--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:46:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1508/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -672.14 -675.56
2 -672.14 -676.34
--------------------------------------
TOTAL -672.14 -676.02
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898207 0.094608 0.364984 1.511781 0.872993 1355.40 1428.20 1.001
r(A<->C){all} 0.171384 0.020606 0.000014 0.450323 0.134509 132.79 214.70 1.002
r(A<->G){all} 0.168370 0.020503 0.000008 0.456746 0.135009 165.64 199.56 1.001
r(A<->T){all} 0.165826 0.020934 0.000052 0.462839 0.123981 280.66 307.58 1.000
r(C<->G){all} 0.169307 0.019676 0.000145 0.449158 0.135962 211.98 237.11 1.001
r(C<->T){all} 0.165661 0.018938 0.000088 0.438375 0.133011 168.40 231.42 1.002
r(G<->T){all} 0.159453 0.018659 0.000038 0.440636 0.126055 252.74 297.26 1.000
pi(A){all} 0.197118 0.000314 0.163442 0.232302 0.196943 1229.62 1339.83 1.000
pi(C){all} 0.261371 0.000394 0.224044 0.300942 0.260711 1136.35 1259.49 1.002
pi(G){all} 0.314222 0.000447 0.270770 0.352456 0.314377 1349.40 1379.44 1.001
pi(T){all} 0.227288 0.000350 0.189814 0.261492 0.226805 1286.19 1322.02 1.000
alpha{1,2} 0.403997 0.211337 0.000142 1.346516 0.236889 1150.88 1177.17 1.000
alpha{3} 0.448293 0.225653 0.000370 1.460072 0.291368 1072.07 1160.24 1.000
pinvar{all} 0.996669 0.000016 0.989086 0.999998 0.998000 1187.64 1210.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -587.297584
Model 2: PositiveSelection -587.297542
Model 0: one-ratio -587.297554
Model 7: beta -587.297616
Model 8: beta&w>1 -587.297554
Model 0 vs 1 6.000000007588824E-5
Model 2 vs 1 8.400000001529406E-5
Model 8 vs 7 1.2399999991430377E-4
>C1
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C2
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C3
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C4
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C5
MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIRooo
ooooooooooooo
>C6
MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIRooo
ooooooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=179
C1 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C2 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C3 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C4 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C5 ----------------MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
C6 ----------------MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
**********************************
C1 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C2 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C3 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C4 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C5 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
C6 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
**************************************************
C1 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C2 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C3 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C4 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C5 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
C6 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
**************************************************
C1 PILHVYGLPPGIR----------------
C2 PILHVYGLPPGIR----------------
C3 PILHVYGLPPGIR----------------
C4 PILHVYGLPPGIR----------------
C5 PILHVYGLPPGIRoooooooooooooooo
C6 PILHVYGLPPGIRoooooooooooooooo
*************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5434]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5434]--->[5022]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.474 Mb, Max= 30.711 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C2 MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C3 MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C4 MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C5 MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
C6 MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLSNVQYHFDPRDLAVRVS
**************************************************
C1 ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C2 ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C3 ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C4 ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C5 ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
C6 ITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEGTAELTPPAAAPDDDTV
**************************************************
C1 EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C2 EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C3 EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C4 EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C5 EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
C6 EALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTLPILHVYGLPPGIR
***********************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:94 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
C2 ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
C3 ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
C4 ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
C5 ------------------------------------------------AT
C6 ------------------------------------------------AT
**
C1 GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C2 GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C3 GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C4 GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C5 GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
C6 GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
**************************************************
C1 CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C2 CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C3 CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C4 CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C5 CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
C6 CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
**************************************************
C1 AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C2 AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C3 AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C4 AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C5 AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
C6 AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
**************************************************
C1 CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C2 CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C3 CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C4 CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C5 CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
C6 CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
**************************************************
C1 CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C2 CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C3 CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C4 CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C5 CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
C6 CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
**************************************************
C1 ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C2 ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C3 ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C4 ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C5 ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
C6 ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
**************************************************
C1 GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C2 GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C3 GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C4 GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C5 GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
C6 GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
**************************************************
C1 ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C2 ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C3 ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C4 ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C5 ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
C6 ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
**************************************************
C1 CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C2 CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C3 CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C4 CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C5 CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
C6 CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
***************************************
C1 -------------------------------------
C2 -------------------------------------
C3 -------------------------------------
C4 -------------------------------------
C5 -------------------------------------
C6 -------------------------------------
>C1
ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C2
ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C3
ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C4
ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C5
------------------------------------------------AT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C6
------------------------------------------------AT
GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT
CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG
AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT
CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT
CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC
ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA
GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG
ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG
CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG-----------
-------------------------------------
>C1
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C2
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C3
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C4
MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C5
ooooooooooooooooMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
>C6
ooooooooooooooooMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
PILHVYGLPPGIR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 537 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855471
Setting output file names to "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1318152605
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5211743013
Seed = 225627974
Swapseed = 1579855471
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 9 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 9 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1085.051903 -- -24.965149
Chain 2 -- -1085.221969 -- -24.965149
Chain 3 -- -1085.038273 -- -24.965149
Chain 4 -- -1085.221969 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1085.038273 -- -24.965149
Chain 2 -- -1085.051903 -- -24.965149
Chain 3 -- -1085.221969 -- -24.965149
Chain 4 -- -1085.229474 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1085.052] (-1085.222) (-1085.038) (-1085.222) * [-1085.038] (-1085.052) (-1085.222) (-1085.229)
500 -- (-681.866) (-679.004) [-679.679] (-683.209) * (-678.065) [-677.139] (-685.343) (-682.528) -- 0:00:00
1000 -- (-686.423) (-685.485) [-678.775] (-678.693) * (-681.390) [-681.955] (-685.375) (-684.433) -- 0:00:00
1500 -- (-684.602) [-677.567] (-685.471) (-682.028) * (-687.755) [-678.385] (-678.909) (-690.065) -- 0:00:00
2000 -- (-681.874) (-679.753) (-679.372) [-681.757] * (-687.139) (-685.273) (-679.849) [-678.550] -- 0:00:00
2500 -- (-680.791) (-683.350) [-677.739] (-681.337) * (-683.356) (-677.540) (-684.525) [-682.959] -- 0:00:00
3000 -- (-685.462) [-681.324] (-687.125) (-679.947) * (-684.277) (-678.958) (-680.844) [-682.109] -- 0:00:00
3500 -- [-675.578] (-677.141) (-679.111) (-684.653) * (-683.780) (-680.332) (-678.239) [-682.366] -- 0:00:00
4000 -- (-684.104) (-684.661) (-683.627) [-683.494] * (-681.661) (-686.819) [-683.973] (-690.195) -- 0:00:00
4500 -- [-675.886] (-691.647) (-687.786) (-684.880) * (-684.668) [-684.675] (-684.471) (-686.524) -- 0:00:00
5000 -- (-680.075) [-680.753] (-682.171) (-681.652) * [-682.644] (-687.019) (-682.539) (-682.847) -- 0:03:19
Average standard deviation of split frequencies: 0.081710
5500 -- (-679.037) (-681.858) (-683.261) [-681.458] * (-678.303) [-680.856] (-685.780) (-683.435) -- 0:03:00
6000 -- (-682.290) (-687.545) [-677.178] (-678.010) * (-680.904) (-686.792) [-679.565] (-678.676) -- 0:02:45
6500 -- (-686.829) (-681.491) [-681.411] (-685.113) * (-688.735) [-684.056] (-682.481) (-679.182) -- 0:02:32
7000 -- [-677.863] (-681.409) (-688.029) (-688.148) * (-679.207) (-688.864) [-682.557] (-686.548) -- 0:02:21
7500 -- [-678.038] (-683.883) (-677.433) (-675.995) * (-683.602) (-684.461) (-683.631) [-684.142] -- 0:02:12
8000 -- (-687.883) (-688.624) [-680.252] (-679.097) * (-688.121) [-682.512] (-680.924) (-683.364) -- 0:02:04
8500 -- [-678.940] (-681.861) (-682.903) (-682.181) * [-679.090] (-683.828) (-683.948) (-683.315) -- 0:01:56
9000 -- (-691.785) (-686.135) [-681.845] (-680.686) * (-681.826) [-677.019] (-687.427) (-685.058) -- 0:01:50
9500 -- [-684.563] (-682.389) (-687.481) (-686.832) * (-687.726) (-682.198) [-684.100] (-682.595) -- 0:01:44
10000 -- [-682.971] (-679.862) (-678.357) (-680.124) * (-690.650) (-685.453) [-684.841] (-680.095) -- 0:01:39
Average standard deviation of split frequencies: 0.069173
10500 -- [-680.129] (-681.702) (-681.552) (-682.122) * (-689.465) (-677.950) [-676.695] (-683.350) -- 0:01:34
11000 -- (-684.918) [-681.226] (-680.578) (-674.491) * [-680.115] (-685.541) (-684.199) (-684.703) -- 0:01:29
11500 -- (-679.483) [-687.977] (-685.886) (-673.354) * [-683.417] (-678.897) (-683.239) (-686.661) -- 0:01:25
12000 -- (-687.315) (-679.343) (-683.772) [-672.474] * (-687.642) (-675.344) [-682.047] (-679.744) -- 0:01:22
12500 -- (-685.429) (-676.817) [-679.782] (-678.457) * (-682.954) [-680.479] (-685.073) (-681.697) -- 0:01:19
13000 -- (-680.438) [-676.101] (-680.430) (-677.569) * [-680.656] (-679.277) (-700.061) (-683.612) -- 0:01:15
13500 -- (-688.173) (-685.207) (-683.878) [-671.659] * [-680.770] (-687.031) (-686.604) (-682.139) -- 0:01:13
14000 -- (-682.471) [-684.950] (-682.822) (-672.635) * (-678.247) (-684.747) (-673.062) [-679.271] -- 0:01:10
14500 -- [-682.981] (-680.204) (-689.527) (-672.806) * (-713.510) (-686.572) (-674.535) [-675.802] -- 0:01:07
15000 -- (-689.097) (-680.109) (-679.940) [-673.102] * (-677.369) (-689.639) (-674.361) [-677.310] -- 0:01:05
Average standard deviation of split frequencies: 0.069780
15500 -- [-680.124] (-687.031) (-685.640) (-673.331) * [-672.470] (-678.125) (-673.388) (-687.979) -- 0:01:03
16000 -- (-680.624) [-684.880] (-702.095) (-671.511) * (-676.008) (-679.141) (-674.700) [-678.065] -- 0:01:01
16500 -- [-678.552] (-685.446) (-700.453) (-672.235) * [-672.705] (-690.529) (-672.745) (-681.008) -- 0:00:59
17000 -- [-685.059] (-687.878) (-687.446) (-673.508) * (-672.124) (-690.392) [-671.519] (-694.609) -- 0:01:55
17500 -- (-686.198) [-680.234] (-685.945) (-676.422) * (-672.008) (-685.433) (-672.150) [-679.626] -- 0:01:52
18000 -- (-680.783) [-680.187] (-675.856) (-674.312) * (-673.442) [-682.929] (-672.336) (-681.943) -- 0:01:49
18500 -- (-676.970) [-680.325] (-673.812) (-671.800) * (-673.866) [-672.325] (-672.408) (-683.702) -- 0:01:46
19000 -- (-681.882) [-683.453] (-672.900) (-675.053) * (-673.060) (-673.442) [-674.681] (-681.707) -- 0:01:43
19500 -- (-684.235) (-681.179) [-672.080] (-676.657) * (-672.456) (-674.639) (-674.478) [-680.999] -- 0:01:40
20000 -- (-684.664) (-684.971) [-674.000] (-673.010) * (-671.914) (-675.145) [-671.188] (-685.798) -- 0:01:38
Average standard deviation of split frequencies: 0.057025
20500 -- (-684.433) (-675.998) (-676.006) [-671.867] * (-671.986) [-671.673] (-671.999) (-681.504) -- 0:01:35
21000 -- (-690.524) [-681.157] (-671.315) (-673.290) * (-671.566) (-671.837) [-670.824] (-682.720) -- 0:01:33
21500 -- (-685.770) (-678.822) [-673.294] (-671.841) * (-670.939) [-675.012] (-679.294) (-682.686) -- 0:01:31
22000 -- (-678.640) (-685.913) (-674.559) [-671.136] * (-673.064) (-672.547) [-675.035] (-685.329) -- 0:01:28
22500 -- [-686.492] (-681.042) (-674.725) (-672.252) * (-671.179) [-674.080] (-679.559) (-684.521) -- 0:01:26
23000 -- (-689.013) (-687.059) [-672.645] (-672.320) * (-676.819) (-674.169) [-674.362] (-678.845) -- 0:01:24
23500 -- (-680.345) (-688.189) [-672.020] (-670.709) * (-674.281) [-671.334] (-671.855) (-681.769) -- 0:01:23
24000 -- [-682.843] (-690.138) (-671.476) (-672.857) * (-673.423) [-673.912] (-671.791) (-685.400) -- 0:01:21
24500 -- [-683.423] (-679.448) (-670.990) (-674.399) * (-674.306) (-671.927) [-673.159] (-683.699) -- 0:01:19
25000 -- (-689.971) [-682.335] (-674.350) (-672.184) * [-675.119] (-675.850) (-672.706) (-675.649) -- 0:01:18
Average standard deviation of split frequencies: 0.038982
25500 -- (-696.159) [-679.042] (-673.648) (-672.293) * (-673.320) (-673.020) [-673.885] (-680.385) -- 0:01:16
26000 -- (-687.103) (-690.289) [-674.323] (-674.072) * [-673.860] (-673.446) (-672.250) (-682.666) -- 0:01:14
26500 -- (-684.389) [-684.104] (-675.483) (-676.649) * [-671.663] (-672.260) (-673.898) (-691.988) -- 0:01:13
27000 -- (-680.025) (-688.535) (-673.887) [-671.798] * (-670.924) (-672.959) [-672.838] (-685.932) -- 0:01:12
27500 -- (-686.937) (-679.454) [-672.324] (-674.108) * (-673.793) (-672.896) [-676.646] (-683.336) -- 0:01:10
28000 -- (-679.711) [-685.424] (-673.518) (-673.736) * (-675.628) [-671.698] (-674.993) (-685.039) -- 0:01:09
28500 -- (-680.256) [-681.262] (-676.256) (-675.642) * (-670.908) (-672.216) [-672.736] (-682.230) -- 0:01:08
29000 -- (-680.249) [-676.489] (-673.722) (-673.263) * (-674.650) (-672.053) (-674.789) [-678.108] -- 0:01:06
29500 -- (-680.269) [-684.890] (-678.528) (-676.270) * [-672.687] (-672.023) (-672.311) (-680.077) -- 0:01:38
30000 -- (-681.472) (-684.129) [-673.167] (-678.901) * [-670.705] (-671.878) (-671.534) (-679.890) -- 0:01:37
Average standard deviation of split frequencies: 0.043810
30500 -- [-677.730] (-691.741) (-673.342) (-674.056) * (-671.324) (-671.891) [-672.088] (-679.433) -- 0:01:35
31000 -- [-681.361] (-683.558) (-675.024) (-674.231) * (-672.997) [-671.678] (-673.521) (-682.213) -- 0:01:33
31500 -- (-678.287) (-681.074) [-671.321] (-676.305) * (-673.734) (-672.176) (-672.187) [-679.100] -- 0:01:32
32000 -- (-677.269) (-683.859) (-672.333) [-673.537] * (-677.747) [-678.451] (-672.026) (-687.082) -- 0:01:30
32500 -- (-675.474) (-683.190) (-673.070) [-672.079] * (-673.003) (-674.784) [-675.224] (-685.676) -- 0:01:29
33000 -- [-673.879] (-681.672) (-673.024) (-673.910) * (-673.832) [-673.953] (-677.740) (-687.034) -- 0:01:27
33500 -- (-673.800) (-689.576) (-672.485) [-672.749] * [-671.872] (-671.728) (-676.048) (-680.934) -- 0:01:26
34000 -- (-675.028) (-679.895) [-670.931] (-678.227) * (-671.886) (-670.999) (-674.951) [-686.326] -- 0:01:25
34500 -- (-672.283) (-691.935) (-672.788) [-677.871] * (-673.042) (-671.140) (-672.691) [-677.409] -- 0:01:23
35000 -- (-673.971) (-680.764) (-670.661) [-671.700] * (-671.028) (-671.944) (-679.651) [-683.381] -- 0:01:22
Average standard deviation of split frequencies: 0.030118
35500 -- (-671.546) (-673.568) [-672.634] (-670.853) * [-671.765] (-674.143) (-672.821) (-691.104) -- 0:01:21
36000 -- (-675.163) [-675.980] (-674.714) (-675.352) * (-672.722) (-677.211) [-670.940] (-683.901) -- 0:01:20
36500 -- (-671.615) (-671.759) (-673.087) [-672.287] * (-674.998) (-680.530) (-672.411) [-676.890] -- 0:01:19
37000 -- (-673.923) (-675.612) [-673.849] (-671.316) * (-673.559) [-673.291] (-674.389) (-684.469) -- 0:01:18
37500 -- [-673.060] (-673.801) (-671.350) (-673.361) * (-675.496) (-675.670) [-672.562] (-688.543) -- 0:01:17
38000 -- [-673.069] (-675.661) (-673.214) (-671.532) * [-672.316] (-671.015) (-674.230) (-681.193) -- 0:01:15
38500 -- (-672.903) [-674.072] (-671.717) (-671.716) * (-675.661) (-670.653) [-673.718] (-683.391) -- 0:01:14
39000 -- (-676.706) (-674.057) (-673.976) [-673.642] * (-677.573) [-670.742] (-674.423) (-679.576) -- 0:01:13
39500 -- (-676.060) (-672.425) (-674.739) [-671.635] * (-674.055) [-671.760] (-675.004) (-679.075) -- 0:01:12
40000 -- (-673.870) [-674.562] (-674.623) (-672.214) * [-672.595] (-671.179) (-671.823) (-687.837) -- 0:01:12
