00:26

      Average standard deviation of split frequencies: 0.008132

      685500 -- (-672.857) [-675.462] (-672.857) (-673.726) * (-674.867) [-672.419] (-674.754) (-673.598) -- 0:00:26
      686000 -- [-672.846] (-671.477) (-673.938) (-673.658) * [-671.948] (-675.098) (-672.135) (-672.403) -- 0:00:26
      686500 -- [-671.903] (-672.049) (-673.174) (-673.282) * (-675.852) (-673.115) [-673.804] (-674.198) -- 0:00:26
      687000 -- (-675.591) [-675.147] (-673.974) (-671.310) * (-673.237) (-674.296) [-675.849] (-675.583) -- 0:00:25
      687500 -- [-673.888] (-672.411) (-675.044) (-673.218) * (-671.953) (-674.849) [-672.630] (-674.020) -- 0:00:25
      688000 -- [-671.182] (-670.987) (-675.024) (-672.573) * (-672.437) (-673.739) (-673.914) [-672.930] -- 0:00:25
      688500 -- (-672.807) (-673.334) (-677.158) [-672.983] * (-673.264) (-673.330) (-676.350) [-672.218] -- 0:00:25
      689000 -- (-673.075) (-672.420) (-672.586) [-672.731] * (-670.621) [-672.329] (-672.717) (-673.307) -- 0:00:25
      689500 -- (-673.264) [-679.022] (-674.948) (-673.043) * (-670.921) (-673.279) [-670.960] (-672.114) -- 0:00:25
      690000 -- (-671.560) (-673.955) (-676.019) [-673.315] * (-673.128) (-670.970) [-673.067] (-671.686) -- 0:00:25

      Average standard deviation of split frequencies: 0.007887

      690500 -- [-671.824] (-676.773) (-674.540) (-671.484) * (-673.349) (-671.391) [-670.993] (-673.614) -- 0:00:25
      691000 -- (-674.136) (-678.204) (-671.223) [-671.215] * (-672.721) (-671.098) (-671.716) [-671.933] -- 0:00:25
      691500 -- [-672.319] (-674.320) (-671.794) (-671.617) * [-671.388] (-670.881) (-673.804) (-674.656) -- 0:00:25
      692000 -- [-673.370] (-671.711) (-671.513) (-674.305) * (-672.640) (-672.291) (-675.980) [-672.771] -- 0:00:25
      692500 -- (-673.276) (-673.068) (-675.924) [-673.048] * (-671.862) (-675.065) [-676.600] (-672.921) -- 0:00:25
      693000 -- (-672.943) [-675.212] (-671.706) (-673.708) * (-672.300) [-673.196] (-672.320) (-673.433) -- 0:00:25
      693500 -- (-672.796) (-672.540) [-674.536] (-672.856) * (-673.982) [-672.187] (-676.185) (-673.375) -- 0:00:25
      694000 -- [-672.282] (-672.423) (-673.602) (-672.313) * (-673.438) (-672.603) (-674.489) [-674.656] -- 0:00:25
      694500 -- (-672.220) (-672.457) (-673.625) [-671.247] * (-673.137) (-675.432) [-672.031] (-675.299) -- 0:00:25
      695000 -- (-673.696) (-671.423) (-675.484) [-671.979] * (-672.983) [-671.707] (-671.841) (-673.146) -- 0:00:25

      Average standard deviation of split frequencies: 0.008606

      695500 -- (-674.368) (-672.019) (-677.238) [-677.761] * (-674.348) [-670.921] (-671.684) (-672.542) -- 0:00:25
      696000 -- (-671.348) [-672.888] (-675.029) (-672.928) * (-673.552) (-672.912) (-673.029) [-671.864] -- 0:00:25
      696500 -- (-671.633) [-672.574] (-675.417) (-672.588) * (-674.144) (-675.087) [-672.922] (-673.982) -- 0:00:25
      697000 -- (-671.214) (-671.146) (-679.961) [-672.900] * (-674.129) [-672.946] (-672.626) (-675.200) -- 0:00:25
      697500 -- [-673.732] (-671.145) (-676.308) (-671.026) * [-673.273] (-674.224) (-672.766) (-672.895) -- 0:00:25
      698000 -- (-677.606) [-671.973] (-672.451) (-676.539) * (-673.139) (-673.402) [-672.916] (-672.466) -- 0:00:25
      698500 -- (-674.434) [-673.924] (-674.727) (-680.359) * [-673.724] (-672.396) (-672.301) (-671.733) -- 0:00:25
      699000 -- (-671.975) (-672.259) [-671.804] (-675.106) * (-671.879) (-674.571) (-673.463) [-672.660] -- 0:00:24
      699500 -- (-673.881) [-672.074] (-676.337) (-672.034) * (-672.819) [-673.731] (-671.863) (-674.941) -- 0:00:24
      700000 -- (-673.005) [-673.653] (-677.610) (-672.646) * [-672.915] (-672.103) (-671.725) (-676.222) -- 0:00:24