Average standard deviation of split frequencies: 0.033556
40500 -- (-671.514) (-671.628) [-672.441] (-673.115) * (-676.825) (-672.898) (-671.829) [-681.323] -- 0:01:11
41000 -- (-673.908) [-672.975] (-673.406) (-670.831) * (-673.198) [-672.551] (-672.568) (-684.497) -- 0:01:10
41500 -- [-672.947] (-673.044) (-674.840) (-671.564) * (-671.655) (-671.448) [-671.303] (-688.562) -- 0:01:32
42000 -- [-672.802] (-672.294) (-672.164) (-673.472) * (-674.485) (-677.422) (-675.317) [-683.250] -- 0:01:31
42500 -- (-676.783) [-671.281] (-674.629) (-673.209) * (-671.444) (-672.531) [-671.174] (-682.880) -- 0:01:30
43000 -- [-673.328] (-671.292) (-672.787) (-671.484) * [-674.696] (-672.433) (-672.144) (-684.304) -- 0:01:29
43500 -- (-671.163) (-673.093) [-673.493] (-671.398) * (-674.465) (-672.195) (-671.703) [-677.816] -- 0:01:27
44000 -- (-671.551) (-672.995) (-673.367) [-672.991] * (-674.051) [-675.334] (-672.889) (-689.551) -- 0:01:26
44500 -- [-674.864] (-671.537) (-676.545) (-671.504) * (-676.388) (-672.711) [-673.110] (-681.133) -- 0:01:25
45000 -- [-674.374] (-673.524) (-674.391) (-674.357) * (-672.685) (-673.791) (-675.420) [-686.256] -- 0:01:24
Average standard deviation of split frequencies: 0.026840
45500 -- (-672.783) [-672.459] (-672.727) (-671.753) * [-672.282] (-675.405) (-675.519) (-690.833) -- 0:01:23
46000 -- (-673.748) [-672.159] (-671.993) (-671.650) * [-672.206] (-674.027) (-674.793) (-689.458) -- 0:01:22
46500 -- [-674.839] (-673.719) (-672.527) (-671.421) * (-672.103) (-671.496) (-673.028) [-672.127] -- 0:01:22
47000 -- [-675.375] (-672.945) (-672.117) (-674.112) * (-673.317) (-673.070) (-675.362) [-671.740] -- 0:01:21
47500 -- (-675.569) (-672.649) [-673.009] (-672.569) * [-671.749] (-673.417) (-674.365) (-671.983) -- 0:01:20
48000 -- (-672.644) [-674.387] (-672.891) (-675.365) * (-670.788) (-673.540) [-676.084] (-675.849) -- 0:01:19
48500 -- (-675.576) [-671.298] (-673.001) (-674.362) * [-670.897] (-674.593) (-676.152) (-671.660) -- 0:01:18
49000 -- (-673.791) [-672.905] (-671.191) (-675.567) * (-674.562) (-674.002) [-674.025] (-671.423) -- 0:01:17
49500 -- [-672.558] (-674.977) (-672.007) (-676.466) * (-672.784) (-673.187) (-673.976) [-672.669] -- 0:01:16
50000 -- (-675.341) (-674.515) (-672.452) [-671.510] * (-674.301) (-673.875) [-672.617] (-674.106) -- 0:01:16
Average standard deviation of split frequencies: 0.038767
50500 -- (-672.440) (-671.638) (-675.486) [-674.768] * (-673.240) [-672.930] (-675.676) (-672.844) -- 0:01:15
51000 -- (-671.248) (-671.013) [-676.201] (-673.901) * [-671.155] (-671.110) (-673.017) (-671.290) -- 0:01:14
51500 -- [-671.200] (-672.534) (-671.306) (-671.650) * [-671.085] (-671.646) (-671.960) (-672.210) -- 0:01:13
52000 -- (-677.464) (-673.780) [-671.789] (-671.181) * [-671.085] (-671.388) (-671.162) (-672.256) -- 0:01:12
52500 -- (-676.863) (-672.487) [-673.986] (-674.222) * (-672.626) (-676.070) [-673.142] (-675.686) -- 0:01:12
53000 -- (-675.403) [-672.443] (-673.489) (-675.701) * [-673.284] (-676.184) (-675.564) (-674.462) -- 0:01:11
53500 -- (-673.551) (-672.849) (-676.127) [-672.584] * (-673.647) (-673.246) [-674.536] (-672.800) -- 0:01:28
54000 -- (-674.376) [-674.103] (-674.950) (-673.191) * (-670.896) (-672.706) [-674.262] (-678.714) -- 0:01:27
54500 -- [-673.187] (-672.756) (-673.182) (-674.133) * [-673.873] (-671.843) (-673.813) (-676.451) -- 0:01:26
55000 -- (-677.783) (-671.935) (-672.877) [-672.412] * (-676.087) [-671.505] (-673.298) (-675.151) -- 0:01:25
Average standard deviation of split frequencies: 0.034874
55500 -- (-680.532) [-672.002] (-674.222) (-673.323) * (-672.201) (-671.091) (-673.796) [-674.521] -- 0:01:25
56000 -- (-676.542) [-670.815] (-674.908) (-675.569) * (-674.723) (-672.117) [-674.032] (-672.606) -- 0:01:24
56500 -- (-673.591) [-671.355] (-670.698) (-677.180) * (-672.661) (-672.353) [-674.106] (-672.838) -- 0:01:23
57000 -- (-675.404) [-671.339] (-672.874) (-672.655) * [-671.705] (-671.481) (-673.031) (-673.145) -- 0:01:22
57500 -- (-675.209) (-673.411) [-670.819] (-671.868) * [-675.556] (-670.923) (-672.835) (-671.458) -- 0:01:21
58000 -- (-676.821) [-674.046] (-670.734) (-674.464) * (-672.879) [-670.641] (-676.849) (-671.325) -- 0:01:21
58500 -- (-673.451) [-672.097] (-671.043) (-672.998) * (-676.227) (-671.929) (-679.767) [-674.379] -- 0:01:20
59000 -- (-674.571) [-671.976] (-672.027) (-672.185) * (-675.847) (-674.098) (-671.084) [-670.748] -- 0:01:19
59500 -- (-675.257) (-671.058) [-671.296] (-672.664) * (-674.649) (-673.916) (-676.722) [-672.867] -- 0:01:19
60000 -- [-674.056] (-674.499) (-672.003) (-677.106) * [-672.899] (-671.673) (-672.817) (-671.725) -- 0:01:18
Average standard deviation of split frequencies: 0.029232
60500 -- (-674.716) (-672.939) (-673.059) [-672.083] * (-674.957) (-670.612) [-673.152] (-672.854) -- 0:01:17
61000 -- (-673.834) (-675.599) (-674.166) [-672.238] * (-673.379) (-670.999) [-671.837] (-674.136) -- 0:01:16
61500 -- (-674.605) (-674.473) [-672.535] (-673.075) * (-672.581) (-670.626) [-676.910] (-674.261) -- 0:01:16
62000 -- (-672.498) (-676.510) [-673.289] (-672.635) * [-672.867] (-672.560) (-675.135) (-671.972) -- 0:01:15
62500 -- [-673.869] (-678.483) (-677.376) (-672.372) * (-673.896) (-672.849) [-671.444] (-673.393) -- 0:01:15
63000 -- (-675.187) [-675.113] (-679.439) (-671.035) * (-676.094) (-673.069) [-671.227] (-672.963) -- 0:01:14
63500 -- [-673.870] (-672.058) (-671.544) (-673.719) * [-674.219] (-671.890) (-673.070) (-673.555) -- 0:01:13
64000 -- (-672.783) (-670.918) (-670.439) [-671.996] * (-674.533) [-673.722] (-672.319) (-673.009) -- 0:01:13
64500 -- (-675.146) (-676.309) (-671.316) [-670.760] * (-676.338) [-670.952] (-675.951) (-675.044) -- 0:01:12
65000 -- (-673.180) (-672.094) (-672.196) [-671.005] * [-673.348] (-670.881) (-673.116) (-671.336) -- 0:01:26
Average standard deviation of split frequencies: 0.023468
65500 -- (-673.955) (-674.269) [-672.271] (-672.042) * (-673.466) (-671.594) [-671.532] (-673.090) -- 0:01:25
66000 -- [-673.596] (-671.619) (-675.026) (-671.470) * (-671.893) (-670.871) [-673.067] (-674.130) -- 0:01:24
66500 -- (-671.111) [-673.533] (-676.034) (-670.850) * (-672.292) [-670.701] (-676.461) (-673.328) -- 0:01:24
67000 -- (-672.213) [-671.808] (-672.664) (-672.061) * (-672.018) (-671.810) [-673.445] (-673.166) -- 0:01:23
67500 -- (-674.653) [-673.091] (-675.970) (-675.238) * (-671.946) (-672.997) [-672.331] (-672.064) -- 0:01:22
68000 -- [-671.251] (-676.819) (-675.170) (-673.648) * (-672.503) (-675.685) (-673.273) [-677.138] -- 0:01:22
68500 -- [-671.068] (-677.628) (-671.954) (-672.541) * (-673.508) (-673.226) (-671.399) [-673.956] -- 0:01:21
69000 -- [-671.634] (-673.605) (-670.675) (-671.468) * (-672.601) (-673.535) [-671.313] (-673.349) -- 0:01:20
69500 -- (-671.456) [-673.592] (-672.569) (-671.403) * (-674.053) [-672.765] (-672.502) (-675.995) -- 0:01:20
70000 -- [-670.992] (-672.900) (-674.053) (-673.195) * (-671.978) (-673.659) (-674.144) [-672.704] -- 0:01:19
Average standard deviation of split frequencies: 0.022470
70500 -- (-672.765) (-672.309) (-671.840) [-673.185] * [-671.487] (-671.477) (-671.932) (-672.817) -- 0:01:19
71000 -- (-671.500) [-671.515] (-676.267) (-674.647) * (-671.218) (-671.833) [-672.060] (-673.219) -- 0:01:18
71500 -- (-672.213) [-672.336] (-672.178) (-672.998) * [-673.894] (-671.713) (-671.518) (-673.576) -- 0:01:17
72000 -- [-671.460] (-673.543) (-675.497) (-671.853) * (-672.489) [-674.602] (-671.790) (-676.373) -- 0:01:17
72500 -- (-671.079) (-674.824) (-674.973) [-674.222] * (-672.656) (-674.329) [-672.612] (-673.817) -- 0:01:16
73000 -- (-672.826) [-673.652] (-674.399) (-672.119) * (-674.668) [-671.736] (-672.891) (-673.726) -- 0:01:16
73500 -- (-671.973) (-671.499) [-672.103] (-673.015) * (-674.871) (-672.643) [-671.433] (-672.662) -- 0:01:15
74000 -- (-672.281) [-671.260] (-672.103) (-672.132) * [-674.103] (-673.376) (-673.916) (-672.655) -- 0:01:15
74500 -- (-676.722) (-671.260) (-671.702) [-671.794] * [-671.539] (-674.309) (-672.970) (-672.842) -- 0:01:14
75000 -- (-672.931) [-672.311] (-671.832) (-671.696) * [-674.573] (-671.660) (-672.141) (-672.908) -- 0:01:14
Average standard deviation of split frequencies: 0.017149
75500 -- (-673.041) (-674.624) [-674.673] (-672.850) * (-673.327) [-673.007] (-674.207) (-672.526) -- 0:01:13
76000 -- [-672.852] (-678.166) (-672.746) (-672.582) * (-671.100) (-672.172) [-673.318] (-672.988) -- 0:01:12
76500 -- (-672.465) (-676.255) [-672.567] (-677.060) * [-671.885] (-673.643) (-671.986) (-671.124) -- 0:01:24
77000 -- [-672.517] (-673.684) (-672.546) (-671.793) * (-673.616) (-674.257) (-671.443) [-673.798] -- 0:01:23
77500 -- (-674.035) [-670.908] (-672.679) (-670.526) * (-672.519) [-673.048] (-673.718) (-679.783) -- 0:01:23
78000 -- [-675.324] (-672.969) (-675.560) (-671.417) * (-672.745) (-671.780) [-671.100] (-671.993) -- 0:01:22
78500 -- [-677.377] (-674.723) (-672.432) (-672.990) * (-672.169) [-671.562] (-674.136) (-672.471) -- 0:01:22
79000 -- (-675.146) (-674.895) [-671.219] (-676.595) * (-671.269) (-673.449) (-670.595) [-672.803] -- 0:01:21
79500 -- (-673.542) (-676.556) (-673.720) [-674.325] * (-675.599) (-674.767) [-673.216] (-671.585) -- 0:01:21
80000 -- (-672.259) (-672.754) (-674.796) [-674.077] * (-675.291) [-674.025] (-672.349) (-674.098) -- 0:01:20
Average standard deviation of split frequencies: 0.018262
80500 -- (-672.198) [-671.694] (-671.970) (-674.530) * (-671.972) [-674.185] (-673.751) (-673.394) -- 0:01:19
81000 -- (-673.962) [-671.684] (-670.697) (-671.223) * (-672.884) [-675.833] (-676.664) (-673.629) -- 0:01:19
81500 -- [-670.836] (-671.823) (-671.485) (-671.157) * (-675.393) [-672.512] (-672.618) (-674.599) -- 0:01:18
82000 -- (-672.974) (-674.830) (-675.520) [-671.519] * (-674.195) (-672.073) (-671.735) [-677.179] -- 0:01:18
82500 -- (-672.191) (-674.665) (-671.970) [-674.772] * (-674.361) (-673.465) (-673.826) [-672.332] -- 0:01:17
83000 -- [-672.996] (-673.996) (-671.805) (-677.556) * (-671.516) [-672.109] (-672.167) (-671.605) -- 0:01:17
83500 -- (-674.436) (-673.106) [-679.052] (-676.825) * [-672.583] (-673.064) (-671.560) (-672.017) -- 0:01:16
84000 -- (-672.251) (-673.868) (-673.825) [-673.400] * (-672.704) (-678.079) (-675.187) [-671.928] -- 0:01:16
84500 -- (-677.701) [-677.964] (-674.492) (-674.224) * (-672.395) (-676.957) (-673.618) [-672.777] -- 0:01:15
85000 -- (-672.822) (-673.722) [-673.387] (-673.484) * [-671.646] (-673.180) (-673.368) (-671.355) -- 0:01:15
Average standard deviation of split frequencies: 0.020772
85500 -- (-671.547) [-673.352] (-672.717) (-677.283) * (-670.861) (-674.748) (-674.212) [-673.934] -- 0:01:14
86000 -- [-671.442] (-674.354) (-674.514) (-672.104) * (-672.985) (-675.168) [-672.746] (-671.215) -- 0:01:14
86500 -- (-671.209) (-673.848) (-672.096) [-673.148] * (-673.507) (-672.996) [-673.235] (-673.390) -- 0:01:13
87000 -- (-671.581) (-677.499) (-673.002) [-671.807] * (-674.578) [-672.629] (-673.317) (-673.993) -- 0:01:13
87500 -- (-674.126) (-673.557) [-671.964] (-673.412) * (-672.506) (-670.903) [-671.874] (-672.863) -- 0:01:13
88000 -- (-672.323) [-674.291] (-673.036) (-674.661) * (-672.393) (-670.892) (-673.099) [-671.390] -- 0:01:12
88500 -- (-673.232) [-673.314] (-678.913) (-673.590) * (-672.461) (-676.714) (-673.302) [-671.390] -- 0:01:12
89000 -- (-672.495) [-672.555] (-672.290) (-675.506) * [-677.855] (-677.894) (-674.229) (-672.015) -- 0:01:21
89500 -- [-674.358] (-671.560) (-672.133) (-672.791) * (-672.627) [-672.818] (-674.815) (-674.188) -- 0:01:21
90000 -- (-671.960) (-676.854) [-671.455] (-671.484) * (-671.904) [-671.150] (-675.804) (-674.253) -- 0:01:20
Average standard deviation of split frequencies: 0.019642
90500 -- (-671.994) (-674.166) (-674.243) [-675.492] * (-671.961) [-673.484] (-676.252) (-676.968) -- 0:01:20
91000 -- (-671.370) [-671.252] (-672.991) (-674.556) * (-672.772) (-676.108) [-673.529] (-673.411) -- 0:01:19
91500 -- (-671.048) (-673.337) (-671.097) [-672.627] * (-673.513) (-674.584) (-672.881) [-671.245] -- 0:01:19
92000 -- (-672.895) (-674.710) [-671.782] (-673.424) * [-673.406] (-672.493) (-671.451) (-672.751) -- 0:01:18
92500 -- [-673.023] (-672.915) (-674.006) (-674.054) * (-672.186) [-671.127] (-671.964) (-672.987) -- 0:01:18
93000 -- [-671.656] (-671.564) (-675.557) (-674.172) * (-674.886) (-672.795) (-672.588) [-674.512] -- 0:01:18
93500 -- [-681.511] (-671.441) (-671.382) (-672.130) * [-675.367] (-673.724) (-674.167) (-673.446) -- 0:01:17
94000 -- (-675.129) [-673.493] (-671.765) (-673.102) * [-672.875] (-675.748) (-675.649) (-671.963) -- 0:01:17
94500 -- (-672.539) (-672.608) (-671.398) [-673.172] * (-674.040) (-672.561) [-673.614] (-671.674) -- 0:01:16
95000 -- (-672.506) (-677.564) [-672.687] (-671.074) * (-672.960) (-674.816) [-673.368] (-673.384) -- 0:01:16
Average standard deviation of split frequencies: 0.020220
95500 -- [-673.827] (-673.932) (-671.213) (-672.412) * (-675.347) [-673.402] (-671.828) (-673.356) -- 0:01:15
96000 -- (-670.579) (-673.496) (-673.592) [-675.748] * (-672.378) (-672.577) [-671.744] (-671.756) -- 0:01:15
96500 -- (-672.328) (-671.693) [-675.983] (-676.089) * (-673.492) (-670.634) [-672.312] (-672.734) -- 0:01:14
97000 -- (-670.992) (-672.621) (-675.871) [-673.304] * (-672.463) [-672.209] (-674.758) (-674.079) -- 0:01:14
97500 -- [-672.185] (-671.164) (-676.404) (-675.713) * (-673.662) (-672.482) [-677.125] (-672.900) -- 0:01:14
98000 -- (-672.334) (-671.497) [-671.216] (-672.108) * (-671.324) (-671.519) [-674.365] (-672.472) -- 0:01:13
98500 -- (-673.557) (-672.467) (-672.604) [-670.808] * (-672.776) [-673.026] (-672.696) (-674.884) -- 0:01:13
99000 -- (-674.148) (-671.530) [-671.860] (-672.301) * [-671.468] (-676.104) (-674.711) (-674.950) -- 0:01:12
99500 -- (-672.280) [-671.027] (-672.639) (-670.766) * (-671.495) [-673.171] (-672.863) (-674.205) -- 0:01:12
100000 -- (-671.504) (-671.741) (-673.033) [-673.633] * [-671.987] (-675.311) (-675.658) (-673.537) -- 0:01:21
Average standard deviation of split frequencies: 0.020935
100500 -- [-671.576] (-671.782) (-671.666) (-677.063) * (-670.942) (-675.362) (-671.950) [-673.892] -- 0:01:20
101000 -- (-672.028) [-671.544] (-673.116) (-672.417) * (-672.191) [-672.236] (-671.311) (-671.836) -- 0:01:20
101500 -- (-672.545) (-672.579) (-677.013) [-674.887] * [-672.268] (-673.159) (-671.321) (-674.368) -- 0:01:19
102000 -- (-671.076) (-674.254) [-674.995] (-671.880) * (-673.530) [-670.905] (-673.310) (-672.213) -- 0:01:19
102500 -- [-671.699] (-673.020) (-676.704) (-671.626) * (-672.602) (-672.087) (-674.483) [-672.728] -- 0:01:18
103000 -- [-674.741] (-671.925) (-673.107) (-670.813) * (-672.077) (-671.004) [-673.961] (-672.767) -- 0:01:18
103500 -- (-673.987) (-672.967) [-672.583] (-671.037) * (-674.148) [-672.620] (-674.900) (-675.164) -- 0:01:17
104000 -- [-671.957] (-672.201) (-671.190) (-672.023) * (-674.193) [-672.759] (-675.027) (-672.973) -- 0:01:17
104500 -- (-672.736) (-671.900) (-671.960) [-671.016] * [-678.779] (-671.172) (-672.757) (-672.434) -- 0:01:17
105000 -- (-673.357) [-673.860] (-672.861) (-675.466) * (-673.293) (-671.250) (-676.993) [-678.466] -- 0:01:16
Average standard deviation of split frequencies: 0.017295
105500 -- (-674.211) [-674.273] (-673.315) (-678.270) * [-672.386] (-673.227) (-674.639) (-672.527) -- 0:01:16
106000 -- (-671.172) [-677.257] (-672.393) (-673.455) * (-675.469) (-672.404) (-672.497) [-674.775] -- 0:01:15
106500 -- (-675.446) (-677.795) [-672.986] (-674.039) * (-674.440) [-670.544] (-674.429) (-675.493) -- 0:01:15
107000 -- (-674.737) (-674.919) (-672.694) [-673.514] * [-671.124] (-671.141) (-673.038) (-674.543) -- 0:01:15
107500 -- [-671.743] (-672.882) (-677.136) (-671.986) * (-672.314) (-674.377) [-671.323] (-673.907) -- 0:01:14
108000 -- (-671.948) (-672.992) (-673.310) [-671.628] * [-671.666] (-672.384) (-674.261) (-674.392) -- 0:01:14
108500 -- [-672.459] (-674.595) (-673.530) (-672.565) * (-672.724) [-671.176] (-673.666) (-679.552) -- 0:01:13
109000 -- (-671.128) (-676.296) (-671.780) [-673.003] * (-675.957) (-671.399) [-674.273] (-676.687) -- 0:01:13
109500 -- (-672.143) (-671.719) (-672.272) [-675.131] * (-672.649) (-673.854) (-672.621) [-678.768] -- 0:01:13
110000 -- (-672.890) [-673.144] (-671.349) (-671.175) * (-674.928) (-674.241) (-671.704) [-672.476] -- 0:01:12
Average standard deviation of split frequencies: 0.018222
110500 -- (-675.650) [-674.994] (-672.422) (-672.007) * (-675.560) [-672.618] (-674.388) (-672.186) -- 0:01:12
111000 -- (-670.969) [-671.754] (-671.253) (-672.924) * (-671.065) [-673.173] (-673.123) (-677.471) -- 0:01:12
111500 -- (-670.727) (-674.251) [-671.665] (-676.065) * [-670.753] (-673.308) (-671.976) (-676.660) -- 0:01:11
112000 -- (-673.687) [-672.869] (-672.474) (-679.747) * (-674.408) [-673.248] (-674.673) (-674.557) -- 0:01:19
112500 -- [-672.807] (-671.744) (-673.497) (-674.835) * (-672.312) [-674.993] (-674.652) (-674.048) -- 0:01:18
113000 -- (-673.766) [-671.893] (-672.686) (-673.056) * (-673.353) [-671.932] (-671.382) (-674.469) -- 0:01:18
113500 -- (-671.952) (-671.615) [-671.216] (-671.824) * (-675.433) (-674.657) (-676.548) [-675.027] -- 0:01:18
114000 -- (-672.903) [-674.496] (-673.002) (-673.176) * (-675.137) (-672.115) (-675.603) [-672.506] -- 0:01:17
114500 -- (-673.367) [-671.492] (-674.753) (-671.648) * (-674.111) (-676.636) (-676.443) [-673.620] -- 0:01:17
115000 -- (-673.012) (-672.036) (-674.172) [-671.065] * (-672.782) [-673.359] (-671.948) (-674.135) -- 0:01:16
Average standard deviation of split frequencies: 0.017451
115500 -- [-673.218] (-673.753) (-671.948) (-674.665) * (-673.929) [-672.630] (-671.878) (-670.623) -- 0:01:16
116000 -- (-672.973) (-671.352) [-673.474] (-677.152) * (-675.108) [-673.946] (-673.132) (-670.650) -- 0:01:16
116500 -- (-672.046) (-672.396) [-673.347] (-674.250) * (-674.035) [-673.260] (-674.618) (-675.302) -- 0:01:15
117000 -- [-672.290] (-672.876) (-677.967) (-676.156) * (-671.842) (-672.155) [-673.024] (-676.502) -- 0:01:15
117500 -- [-672.031] (-674.303) (-676.647) (-673.588) * (-675.439) [-671.965] (-672.179) (-673.333) -- 0:01:15
118000 -- (-674.488) (-673.609) (-671.587) [-674.837] * (-671.848) (-674.424) (-672.246) [-674.459] -- 0:01:14
118500 -- (-674.122) (-673.537) [-672.168] (-673.518) * (-675.597) (-675.467) (-672.511) [-672.633] -- 0:01:14
119000 -- [-673.293] (-673.018) (-673.987) (-672.149) * (-674.147) [-673.278] (-672.340) (-671.147) -- 0:01:14
119500 -- [-672.629] (-674.281) (-673.068) (-674.257) * (-671.420) (-676.837) [-673.376] (-672.696) -- 0:01:13
120000 -- (-671.412) [-672.016] (-671.625) (-672.384) * (-673.856) [-675.934] (-671.312) (-672.486) -- 0:01:13
Average standard deviation of split frequencies: 0.019289
120500 -- [-671.377] (-670.707) (-672.629) (-674.129) * (-672.093) (-673.514) [-674.254] (-671.683) -- 0:01:12
121000 -- (-671.303) [-672.426] (-670.944) (-672.074) * [-671.629] (-672.643) (-671.035) (-673.152) -- 0:01:12
121500 -- (-673.919) [-674.540] (-672.494) (-674.559) * [-671.851] (-675.220) (-675.027) (-672.020) -- 0:01:12
122000 -- (-672.360) (-672.334) [-672.639] (-671.029) * [-673.572] (-673.698) (-672.767) (-671.086) -- 0:01:11
122500 -- (-672.591) (-671.586) [-671.467] (-673.661) * (-674.174) (-672.439) [-675.610] (-671.657) -- 0:01:11
123000 -- (-672.887) (-673.050) (-673.017) [-677.134] * (-671.961) [-671.471] (-673.796) (-672.469) -- 0:01:11
123500 -- (-672.585) (-673.405) [-673.054] (-672.831) * (-673.232) [-671.716] (-675.683) (-671.726) -- 0:01:10
124000 -- (-672.973) (-674.513) [-673.182] (-673.186) * (-671.291) [-672.378] (-673.138) (-671.934) -- 0:01:10
124500 -- (-676.998) [-675.608] (-673.857) (-675.452) * (-673.600) [-672.151] (-672.303) (-671.257) -- 0:01:17
125000 -- (-672.874) (-672.257) (-673.147) [-672.323] * (-672.659) (-673.199) (-672.753) [-671.673] -- 0:01:17
Average standard deviation of split frequencies: 0.014571
125500 -- (-673.952) (-673.623) (-673.413) [-673.755] * (-671.128) [-671.335] (-671.717) (-671.234) -- 0:01:16
126000 -- (-673.975) [-674.022] (-674.299) (-673.559) * (-674.553) (-674.891) [-672.397] (-674.545) -- 0:01:16
126500 -- (-672.697) [-673.178] (-671.212) (-673.766) * (-677.136) [-674.356] (-671.051) (-674.053) -- 0:01:15
127000 -- (-673.643) [-671.568] (-671.726) (-673.637) * (-672.118) [-673.207] (-676.747) (-670.433) -- 0:01:15
127500 -- [-671.214] (-676.491) (-670.787) (-672.423) * [-671.550] (-671.968) (-671.407) (-671.609) -- 0:01:15
128000 -- [-671.529] (-675.627) (-673.955) (-672.051) * [-671.694] (-671.779) (-671.338) (-671.605) -- 0:01:14