      Average standard deviation of split frequencies: 0.008271

      700500 -- (-670.874) (-673.074) (-672.923) [-673.818] * (-673.183) (-672.202) (-671.397) [-675.263] -- 0:00:24
      701000 -- (-672.074) [-671.864] (-678.061) (-671.690) * (-674.746) (-673.358) [-671.934] (-677.812) -- 0:00:24
      701500 -- (-673.831) [-672.212] (-674.225) (-674.769) * (-671.014) (-674.602) [-672.694] (-671.796) -- 0:00:24
      702000 -- [-671.691] (-671.411) (-671.198) (-672.730) * (-673.774) (-672.666) (-673.469) [-672.538] -- 0:00:24
      702500 -- (-674.107) (-671.068) (-675.677) [-672.437] * (-673.994) (-674.093) (-673.068) [-672.547] -- 0:00:24
      703000 -- (-673.321) [-672.001] (-673.494) (-673.506) * [-670.884] (-675.043) (-673.926) (-672.880) -- 0:00:24
      703500 -- [-675.111] (-673.173) (-672.555) (-674.009) * [-672.710] (-672.013) (-673.295) (-674.276) -- 0:00:24
      704000 -- (-672.992) (-671.126) (-671.376) [-672.632] * [-670.634] (-673.102) (-675.376) (-673.300) -- 0:00:24
      704500 -- [-672.723] (-671.453) (-674.599) (-672.797) * [-673.623] (-670.704) (-676.571) (-674.692) -- 0:00:24
      705000 -- (-674.645) (-674.658) [-673.134] (-677.294) * [-674.406] (-671.615) (-671.890) (-675.884) -- 0:00:24

      Average standard deviation of split frequencies: 0.008170

      705500 -- [-672.963] (-674.209) (-683.604) (-673.097) * (-671.312) (-673.707) [-671.040] (-672.642) -- 0:00:24
      706000 -- (-671.524) [-672.708] (-673.562) (-676.658) * [-670.736] (-671.633) (-671.686) (-672.631) -- 0:00:24
      706500 -- (-673.166) [-674.204] (-673.715) (-673.650) * (-676.235) [-672.720] (-671.488) (-676.867) -- 0:00:24
      707000 -- (-675.677) (-673.598) (-672.554) [-672.560] * (-671.811) (-674.694) (-673.055) [-672.240] -- 0:00:24
      707500 -- (-675.049) [-674.457] (-673.233) (-673.691) * (-671.387) (-670.865) [-672.674] (-672.219) -- 0:00:24
      708000 -- (-673.138) (-673.537) (-672.512) [-673.690] * [-674.494] (-675.520) (-671.922) (-677.629) -- 0:00:24
      708500 -- [-673.202] (-676.432) (-671.680) (-673.182) * (-675.259) (-671.861) [-671.859] (-674.832) -- 0:00:24
      709000 -- [-673.467] (-677.766) (-672.279) (-671.612) * (-673.345) (-672.311) [-672.086] (-674.283) -- 0:00:24
      709500 -- [-672.881] (-673.017) (-673.671) (-672.315) * (-675.451) (-674.538) [-672.485] (-674.063) -- 0:00:24
      710000 -- (-672.927) (-673.917) [-675.932] (-672.735) * (-673.138) (-673.279) [-673.265] (-671.300) -- 0:00:24