128500 -- (-674.514) (-672.672) (-670.773) [-671.548] * (-671.043) (-672.252) (-671.416) [-671.822] -- 0:01:14
129000 -- (-675.563) (-673.509) (-672.153) [-670.926] * (-671.091) [-671.355] (-671.868) (-673.069) -- 0:01:14
129500 -- [-675.436] (-673.604) (-672.603) (-671.941) * (-674.263) [-672.850] (-675.401) (-676.063) -- 0:01:13
130000 -- (-671.367) (-674.929) (-672.230) [-671.709] * (-678.802) (-671.852) [-671.463] (-676.313) -- 0:01:13
Average standard deviation of split frequencies: 0.015280
130500 -- [-671.878] (-671.421) (-673.179) (-671.492) * (-674.161) (-673.047) [-672.127] (-672.533) -- 0:01:13
131000 -- (-676.197) (-676.065) [-672.304] (-675.161) * (-676.433) [-671.623] (-676.145) (-673.273) -- 0:01:12
131500 -- [-671.724] (-671.972) (-671.786) (-674.456) * (-677.528) (-672.221) [-673.517] (-676.388) -- 0:01:12
132000 -- (-671.900) [-672.351] (-672.916) (-674.553) * (-680.036) [-672.889] (-671.736) (-673.876) -- 0:01:12
132500 -- [-673.007] (-675.099) (-674.332) (-676.704) * [-674.306] (-673.194) (-672.609) (-673.000) -- 0:01:12
133000 -- [-675.817] (-678.171) (-673.322) (-675.569) * (-679.304) (-675.699) (-675.983) [-674.189] -- 0:01:11
133500 -- (-673.798) [-671.644] (-671.019) (-678.307) * (-672.123) (-672.856) (-676.122) [-671.567] -- 0:01:11
134000 -- (-671.857) (-673.084) [-674.914] (-676.041) * (-671.670) [-670.973] (-673.833) (-673.711) -- 0:01:11
134500 -- (-672.599) [-672.657] (-672.234) (-672.317) * (-674.718) (-674.269) [-670.472] (-674.272) -- 0:01:10
135000 -- (-677.797) (-672.219) (-673.331) [-673.726] * (-673.914) (-673.728) [-670.915] (-672.246) -- 0:01:10
Average standard deviation of split frequencies: 0.016561
135500 -- (-672.097) (-674.759) [-674.976] (-676.469) * [-675.294] (-673.511) (-672.426) (-672.680) -- 0:01:10
136000 -- (-672.314) [-672.136] (-671.544) (-673.034) * [-676.329] (-673.480) (-671.151) (-675.977) -- 0:01:09
136500 -- (-675.067) (-673.167) [-674.524] (-674.404) * [-672.053] (-674.032) (-671.159) (-673.393) -- 0:01:15
137000 -- [-673.129] (-675.137) (-673.906) (-673.417) * (-673.015) (-673.455) [-671.215] (-671.977) -- 0:01:15
137500 -- [-679.174] (-672.001) (-673.147) (-675.855) * (-672.407) [-672.906] (-676.256) (-671.660) -- 0:01:15
138000 -- (-676.263) (-671.905) (-676.495) [-670.919] * (-671.407) [-672.096] (-678.113) (-672.719) -- 0:01:14
138500 -- (-678.493) (-671.466) [-673.427] (-672.684) * [-676.253] (-675.646) (-681.334) (-674.811) -- 0:01:14
139000 -- (-675.250) (-673.243) (-671.233) [-672.015] * (-672.937) [-673.750] (-675.707) (-672.321) -- 0:01:14
139500 -- (-673.477) (-673.261) [-674.590] (-677.904) * (-672.830) (-674.732) [-673.777] (-675.011) -- 0:01:14
140000 -- [-672.636] (-674.992) (-673.144) (-672.754) * (-672.760) (-671.500) [-671.404] (-680.254) -- 0:01:13
Average standard deviation of split frequencies: 0.016011
140500 -- (-673.656) (-674.677) [-674.727] (-674.136) * [-675.362] (-671.408) (-671.809) (-671.946) -- 0:01:13
141000 -- [-671.531] (-672.840) (-671.745) (-675.709) * (-672.095) (-672.611) [-671.067] (-671.888) -- 0:01:13
141500 -- (-673.325) [-674.474] (-674.575) (-676.609) * (-673.855) (-673.026) (-671.419) [-671.847] -- 0:01:12
142000 -- (-672.861) [-672.325] (-672.204) (-671.913) * (-674.844) [-672.739] (-672.581) (-671.824) -- 0:01:12
142500 -- (-674.399) [-672.628] (-671.811) (-673.746) * [-672.260] (-672.079) (-674.580) (-670.985) -- 0:01:12
143000 -- (-677.802) (-672.409) [-672.492] (-674.913) * (-678.090) (-672.811) (-672.316) [-672.900] -- 0:01:11
143500 -- [-674.827] (-670.863) (-672.810) (-675.914) * (-672.463) [-673.222] (-677.057) (-671.614) -- 0:01:11
144000 -- (-673.371) (-673.530) [-672.459] (-672.154) * (-671.726) (-671.413) [-675.429] (-672.232) -- 0:01:11
144500 -- (-674.347) (-672.335) (-670.673) [-672.981] * (-672.728) (-671.391) (-674.127) [-672.029] -- 0:01:11
145000 -- (-693.355) [-672.212] (-671.399) (-676.176) * (-675.439) [-674.562] (-672.547) (-672.419) -- 0:01:10
Average standard deviation of split frequencies: 0.014105
145500 -- (-678.924) [-671.651] (-673.402) (-672.275) * (-671.061) [-671.698] (-673.948) (-673.038) -- 0:01:10
146000 -- (-674.174) (-677.194) (-672.408) [-672.230] * (-676.301) (-674.577) (-674.230) [-671.734] -- 0:01:10
146500 -- (-671.511) (-676.195) [-672.597] (-672.339) * (-673.024) (-679.685) [-674.590] (-670.909) -- 0:01:09
147000 -- [-672.743] (-674.862) (-672.410) (-675.704) * [-672.024] (-671.750) (-676.641) (-672.370) -- 0:01:09
147500 -- (-674.872) [-672.408] (-672.821) (-676.406) * (-672.846) (-671.428) (-673.964) [-671.827] -- 0:01:09
148000 -- (-673.820) (-673.573) (-671.973) [-673.061] * (-678.412) (-671.945) (-673.698) [-671.225] -- 0:01:09
148500 -- (-672.302) (-671.412) [-673.363] (-672.249) * (-674.929) [-671.026] (-674.149) (-671.278) -- 0:01:08
149000 -- (-675.935) (-673.497) [-674.361] (-676.466) * [-674.501] (-673.376) (-675.812) (-675.205) -- 0:01:14
149500 -- (-672.264) (-673.537) (-673.207) [-677.822] * (-674.442) (-672.395) (-673.172) [-675.962] -- 0:01:13
150000 -- (-671.269) [-674.089] (-670.973) (-673.109) * (-675.012) [-674.616] (-672.528) (-672.118) -- 0:01:13
Average standard deviation of split frequencies: 0.013906
150500 -- (-670.929) (-673.712) [-671.684] (-674.350) * (-674.231) (-670.946) (-671.540) [-670.975] -- 0:01:13
151000 -- (-673.649) [-673.623] (-674.663) (-673.560) * (-672.273) (-671.280) (-673.734) [-671.865] -- 0:01:13
151500 -- (-675.381) [-674.188] (-676.291) (-672.745) * [-671.522] (-671.269) (-673.381) (-672.289) -- 0:01:12
152000 -- (-675.409) (-675.334) [-672.760] (-672.532) * (-673.361) (-671.317) (-671.701) [-675.488] -- 0:01:12
152500 -- (-675.514) (-677.022) [-672.361] (-672.774) * [-670.714] (-672.191) (-672.144) (-674.889) -- 0:01:12
153000 -- [-675.027] (-672.886) (-673.413) (-673.486) * [-673.133] (-670.947) (-673.130) (-670.741) -- 0:01:11
153500 -- (-672.032) (-674.433) [-671.842] (-674.335) * [-671.360] (-671.672) (-672.609) (-671.788) -- 0:01:11
154000 -- (-674.481) [-673.501] (-671.635) (-672.975) * [-671.027] (-672.797) (-670.951) (-675.683) -- 0:01:11
154500 -- [-672.293] (-673.026) (-673.261) (-672.164) * (-672.153) (-672.012) (-673.552) [-673.687] -- 0:01:11
155000 -- (-672.291) [-670.902] (-672.609) (-674.380) * (-671.953) [-672.651] (-673.081) (-670.946) -- 0:01:10
Average standard deviation of split frequencies: 0.014354
155500 -- (-672.837) (-672.150) (-675.510) [-673.416] * [-672.147] (-672.044) (-671.086) (-674.329) -- 0:01:10
156000 -- [-672.694] (-672.047) (-678.011) (-672.626) * (-671.489) (-674.335) [-673.810] (-673.235) -- 0:01:10
156500 -- (-677.164) [-678.088] (-674.968) (-672.604) * (-676.531) [-671.179] (-672.820) (-672.986) -- 0:01:10
157000 -- (-678.132) (-673.418) [-676.490] (-673.061) * (-672.907) (-671.720) (-672.633) [-673.537] -- 0:01:09
157500 -- (-678.613) (-675.040) (-674.545) [-673.203] * [-672.312] (-673.383) (-676.929) (-673.853) -- 0:01:09
158000 -- (-675.545) (-671.248) [-671.704] (-677.538) * (-672.912) [-672.550] (-674.661) (-673.110) -- 0:01:09
158500 -- (-673.524) (-670.785) [-673.925] (-673.341) * (-672.303) [-672.571] (-671.769) (-671.711) -- 0:01:09
159000 -- [-671.616] (-679.302) (-676.182) (-671.278) * (-676.161) (-672.426) (-672.558) [-672.526] -- 0:01:08
159500 -- [-671.765] (-673.370) (-675.716) (-672.803) * (-671.884) (-672.928) [-674.897] (-670.879) -- 0:01:08
160000 -- (-673.497) (-671.856) [-673.060] (-676.635) * (-674.505) (-672.765) [-673.013] (-671.091) -- 0:01:13
Average standard deviation of split frequencies: 0.016300
160500 -- (-674.205) (-671.254) [-673.579] (-673.978) * (-677.847) (-672.013) (-675.107) [-671.601] -- 0:01:13
161000 -- (-671.228) (-671.377) (-674.277) [-671.463] * (-680.909) (-674.183) (-674.122) [-671.743] -- 0:01:12
161500 -- (-673.610) (-673.759) [-675.002] (-675.083) * [-673.222] (-674.476) (-673.116) (-672.396) -- 0:01:12
162000 -- (-673.619) [-672.978] (-673.053) (-676.331) * [-673.697] (-673.358) (-671.757) (-672.403) -- 0:01:12
162500 -- (-672.260) [-672.261] (-673.143) (-671.893) * [-675.404] (-673.466) (-672.613) (-672.491) -- 0:01:12
163000 -- (-671.584) (-674.542) [-672.035] (-672.113) * (-675.106) [-672.101] (-676.250) (-671.900) -- 0:01:11
163500 -- (-671.022) [-672.318] (-672.351) (-674.345) * [-671.248] (-672.823) (-672.158) (-671.323) -- 0:01:11
164000 -- [-676.477] (-672.125) (-675.174) (-676.468) * (-671.898) [-674.627] (-675.609) (-672.198) -- 0:01:11
164500 -- (-679.092) (-672.510) [-672.082] (-675.396) * (-672.976) [-673.589] (-674.459) (-674.302) -- 0:01:11
165000 -- (-678.121) [-672.591] (-673.740) (-674.243) * (-674.091) (-675.348) (-673.152) [-676.539] -- 0:01:10
Average standard deviation of split frequencies: 0.017935
165500 -- (-675.742) (-671.236) [-673.618] (-671.539) * (-675.663) (-676.617) [-671.624] (-675.868) -- 0:01:10
166000 -- (-671.552) (-676.157) (-673.457) [-671.825] * (-672.442) [-677.376] (-672.477) (-673.705) -- 0:01:10
166500 -- (-673.350) [-674.746] (-673.298) (-673.778) * [-671.112] (-678.238) (-673.487) (-671.201) -- 0:01:10
167000 -- (-671.260) [-674.270] (-671.718) (-672.378) * (-671.419) (-670.910) [-675.008] (-674.058) -- 0:01:09
167500 -- [-671.564] (-673.298) (-673.050) (-673.729) * [-675.179] (-671.260) (-673.337) (-676.314) -- 0:01:09
168000 -- (-671.374) [-674.230] (-675.098) (-677.953) * (-675.058) [-671.198] (-673.603) (-672.616) -- 0:01:09
168500 -- (-672.003) [-676.198] (-674.553) (-675.984) * (-673.881) (-670.937) (-671.484) [-674.086] -- 0:01:09
169000 -- (-672.220) (-672.333) (-675.000) [-672.788] * (-673.677) [-673.286] (-671.233) (-675.735) -- 0:01:08
169500 -- (-673.138) (-672.563) [-671.359] (-671.675) * [-672.732] (-672.366) (-672.939) (-673.528) -- 0:01:08
170000 -- (-675.621) (-672.140) [-672.503] (-671.489) * (-670.741) (-678.222) [-673.244] (-672.620) -- 0:01:08
Average standard deviation of split frequencies: 0.018317
170500 -- [-672.479] (-671.029) (-674.629) (-676.693) * [-671.791] (-674.757) (-673.684) (-671.073) -- 0:01:08
171000 -- (-673.028) (-673.756) (-672.827) [-674.658] * [-671.015] (-673.240) (-673.410) (-671.461) -- 0:01:12
171500 -- (-673.917) (-672.824) [-673.932] (-671.526) * [-671.745] (-675.464) (-670.897) (-674.921) -- 0:01:12
172000 -- [-672.205] (-672.593) (-673.750) (-671.058) * [-671.861] (-675.251) (-674.053) (-674.997) -- 0:01:12
172500 -- (-671.748) [-672.098] (-671.969) (-672.401) * (-672.822) (-671.290) (-671.477) [-674.227] -- 0:01:11
173000 -- (-676.207) (-674.075) (-676.818) [-670.822] * (-675.902) (-673.548) (-674.319) [-673.847] -- 0:01:11
173500 -- (-673.842) (-672.810) [-671.251] (-674.435) * (-673.369) (-675.628) (-671.131) [-672.348] -- 0:01:11
174000 -- (-673.173) [-671.064] (-671.465) (-673.221) * [-674.585] (-674.925) (-671.458) (-670.861) -- 0:01:11
174500 -- (-673.185) (-671.212) [-672.490] (-676.525) * (-673.853) (-677.347) [-670.579] (-670.961) -- 0:01:10
175000 -- (-671.589) (-675.167) [-672.178] (-672.484) * (-671.925) (-671.832) (-673.240) [-671.985] -- 0:01:10
Average standard deviation of split frequencies: 0.017112
175500 -- (-671.750) [-676.971] (-672.106) (-671.907) * [-671.900] (-674.414) (-673.119) (-674.420) -- 0:01:10
176000 -- (-674.151) (-677.085) (-672.579) [-673.526] * [-672.410] (-674.888) (-672.779) (-672.724) -- 0:01:10
176500 -- [-672.086] (-672.340) (-673.816) (-672.745) * (-673.227) [-674.124] (-673.205) (-672.412) -- 0:01:09
177000 -- (-671.740) [-671.563] (-675.346) (-678.273) * (-675.232) (-672.223) (-673.875) [-671.854] -- 0:01:09
177500 -- (-679.451) (-675.567) [-674.520] (-676.022) * (-672.303) (-676.237) (-676.920) [-672.671] -- 0:01:09
178000 -- [-672.686] (-672.622) (-672.525) (-672.077) * (-671.536) (-674.525) [-672.523] (-671.342) -- 0:01:09
178500 -- (-674.961) [-672.615] (-674.616) (-673.297) * (-672.599) (-672.726) [-671.996] (-671.871) -- 0:01:09
179000 -- (-673.770) (-676.604) [-674.580] (-671.526) * [-674.902] (-672.746) (-674.903) (-674.693) -- 0:01:08
179500 -- (-672.414) [-674.399] (-673.219) (-675.793) * (-673.932) [-674.078] (-674.124) (-672.756) -- 0:01:08
180000 -- (-674.903) (-674.458) [-674.461] (-671.622) * (-673.455) (-670.766) (-673.091) [-672.130] -- 0:01:08
Average standard deviation of split frequencies: 0.014786
180500 -- (-673.711) [-672.161] (-675.739) (-672.870) * [-674.240] (-675.403) (-674.178) (-671.570) -- 0:01:08
181000 -- (-674.081) [-671.743] (-672.742) (-672.603) * (-674.559) (-674.326) (-671.731) [-671.983] -- 0:01:07
181500 -- (-672.674) [-671.517] (-673.340) (-672.210) * (-673.712) (-674.375) [-671.415] (-675.979) -- 0:01:07
182000 -- (-671.912) (-671.776) (-671.482) [-670.974] * (-673.422) (-672.339) (-671.378) [-672.118] -- 0:01:07
182500 -- [-671.167] (-671.986) (-672.432) (-673.000) * (-673.246) (-675.026) [-671.187] (-672.964) -- 0:01:07
183000 -- [-671.936] (-673.479) (-672.960) (-673.441) * (-671.771) (-675.626) (-671.137) [-672.436] -- 0:01:06
183500 -- (-670.648) (-671.972) (-675.546) [-671.764] * [-671.416] (-671.732) (-672.628) (-672.580) -- 0:01:11
184000 -- [-671.655] (-671.586) (-672.950) (-673.166) * (-672.939) (-671.295) [-672.225] (-673.101) -- 0:01:10
184500 -- [-676.329] (-673.214) (-672.059) (-672.549) * (-671.593) (-672.422) [-672.678] (-673.119) -- 0:01:10
185000 -- [-674.983] (-674.377) (-673.134) (-671.782) * (-671.812) (-671.524) [-672.804] (-673.537) -- 0:01:10
Average standard deviation of split frequencies: 0.014806
185500 -- [-675.979] (-673.518) (-671.971) (-677.508) * (-677.935) (-673.160) [-676.427] (-675.816) -- 0:01:10
186000 -- [-673.803] (-670.907) (-673.219) (-673.799) * (-675.389) (-670.969) (-672.545) [-677.204] -- 0:01:10
186500 -- (-671.764) (-674.637) (-671.184) [-670.730] * (-674.153) [-673.426] (-676.561) (-671.278) -- 0:01:09
187000 -- (-671.873) (-672.966) [-670.965] (-671.715) * (-672.443) (-671.385) [-671.833] (-671.017) -- 0:01:09
187500 -- (-672.245) (-671.665) [-675.079] (-672.017) * [-670.635] (-674.707) (-671.176) (-674.803) -- 0:01:09
188000 -- (-674.785) (-676.250) (-674.001) [-672.672] * [-672.197] (-673.523) (-670.983) (-673.686) -- 0:01:09
188500 -- (-671.561) [-672.635] (-677.586) (-672.534) * (-672.240) (-672.533) (-672.812) [-672.811] -- 0:01:08
189000 -- (-671.399) [-671.458] (-677.469) (-673.502) * (-674.605) (-672.896) [-672.725] (-674.396) -- 0:01:08
189500 -- (-673.234) [-671.871] (-676.557) (-676.507) * (-676.634) (-671.530) (-673.311) [-671.301] -- 0:01:08
190000 -- (-676.956) (-672.528) [-674.545] (-673.681) * (-673.922) [-673.489] (-676.904) (-672.578) -- 0:01:08
Average standard deviation of split frequencies: 0.014980
190500 -- [-671.488] (-671.815) (-673.066) (-678.487) * (-671.415) (-672.906) (-671.037) [-674.286] -- 0:01:07
191000 -- (-671.745) (-672.797) [-672.211] (-679.934) * (-671.257) (-673.594) [-675.105] (-675.945) -- 0:01:07
191500 -- (-675.979) (-671.136) [-671.029] (-675.131) * (-674.841) [-671.310] (-671.428) (-672.426) -- 0:01:07
192000 -- (-674.364) [-672.297] (-674.891) (-671.333) * (-673.284) (-671.161) (-671.086) [-672.717] -- 0:01:07
192500 -- (-674.316) (-672.648) [-672.649] (-675.409) * (-675.489) (-672.259) [-673.592] (-672.598) -- 0:01:07
193000 -- (-676.085) (-674.994) [-672.819] (-671.823) * (-674.437) (-670.886) [-673.787] (-674.810) -- 0:01:06
193500 -- [-673.103] (-672.945) (-672.481) (-671.514) * (-674.454) (-671.193) (-675.905) [-671.189] -- 0:01:06
194000 -- [-671.103] (-671.793) (-672.654) (-671.552) * [-681.778] (-676.400) (-675.256) (-676.283) -- 0:01:06
194500 -- [-671.131] (-672.232) (-678.628) (-675.384) * [-673.085] (-677.431) (-674.210) (-673.521) -- 0:01:06
195000 -- [-672.770] (-672.242) (-675.459) (-671.805) * [-672.365] (-672.671) (-676.258) (-671.231) -- 0:01:06
Average standard deviation of split frequencies: 0.015280
195500 -- [-672.821] (-674.058) (-674.102) (-671.250) * [-673.549] (-672.242) (-670.852) (-673.370) -- 0:01:09
196000 -- [-674.055] (-676.734) (-672.075) (-672.763) * (-673.372) [-671.010] (-672.707) (-672.274) -- 0:01:09
196500 -- (-675.009) (-675.489) (-671.072) [-673.863] * (-672.535) (-671.655) (-672.282) [-673.342] -- 0:01:09
197000 -- (-672.045) (-677.916) [-672.329] (-673.270) * (-677.436) (-675.034) (-675.557) [-672.256] -- 0:01:09
197500 -- (-673.354) (-678.369) [-672.127] (-676.260) * (-674.400) (-672.482) (-671.653) [-671.917] -- 0:01:09
198000 -- (-673.316) (-672.428) [-671.861] (-673.788) * (-672.881) [-671.972] (-672.286) (-672.031) -- 0:01:08
198500 -- [-673.863] (-672.771) (-675.010) (-677.560) * (-671.370) [-673.985] (-671.062) (-676.473) -- 0:01:08
199000 -- (-672.681) [-672.829] (-672.971) (-674.660) * (-671.248) (-671.393) (-674.446) [-675.440] -- 0:01:08
199500 -- (-673.377) [-670.855] (-672.207) (-674.766) * [-676.727] (-671.355) (-673.127) (-672.929) -- 0:01:08
200000 -- (-671.119) [-674.219] (-673.454) (-673.161) * (-677.104) (-671.647) (-672.486) [-671.541] -- 0:01:08
Average standard deviation of split frequencies: 0.016859
200500 -- (-672.824) [-671.550] (-672.559) (-675.302) * (-672.521) [-671.377] (-671.238) (-673.406) -- 0:01:07
201000 -- [-672.872] (-670.772) (-670.889) (-679.013) * (-671.851) (-671.323) [-673.935] (-674.285) -- 0:01:07
201500 -- (-672.914) (-672.160) (-671.407) [-675.056] * (-671.195) (-671.302) [-670.983] (-673.637) -- 0:01:07
202000 -- [-671.526] (-672.380) (-672.842) (-674.042) * (-678.658) (-673.067) [-673.089] (-671.679) -- 0:01:07
202500 -- (-671.152) (-672.650) [-674.632] (-674.186) * [-672.741] (-677.751) (-671.370) (-674.508) -- 0:01:06
203000 -- (-671.077) [-672.905] (-676.407) (-674.770) * (-673.212) (-676.768) [-670.643] (-673.016) -- 0:01:06
203500 -- (-673.699) (-672.610) (-676.977) [-676.244] * (-673.333) (-673.169) [-670.643] (-674.363) -- 0:01:06
204000 -- (-672.918) (-672.298) (-671.387) [-672.603] * (-673.119) [-672.835] (-671.874) (-672.828) -- 0:01:06
204500 -- [-672.036] (-672.663) (-672.555) (-673.196) * (-671.822) (-673.192) [-670.722] (-673.695) -- 0:01:06
205000 -- (-672.194) (-671.517) [-671.687] (-673.139) * [-673.377] (-673.350) (-672.216) (-675.432) -- 0:01:05
Average standard deviation of split frequencies: 0.016019
205500 -- (-674.660) (-670.789) (-671.919) [-671.248] * (-675.885) (-671.871) [-672.191] (-680.768) -- 0:01:05
206000 -- (-673.610) (-673.182) [-673.041] (-673.001) * [-677.280] (-672.381) (-671.022) (-675.202) -- 0:01:05
206500 -- (-676.407) [-672.055] (-672.628) (-671.811) * (-675.922) (-672.828) (-672.231) [-674.722] -- 0:01:05
207000 -- (-673.269) [-672.399] (-674.013) (-672.050) * (-674.403) (-672.292) [-672.144] (-673.632) -- 0:01:05
207500 -- (-673.164) [-673.070] (-673.350) (-673.122) * (-671.903) (-671.776) [-672.988] (-672.181) -- 0:01:08
208000 -- (-673.911) (-672.261) (-671.408) [-671.545] * (-672.216) (-672.309) [-672.583] (-671.921) -- 0:01:08
208500 -- (-672.164) (-675.973) (-670.840) [-672.352] * (-670.910) [-672.560] (-671.554) (-672.580) -- 0:01:08
209000 -- (-671.830) (-671.502) (-674.361) [-674.348] * (-671.705) [-674.356] (-679.127) (-673.890) -- 0:01:08
209500 -- [-671.142] (-671.801) (-673.721) (-674.086) * [-673.231] (-672.312) (-677.345) (-672.998) -- 0:01:07
210000 -- [-671.385] (-673.526) (-671.213) (-672.511) * (-674.056) (-671.861) (-676.464) [-677.710] -- 0:01:07
Average standard deviation of split frequencies: 0.017375
210500 -- (-671.464) (-672.241) (-671.980) [-671.202] * (-671.466) (-672.427) (-673.668) [-675.707] -- 0:01:07
211000 -- (-671.989) (-672.924) (-674.684) [-673.787] * (-671.924) [-671.846] (-677.863) (-674.674) -- 0:01:07
211500 -- (-673.731) [-672.104] (-671.699) (-673.346) * (-670.804) (-672.944) (-675.208) [-672.172] -- 0:01:07
212000 -- (-675.972) (-674.609) (-671.332) [-671.564] * (-673.639) (-671.404) (-678.565) [-671.707] -- 0:01:06
212500 -- (-675.960) (-672.333) (-670.890) [-678.456] * (-676.500) (-671.553) (-681.267) [-672.023] -- 0:01:06
213000 -- (-670.792) (-677.878) [-670.497] (-672.543) * (-672.407) [-677.768] (-671.130) (-673.655) -- 0:01:06
213500 -- [-671.400] (-675.804) (-671.747) (-670.844) * [-676.350] (-671.414) (-675.408) (-672.387) -- 0:01:06
214000 -- (-673.060) [-674.480] (-674.260) (-671.709) * (-674.732) [-672.407] (-672.773) (-672.353) -- 0:01:06
214500 -- (-671.921) [-673.506] (-671.250) (-673.563) * (-674.597) (-670.801) (-671.701) [-670.761] -- 0:01:05
215000 -- (-672.095) [-676.757] (-671.278) (-673.097) * (-673.722) (-672.630) (-672.914) [-672.168] -- 0:01:05
Average standard deviation of split frequencies: 0.018429
215500 -- (-670.766) [-675.557] (-672.290) (-672.707) * (-674.096) (-671.773) (-673.492) [-671.837] -- 0:01:05