      Average standard deviation of split frequencies: 0.007843

      710500 -- (-672.749) (-676.695) [-672.377] (-670.907) * (-678.313) [-676.321] (-676.026) (-675.330) -- 0:00:24
      711000 -- (-672.720) (-672.500) (-673.775) [-672.883] * (-672.667) (-677.003) [-671.651] (-672.045) -- 0:00:23
      711500 -- [-673.809] (-670.990) (-671.877) (-672.008) * (-675.519) (-674.266) (-673.546) [-674.008] -- 0:00:23
      712000 -- (-671.513) (-671.781) (-672.277) [-672.814] * [-673.136] (-674.013) (-674.236) (-676.501) -- 0:00:23
      712500 -- (-674.291) [-670.540] (-671.907) (-673.716) * (-672.228) (-674.023) [-670.825] (-671.378) -- 0:00:23
      713000 -- (-674.545) (-670.686) (-671.955) [-672.408] * (-671.641) (-672.071) (-671.635) [-673.014] -- 0:00:23
      713500 -- [-671.530] (-671.609) (-673.158) (-675.856) * (-672.757) [-672.852] (-673.531) (-673.922) -- 0:00:23
      714000 -- (-672.496) (-675.108) (-675.507) [-671.363] * [-672.800] (-672.591) (-672.619) (-672.897) -- 0:00:23
      714500 -- (-672.517) [-673.264] (-672.791) (-673.982) * (-672.318) (-672.985) (-671.788) [-671.689] -- 0:00:23
      715000 -- (-671.895) (-676.849) (-674.536) [-673.720] * (-672.252) (-672.106) [-674.837] (-672.762) -- 0:00:23

      Average standard deviation of split frequencies: 0.007206

      715500 -- [-672.730] (-675.182) (-673.237) (-672.820) * (-673.306) [-671.231] (-673.557) (-674.502) -- 0:00:23
      716000 -- [-670.948] (-671.566) (-670.886) (-672.011) * (-671.622) (-672.628) (-672.305) [-673.945] -- 0:00:23
      716500 -- [-671.998] (-671.470) (-672.438) (-676.926) * (-673.512) [-670.992] (-671.574) (-671.684) -- 0:00:23
      717000 -- (-672.934) (-671.909) (-674.216) [-672.474] * (-674.090) (-672.087) [-674.904] (-672.599) -- 0:00:23
      717500 -- (-673.404) (-670.936) (-672.260) [-671.373] * (-675.576) (-675.581) [-673.439] (-674.569) -- 0:00:23
      718000 -- (-673.301) [-673.312] (-670.783) (-674.615) * (-671.800) (-672.736) [-671.858] (-672.838) -- 0:00:23
      718500 -- (-672.628) [-671.599] (-671.557) (-672.369) * (-671.160) [-674.707] (-675.689) (-671.247) -- 0:00:23
      719000 -- [-673.246] (-672.144) (-671.597) (-674.820) * (-672.671) (-674.329) (-673.414) [-672.424] -- 0:00:23
      719500 -- [-673.360] (-671.054) (-672.054) (-671.549) * (-672.707) (-674.524) [-673.284] (-671.913) -- 0:00:23
      720000 -- (-672.604) (-673.938) [-671.611] (-671.740) * [-673.444] (-675.881) (-673.760) (-672.117) -- 0:00:23

      Average standard deviation of split frequencies: 0.007849

      720500 -- (-673.947) [-673.973] (-672.545) (-671.575) * (-675.204) (-673.119) [-672.644] (-673.028) -- 0:00:23
      721000 -- (-673.492) (-674.523) (-677.121) [-671.576] * (-678.546) [-671.243] (-679.001) (-672.184) -- 0:00:23
      721500 -- (-674.479) [-672.693] (-676.399) (-672.740) * [-672.509] (-671.576) (-679.325) (-674.316) -- 0:00:23
      722000 -- (-674.189) (-672.471) (-672.932) [-675.257] * (-672.374) (-676.699) (-675.554) [-674.057] -- 0:00:23
      722500 -- [-672.347] (-673.554) (-671.624) (-672.269) * (-676.562) [-671.320] (-672.538) (-673.354) -- 0:00:23
      723000 -- (-673.021) (-675.105) [-671.939] (-672.298) * (-674.920) (-672.293) (-673.031) [-671.095] -- 0:00:22
      723500 -- [-672.245] (-676.193) (-672.725) (-671.926) * [-674.612] (-673.378) (-670.888) (-673.491) -- 0:00:22
      724000 -- [-672.554] (-677.829) (-672.902) (-673.657) * (-672.553) (-671.413) [-672.645] (-675.847) -- 0:00:22
      724500 -- (-673.219) (-673.175) (-672.440) [-671.639] * [-672.016] (-674.666) (-673.893) (-679.957) -- 0:00:22
      725000 -- [-673.063] (-674.798) (-672.568) (-673.605) * (-670.825) (-674.807) (-672.590) [-671.876] -- 0:00:22