216000 -- (-670.876) [-672.462] (-672.276) (-673.043) * (-675.670) (-672.411) [-671.985] (-672.042) -- 0:01:05
216500 -- (-674.147) [-672.035] (-672.224) (-672.417) * (-673.451) (-671.440) (-674.586) [-671.929] -- 0:01:05
217000 -- (-674.674) [-672.726] (-671.940) (-675.289) * (-671.178) (-671.957) [-671.855] (-672.493) -- 0:01:04
217500 -- (-675.714) (-672.330) (-671.482) [-673.995] * [-672.924] (-672.871) (-680.036) (-675.889) -- 0:01:04
218000 -- (-671.255) (-671.271) [-671.180] (-672.896) * (-673.881) (-673.480) (-672.215) [-678.923] -- 0:01:04
218500 -- [-673.788] (-679.121) (-672.991) (-671.190) * (-671.902) (-671.818) [-674.729] (-672.979) -- 0:01:04
219000 -- (-674.311) (-673.827) [-671.533] (-674.042) * (-672.115) (-672.723) [-674.016] (-671.255) -- 0:01:04
219500 -- (-673.226) (-672.672) [-675.787] (-672.391) * (-674.406) [-671.535] (-673.961) (-676.532) -- 0:01:04
220000 -- [-671.946] (-671.657) (-674.422) (-671.115) * [-671.095] (-673.394) (-675.822) (-672.086) -- 0:01:07
Average standard deviation of split frequencies: 0.019226
220500 -- (-674.021) (-672.063) (-676.581) [-670.876] * (-672.575) (-677.994) [-673.649] (-672.369) -- 0:01:07
221000 -- (-672.186) (-671.652) (-671.477) [-672.503] * (-677.086) [-676.873] (-674.977) (-672.395) -- 0:01:06
221500 -- [-672.645] (-671.264) (-671.331) (-672.186) * [-671.100] (-671.575) (-673.405) (-675.568) -- 0:01:06
222000 -- [-674.473] (-672.027) (-674.273) (-671.959) * [-671.434] (-674.151) (-673.953) (-671.577) -- 0:01:06
222500 -- [-672.147] (-671.634) (-671.534) (-674.690) * (-672.135) (-672.741) (-671.895) [-673.901] -- 0:01:06
223000 -- [-672.757] (-673.236) (-672.018) (-676.453) * (-672.807) (-673.849) [-675.559] (-672.872) -- 0:01:06
223500 -- [-672.034] (-672.834) (-674.200) (-672.084) * [-674.630] (-672.197) (-672.732) (-674.620) -- 0:01:06
224000 -- (-673.321) [-672.879] (-676.283) (-671.751) * [-672.057] (-673.030) (-672.756) (-672.064) -- 0:01:05
224500 -- (-673.333) (-672.286) (-673.931) [-671.868] * (-673.340) (-673.445) [-672.097] (-673.259) -- 0:01:05
225000 -- (-673.731) (-672.882) [-674.035] (-671.372) * (-671.977) (-671.214) (-674.406) [-673.137] -- 0:01:05
Average standard deviation of split frequencies: 0.018077
225500 -- [-672.247] (-674.890) (-673.942) (-671.350) * [-674.050] (-671.422) (-672.320) (-672.435) -- 0:01:05
226000 -- (-674.315) (-671.822) (-672.647) [-672.441] * (-678.649) (-672.224) [-671.619] (-672.985) -- 0:01:05
226500 -- (-675.107) (-671.410) (-674.068) [-671.516] * (-674.209) (-671.607) [-671.152] (-672.113) -- 0:01:04
227000 -- [-675.703] (-675.986) (-672.281) (-674.894) * (-679.366) (-672.933) [-675.494] (-677.217) -- 0:01:04
227500 -- (-675.399) [-676.183] (-672.121) (-674.496) * (-673.376) (-673.118) (-673.711) [-677.503] -- 0:01:04
228000 -- [-673.500] (-674.157) (-672.165) (-674.445) * (-672.526) (-672.803) [-671.215] (-672.237) -- 0:01:04
228500 -- (-673.280) (-672.058) (-676.731) [-671.367] * [-673.790] (-671.117) (-671.456) (-671.782) -- 0:01:04
229000 -- [-670.726] (-670.668) (-673.850) (-678.267) * (-676.327) [-671.921] (-672.373) (-673.916) -- 0:01:03
229500 -- [-672.252] (-673.717) (-674.167) (-671.914) * (-673.601) (-671.199) (-672.255) [-673.620] -- 0:01:03
230000 -- [-672.911] (-671.787) (-674.576) (-675.242) * (-671.661) (-671.317) (-672.400) [-673.899] -- 0:01:03
Average standard deviation of split frequencies: 0.017144
230500 -- (-674.386) (-673.749) (-672.270) [-673.444] * (-671.410) (-676.330) (-673.108) [-670.920] -- 0:01:03
231000 -- (-672.097) [-675.462] (-672.830) (-674.218) * [-673.941] (-673.690) (-672.723) (-672.413) -- 0:01:03
231500 -- (-672.929) (-673.386) [-674.049] (-671.764) * (-673.110) (-673.494) [-675.137] (-672.881) -- 0:01:03
232000 -- [-672.759] (-673.558) (-672.995) (-674.281) * (-672.118) (-671.490) [-671.719] (-674.513) -- 0:01:06
232500 -- (-675.959) (-671.812) [-672.990] (-674.856) * (-673.080) [-672.699] (-673.258) (-676.625) -- 0:01:06
233000 -- (-677.958) [-671.238] (-674.442) (-677.880) * [-672.192] (-673.474) (-672.334) (-672.391) -- 0:01:05
233500 -- (-673.163) (-676.222) [-671.276] (-675.261) * [-675.502] (-677.553) (-676.427) (-671.481) -- 0:01:05
234000 -- (-676.965) [-671.582] (-672.432) (-673.965) * (-672.523) (-675.654) (-676.711) [-673.092] -- 0:01:05
234500 -- (-672.989) (-674.599) [-672.853] (-671.469) * (-671.937) (-672.565) (-673.738) [-671.663] -- 0:01:05
235000 -- (-672.210) (-673.957) (-671.952) [-671.820] * (-670.872) [-671.122] (-674.358) (-672.653) -- 0:01:05
Average standard deviation of split frequencies: 0.018447
235500 -- (-671.730) (-672.816) [-672.708] (-671.481) * [-677.135] (-673.686) (-675.948) (-678.304) -- 0:01:04
236000 -- (-674.217) [-671.781] (-673.060) (-676.278) * [-671.927] (-673.686) (-678.788) (-674.623) -- 0:01:04
236500 -- (-673.792) (-675.870) (-671.223) [-674.663] * (-674.046) (-672.989) (-673.912) [-673.455] -- 0:01:04
237000 -- [-673.444] (-676.060) (-672.572) (-681.899) * (-672.680) (-671.281) [-672.701] (-673.759) -- 0:01:04
237500 -- (-673.539) (-672.238) (-672.353) [-671.710] * (-672.532) (-672.479) [-671.529] (-672.760) -- 0:01:04
238000 -- (-671.024) (-672.069) (-671.581) [-673.421] * (-672.340) (-672.426) [-671.569] (-673.528) -- 0:01:04
238500 -- (-671.221) (-672.016) [-671.172] (-673.588) * (-674.442) [-673.562] (-672.051) (-673.089) -- 0:01:03
239000 -- (-671.342) (-674.845) [-672.735] (-677.561) * [-673.630] (-671.893) (-671.679) (-670.525) -- 0:01:03
239500 -- (-671.750) [-671.721] (-671.272) (-674.228) * (-672.464) (-672.641) [-671.198] (-671.897) -- 0:01:03
240000 -- [-672.061] (-673.912) (-671.643) (-676.771) * [-672.587] (-673.395) (-672.289) (-671.729) -- 0:01:03
Average standard deviation of split frequencies: 0.016758
240500 -- [-672.554] (-674.150) (-671.420) (-673.526) * (-674.302) [-673.047] (-674.380) (-674.102) -- 0:01:03
241000 -- [-671.002] (-676.199) (-672.696) (-673.804) * (-673.084) [-676.856] (-673.126) (-672.391) -- 0:01:02
241500 -- (-671.034) [-671.460] (-673.291) (-673.554) * [-674.488] (-675.975) (-672.597) (-671.811) -- 0:01:02
242000 -- [-671.311] (-674.523) (-671.625) (-674.360) * [-677.535] (-671.382) (-674.298) (-673.912) -- 0:01:02
242500 -- (-671.397) (-671.621) [-672.231] (-673.992) * (-678.905) (-672.337) (-676.148) [-674.903] -- 0:01:02
243000 -- (-674.431) (-672.329) [-673.597] (-671.243) * (-672.735) (-671.396) (-675.656) [-673.337] -- 0:01:02
243500 -- (-671.342) [-675.527] (-672.193) (-673.137) * [-671.252] (-674.740) (-675.085) (-675.638) -- 0:01:02
244000 -- (-673.021) (-673.725) (-671.508) [-672.705] * (-675.080) (-676.080) (-674.877) [-671.824] -- 0:01:05
244500 -- [-672.819] (-675.645) (-671.693) (-672.206) * (-672.619) [-674.400] (-673.883) (-675.785) -- 0:01:04
245000 -- (-671.281) [-673.854] (-672.308) (-672.749) * (-673.193) (-677.435) (-672.314) [-672.831] -- 0:01:04
Average standard deviation of split frequencies: 0.015781
245500 -- (-672.973) (-677.884) [-672.186] (-674.349) * [-672.372] (-675.618) (-674.380) (-673.337) -- 0:01:04
246000 -- (-677.469) [-673.761] (-674.571) (-671.616) * (-673.008) (-673.000) (-672.814) [-679.084] -- 0:01:04
246500 -- (-674.866) [-673.390] (-671.473) (-671.748) * (-672.502) (-672.641) [-671.141] (-673.547) -- 0:01:04
247000 -- [-673.481] (-674.130) (-675.077) (-675.036) * (-672.877) (-672.786) (-676.965) [-673.662] -- 0:01:04
247500 -- [-673.219] (-676.808) (-672.634) (-677.320) * [-671.007] (-671.896) (-672.358) (-678.581) -- 0:01:03
248000 -- (-674.395) (-674.300) (-673.587) [-677.074] * (-671.576) (-671.784) (-677.750) [-673.250] -- 0:01:03
248500 -- (-673.436) [-676.398] (-671.584) (-676.093) * (-673.164) (-674.235) [-674.758] (-677.220) -- 0:01:03
249000 -- [-672.559] (-670.933) (-672.857) (-675.246) * (-671.802) (-675.770) [-671.685] (-672.083) -- 0:01:03
249500 -- (-672.242) (-673.401) (-671.161) [-673.372] * (-671.469) (-673.109) (-670.682) [-671.380] -- 0:01:03
250000 -- (-671.693) (-672.490) [-674.402] (-672.469) * (-672.318) (-675.465) [-672.846] (-672.698) -- 0:01:03
Average standard deviation of split frequencies: 0.014934
250500 -- (-673.286) [-671.333] (-672.136) (-673.195) * (-671.673) (-675.043) [-673.200] (-671.460) -- 0:01:02
251000 -- (-672.604) (-676.652) [-674.523] (-671.935) * (-674.525) [-675.981] (-672.238) (-673.273) -- 0:01:02
251500 -- [-671.118] (-674.442) (-677.650) (-673.013) * (-672.778) (-672.803) [-674.726] (-671.006) -- 0:01:02
252000 -- [-672.172] (-672.401) (-672.327) (-671.337) * (-673.580) (-674.160) [-671.298] (-674.353) -- 0:01:02
252500 -- [-674.196] (-673.955) (-673.466) (-675.590) * (-672.256) [-671.931] (-671.347) (-674.876) -- 0:01:02
253000 -- (-671.732) [-672.607] (-673.432) (-673.883) * (-672.462) [-670.666] (-676.775) (-673.655) -- 0:01:02
253500 -- (-673.339) [-673.109] (-673.735) (-674.209) * (-670.894) (-672.661) (-672.751) [-671.845] -- 0:01:01
254000 -- [-671.505] (-674.176) (-675.560) (-673.711) * [-673.995] (-673.532) (-675.781) (-674.610) -- 0:01:01
254500 -- [-671.808] (-674.780) (-672.677) (-673.139) * (-678.244) [-671.853] (-679.957) (-673.271) -- 0:01:01
255000 -- (-671.514) [-671.807] (-673.068) (-673.242) * (-676.940) (-671.835) (-679.613) [-672.053] -- 0:01:01
Average standard deviation of split frequencies: 0.014081
255500 -- (-672.062) (-672.926) (-671.617) [-673.406] * (-672.635) (-670.812) (-671.901) [-671.728] -- 0:01:01
256000 -- (-672.708) (-670.898) (-676.887) [-672.443] * (-672.399) (-671.076) [-670.617] (-671.936) -- 0:01:03
256500 -- [-671.762] (-671.502) (-678.335) (-672.657) * (-672.516) (-671.739) [-671.759] (-672.904) -- 0:01:03
257000 -- (-670.537) [-671.241] (-675.748) (-671.242) * [-675.598] (-673.444) (-673.588) (-673.115) -- 0:01:03
257500 -- (-671.387) [-672.897] (-674.089) (-673.437) * (-673.689) [-674.755] (-674.111) (-671.554) -- 0:01:03
258000 -- [-671.418] (-671.172) (-674.124) (-678.491) * (-673.796) (-671.015) (-674.301) [-672.659] -- 0:01:03
258500 -- [-670.645] (-675.548) (-672.276) (-677.342) * (-673.026) (-673.989) [-672.311] (-672.664) -- 0:01:03
259000 -- (-671.406) (-671.470) [-674.610] (-675.309) * (-673.119) (-675.335) (-672.876) [-673.901] -- 0:01:02
259500 -- (-675.797) [-673.237] (-673.875) (-673.186) * (-675.562) [-673.744] (-672.805) (-673.158) -- 0:01:02