      Average standard deviation of split frequencies: 0.007410

      725500 -- (-676.180) (-675.060) [-677.041] (-673.953) * (-675.237) (-675.183) [-674.473] (-670.924) -- 0:00:22
      726000 -- [-672.272] (-671.618) (-671.487) (-672.538) * (-672.144) (-672.032) (-679.043) [-672.851] -- 0:00:22
      726500 -- (-673.075) [-673.884] (-672.781) (-673.096) * [-671.291] (-671.905) (-677.133) (-675.233) -- 0:00:22
      727000 -- (-672.642) [-670.936] (-670.876) (-671.737) * (-672.940) (-673.843) [-671.203] (-673.440) -- 0:00:22
      727500 -- [-672.021] (-671.247) (-671.309) (-674.657) * (-671.003) (-678.196) [-672.269] (-673.931) -- 0:00:22
      728000 -- (-672.002) (-671.741) (-672.219) [-672.505] * [-671.627] (-677.516) (-672.370) (-673.921) -- 0:00:22
      728500 -- (-681.692) (-675.072) (-670.818) [-672.799] * [-672.067] (-673.022) (-673.041) (-673.783) -- 0:00:22
      729000 -- (-678.213) (-672.476) (-671.576) [-672.935] * [-680.437] (-672.167) (-674.591) (-671.803) -- 0:00:22
      729500 -- (-672.633) [-673.808] (-680.852) (-675.626) * (-675.687) [-672.601] (-671.249) (-673.046) -- 0:00:22
      730000 -- (-672.737) (-676.826) (-675.962) [-672.155] * [-671.445] (-673.188) (-671.671) (-677.677) -- 0:00:22

      Average standard deviation of split frequencies: 0.006907

      730500 -- (-671.241) (-671.585) (-673.992) [-676.954] * (-670.898) [-672.441] (-673.611) (-672.800) -- 0:00:22
      731000 -- (-671.478) (-672.418) [-671.666] (-675.111) * [-671.846] (-674.449) (-671.688) (-671.624) -- 0:00:22
      731500 -- [-672.069] (-672.101) (-670.992) (-672.838) * (-672.705) (-671.973) [-672.618] (-671.522) -- 0:00:22
      732000 -- [-673.253] (-672.180) (-674.305) (-671.649) * [-671.003] (-672.364) (-675.421) (-673.907) -- 0:00:22
      732500 -- (-673.292) [-674.391] (-670.970) (-673.570) * [-671.742] (-674.836) (-674.051) (-676.296) -- 0:00:22
      733000 -- (-675.467) [-672.028] (-671.205) (-672.950) * (-675.098) (-671.654) (-673.044) [-673.259] -- 0:00:22
      733500 -- (-674.062) [-675.550] (-672.910) (-672.003) * [-673.799] (-676.084) (-673.354) (-673.482) -- 0:00:22
      734000 -- (-672.747) (-676.122) (-673.865) [-670.944] * (-673.010) (-672.032) (-673.117) [-672.681] -- 0:00:22
      734500 -- [-670.517] (-672.552) (-672.953) (-673.464) * (-671.345) [-671.277] (-673.785) (-675.385) -- 0:00:22
      735000 -- (-674.052) [-677.187] (-675.569) (-672.482) * [-672.123] (-670.799) (-671.938) (-672.097) -- 0:00:21

      Average standard deviation of split frequencies: 0.007272

      735500 -- [-672.151] (-673.023) (-678.103) (-672.300) * (-671.635) (-672.448) (-670.882) [-673.736] -- 0:00:21
      736000 -- (-672.809) (-673.107) [-670.742] (-673.748) * [-672.017] (-671.576) (-674.658) (-670.862) -- 0:00:21
      736500 -- [-673.657] (-675.500) (-672.484) (-677.370) * (-673.122) (-672.478) (-672.367) [-672.773] -- 0:00:21
      737000 -- [-670.894] (-672.900) (-671.525) (-672.564) * (-676.182) (-675.539) [-672.761] (-675.260) -- 0:00:21
      737500 -- (-674.162) (-674.624) (-670.574) [-673.340] * (-672.539) [-673.564] (-674.283) (-672.220) -- 0:00:21
      738000 -- (-671.408) (-674.053) (-670.836) [-674.680] * (-672.857) [-672.313] (-677.326) (-672.661) -- 0:00:21
      738500 -- (-671.366) [-677.371] (-674.265) (-670.974) * [-673.053] (-671.858) (-671.515) (-670.628) -- 0:00:21
      739000 -- (-672.015) (-671.553) [-672.527] (-674.403) * [-676.843] (-672.855) (-671.986) (-670.980) -- 0:00:21
      739500 -- (-671.356) [-671.232] (-671.338) (-675.840) * [-674.380] (-679.211) (-671.520) (-671.316) -- 0:00:21
      740000 -- (-673.978) (-673.409) (-672.900) [-672.288] * (-672.184) [-673.400] (-672.650) (-671.697) -- 0:00:21

      Average standard deviation of split frequencies: 0.007240