260000 -- (-670.660) [-672.145] (-670.955) (-674.364) * [-673.998] (-674.208) (-673.754) (-671.949) -- 0:01:02
Average standard deviation of split frequencies: 0.013829
260500 -- (-673.050) (-674.012) [-672.050] (-674.547) * (-671.466) [-671.469] (-673.740) (-676.355) -- 0:01:02
261000 -- [-671.073] (-673.296) (-672.435) (-672.742) * (-672.050) (-671.628) [-672.611] (-673.134) -- 0:01:02
261500 -- [-670.782] (-672.651) (-676.304) (-672.565) * [-673.680] (-677.365) (-671.891) (-675.730) -- 0:01:02
262000 -- (-670.990) [-674.601] (-678.422) (-673.468) * [-671.643] (-679.671) (-671.760) (-672.799) -- 0:01:01
262500 -- [-673.294] (-674.731) (-671.814) (-672.131) * [-671.794] (-671.485) (-672.838) (-672.392) -- 0:01:01
263000 -- (-673.159) (-674.942) [-670.976] (-671.824) * (-677.229) (-671.389) [-677.345] (-677.055) -- 0:01:01
263500 -- [-673.118] (-671.568) (-672.564) (-675.208) * (-675.337) (-673.115) (-675.541) [-673.570] -- 0:01:01
264000 -- [-673.237] (-672.104) (-674.752) (-673.628) * (-674.291) (-673.311) (-673.273) [-674.622] -- 0:01:01
264500 -- [-672.698] (-672.143) (-673.796) (-673.541) * [-672.174] (-673.972) (-675.983) (-676.352) -- 0:01:01
265000 -- [-671.334] (-672.255) (-674.991) (-674.118) * [-673.208] (-671.964) (-674.694) (-677.042) -- 0:01:01
Average standard deviation of split frequencies: 0.014276
265500 -- (-674.489) (-672.515) (-674.720) [-678.158] * (-674.738) (-671.135) (-674.896) [-671.598] -- 0:01:00
266000 -- (-672.302) (-670.991) (-674.571) [-674.731] * [-672.128] (-675.142) (-673.928) (-672.869) -- 0:01:00
266500 -- (-672.461) (-670.837) [-672.371] (-671.255) * (-677.322) (-672.916) (-673.657) [-671.917] -- 0:01:00
267000 -- (-673.140) (-670.708) [-675.145] (-670.762) * (-673.613) [-676.875] (-675.179) (-671.732) -- 0:01:00
267500 -- (-671.809) (-672.579) [-674.670] (-676.212) * (-674.210) (-672.334) [-672.011] (-670.779) -- 0:01:00
268000 -- (-671.788) (-673.729) (-672.549) [-675.699] * (-675.087) (-674.137) [-673.179] (-673.099) -- 0:01:00
268500 -- (-673.870) (-674.049) (-672.396) [-672.020] * (-680.634) (-678.321) [-672.759] (-673.588) -- 0:01:02
269000 -- [-672.539] (-672.182) (-672.339) (-672.326) * (-673.724) [-671.943] (-671.407) (-671.956) -- 0:01:02
269500 -- (-672.412) [-671.379] (-675.739) (-671.230) * (-673.716) (-673.464) (-674.237) [-675.655] -- 0:01:02
270000 -- (-671.598) (-672.742) (-673.527) [-671.545] * (-674.468) (-674.100) [-670.895] (-675.322) -- 0:01:02
Average standard deviation of split frequencies: 0.013011
270500 -- (-671.429) (-673.569) (-671.592) [-671.123] * (-674.290) (-673.751) (-672.069) [-672.896] -- 0:01:02
271000 -- [-671.697] (-671.536) (-674.771) (-673.394) * [-674.355] (-673.552) (-672.668) (-676.880) -- 0:01:01
271500 -- [-671.556] (-674.112) (-674.013) (-673.321) * (-671.481) [-671.935] (-675.467) (-676.884) -- 0:01:01
272000 -- (-671.006) (-673.687) [-671.425] (-674.133) * (-673.259) [-673.123] (-673.098) (-671.985) -- 0:01:01
272500 -- [-672.760] (-675.030) (-674.003) (-679.873) * (-675.713) [-672.406] (-671.805) (-673.164) -- 0:01:01
273000 -- [-673.509] (-674.425) (-673.163) (-674.626) * (-672.454) (-670.726) [-675.394] (-675.733) -- 0:01:01
273500 -- (-677.707) (-679.801) [-678.957] (-674.388) * (-672.985) (-672.701) (-672.987) [-671.959] -- 0:01:01
274000 -- (-672.514) (-673.682) (-676.540) [-673.989] * (-672.867) (-674.744) [-672.702] (-674.975) -- 0:01:00
274500 -- (-674.888) (-674.087) [-677.833] (-674.169) * (-674.392) (-672.987) [-670.806] (-672.729) -- 0:01:00
275000 -- (-673.911) [-672.995] (-675.794) (-672.139) * (-671.005) (-673.059) [-670.554] (-675.050) -- 0:01:00
Average standard deviation of split frequencies: 0.013759
275500 -- (-671.273) [-673.300] (-674.680) (-671.317) * (-674.954) (-673.415) [-673.142] (-673.865) -- 0:01:00
276000 -- (-674.049) (-674.242) (-675.086) [-674.792] * (-671.856) (-671.945) (-672.063) [-672.297] -- 0:01:00
276500 -- (-674.317) (-671.235) (-672.639) [-672.194] * (-672.737) (-672.114) [-675.844] (-672.819) -- 0:01:00
277000 -- (-671.452) (-673.205) [-671.237] (-670.475) * [-675.200] (-671.897) (-676.223) (-674.634) -- 0:01:00
277500 -- (-671.562) (-671.823) [-675.512] (-670.448) * [-671.952] (-673.705) (-671.471) (-673.930) -- 0:00:59
278000 -- (-671.518) (-672.355) (-675.659) [-670.635] * (-672.429) (-675.133) (-670.907) [-671.487] -- 0:00:59
278500 -- (-671.298) (-671.590) [-672.082] (-671.863) * [-672.465] (-676.800) (-670.927) (-672.359) -- 0:00:59
279000 -- (-673.744) (-673.652) (-671.836) [-671.888] * (-673.662) (-672.891) (-671.013) [-673.437] -- 0:00:59
279500 -- (-674.903) [-674.030] (-673.601) (-672.091) * (-673.684) (-671.168) (-672.865) [-671.015] -- 0:00:59
280000 -- (-673.448) (-674.207) [-671.886] (-672.779) * (-672.849) (-671.629) [-671.370] (-674.350) -- 0:00:59
Average standard deviation of split frequencies: 0.013437
280500 -- [-674.109] (-678.047) (-673.078) (-672.709) * [-673.079] (-672.887) (-676.861) (-672.941) -- 0:01:01
281000 -- (-672.350) (-672.246) (-671.571) [-672.398] * (-673.698) (-672.091) [-672.906] (-672.265) -- 0:01:01
281500 -- (-674.820) (-675.990) [-671.606] (-674.134) * [-670.678] (-670.899) (-673.164) (-671.364) -- 0:01:01
282000 -- (-674.863) (-677.545) [-672.447] (-674.900) * (-671.282) (-672.180) [-670.699] (-671.425) -- 0:01:01
282500 -- (-673.472) (-671.818) [-672.168] (-677.018) * (-674.241) (-671.968) (-673.749) [-670.940] -- 0:01:00
283000 -- (-672.821) [-674.014] (-672.842) (-673.855) * (-676.314) (-671.326) (-673.551) [-673.145] -- 0:01:00
283500 -- (-673.803) [-674.180] (-675.374) (-673.725) * (-672.444) [-672.222] (-675.902) (-671.791) -- 0:01:00
284000 -- (-673.749) (-671.832) (-670.643) [-675.259] * (-672.459) (-673.128) [-672.434] (-671.792) -- 0:01:00
284500 -- (-674.055) (-672.571) [-671.145] (-673.673) * [-674.838] (-672.080) (-671.995) (-671.724) -- 0:01:00
285000 -- (-673.345) (-671.932) (-671.100) [-673.177] * [-671.436] (-672.426) (-672.041) (-673.294) -- 0:01:00
Average standard deviation of split frequencies: 0.013369
285500 -- (-672.455) [-672.610] (-673.701) (-674.479) * [-673.379] (-671.161) (-672.997) (-676.320) -- 0:01:00
286000 -- (-671.256) (-672.995) [-672.605] (-671.261) * (-672.639) (-672.157) [-672.594] (-675.858) -- 0:00:59
286500 -- [-672.897] (-673.687) (-672.544) (-672.816) * (-674.652) (-672.817) [-672.043] (-672.251) -- 0:00:59
287000 -- (-671.840) (-671.154) [-672.232] (-677.880) * [-670.466] (-673.469) (-671.296) (-671.768) -- 0:00:59
287500 -- (-670.892) (-671.069) (-674.547) [-673.423] * (-673.524) (-671.988) (-673.428) [-672.846] -- 0:00:59
288000 -- (-674.863) (-672.158) (-674.105) [-671.043] * (-676.986) (-672.433) (-677.834) [-673.665] -- 0:00:59
288500 -- (-679.165) [-670.579] (-673.248) (-671.805) * (-676.851) [-674.435] (-671.241) (-673.660) -- 0:00:59
289000 -- [-672.174] (-673.773) (-672.469) (-674.604) * (-675.789) (-678.858) (-673.510) [-674.546] -- 0:00:59
289500 -- [-674.365] (-671.256) (-674.570) (-672.994) * (-675.004) (-677.528) (-671.074) [-671.276] -- 0:00:58
290000 -- (-671.518) [-670.642] (-675.335) (-675.003) * (-672.763) (-675.800) (-672.723) [-671.773] -- 0:00:58
Average standard deviation of split frequencies: 0.013731
290500 -- (-672.099) [-670.935] (-673.422) (-675.186) * [-673.055] (-672.221) (-675.540) (-675.818) -- 0:00:58
291000 -- (-672.180) (-671.499) [-672.488] (-673.296) * [-672.534] (-672.149) (-673.700) (-675.167) -- 0:00:58
291500 -- (-673.540) [-671.610] (-672.551) (-671.095) * [-671.466] (-675.748) (-674.028) (-674.433) -- 0:01:00
292000 -- (-678.598) [-672.631] (-673.862) (-674.769) * (-676.345) [-675.694] (-673.006) (-671.400) -- 0:01:00
292500 -- (-673.310) (-671.265) (-673.904) [-674.146] * (-673.173) (-672.620) (-674.732) [-676.067] -- 0:01:00
293000 -- (-673.933) (-672.852) (-671.732) [-675.428] * [-675.363] (-674.939) (-675.557) (-671.377) -- 0:01:00
293500 -- [-675.334] (-671.745) (-673.076) (-672.047) * [-674.246] (-672.324) (-671.884) (-674.480) -- 0:01:00
294000 -- [-672.643] (-670.774) (-671.668) (-671.773) * (-673.972) [-671.630] (-672.467) (-672.194) -- 0:01:00
294500 -- [-672.517] (-674.751) (-671.960) (-672.148) * (-672.818) (-672.588) (-671.723) [-672.390] -- 0:00:59
295000 -- [-673.051] (-674.784) (-672.191) (-670.931) * [-672.468] (-672.268) (-673.282) (-675.540) -- 0:00:59
Average standard deviation of split frequencies: 0.014546
295500 -- (-673.122) [-670.660] (-672.388) (-674.449) * (-673.101) (-672.807) (-676.216) [-675.900] -- 0:00:59
296000 -- (-674.233) (-672.588) (-672.564) [-678.143] * (-671.827) (-673.553) [-673.397] (-674.592) -- 0:00:59
296500 -- (-675.939) (-674.755) [-673.404] (-674.590) * [-671.620] (-670.856) (-674.537) (-671.235) -- 0:00:59
297000 -- (-673.280) (-672.690) [-672.357] (-674.382) * (-671.704) (-671.727) [-673.452] (-672.940) -- 0:00:59
297500 -- (-672.780) [-672.097] (-672.246) (-672.988) * (-671.659) (-676.204) (-672.633) [-673.751] -- 0:00:59
298000 -- (-672.208) (-671.511) (-672.575) [-670.679] * (-671.888) (-673.776) [-675.992] (-675.042) -- 0:00:58
298500 -- (-674.661) [-671.659] (-672.646) (-670.725) * [-673.951] (-672.821) (-674.604) (-671.302) -- 0:00:58
299000 -- (-671.796) (-671.356) (-672.258) [-677.408] * (-672.236) [-672.950] (-674.236) (-673.397) -- 0:00:58
299500 -- (-673.759) [-673.246] (-671.955) (-672.708) * (-672.790) (-672.873) (-672.547) [-671.250] -- 0:00:58
300000 -- (-673.902) [-674.173] (-671.274) (-674.593) * (-671.477) (-674.136) (-672.896) [-673.678] -- 0:00:58
Average standard deviation of split frequencies: 0.014738
300500 -- (-672.323) (-672.149) (-676.276) [-671.371] * [-671.292] (-672.341) (-671.753) (-671.638) -- 0:00:58
301000 -- (-674.052) [-672.623] (-673.824) (-672.949) * (-673.829) [-670.954] (-672.431) (-671.069) -- 0:00:58
301500 -- (-673.291) (-674.677) (-672.510) [-671.431] * [-672.141] (-671.067) (-671.596) (-670.815) -- 0:00:57
302000 -- [-674.213] (-674.104) (-674.576) (-673.265) * (-674.328) (-672.304) [-674.234] (-674.345) -- 0:00:57
302500 -- (-672.728) (-672.666) (-673.573) [-672.899] * [-672.358] (-672.850) (-675.384) (-674.841) -- 0:00:57
303000 -- (-672.591) [-672.730] (-674.162) (-672.821) * [-673.152] (-676.446) (-672.574) (-673.695) -- 0:00:57
303500 -- (-674.470) (-672.761) [-673.469] (-673.749) * (-674.613) (-673.725) (-673.217) [-671.377] -- 0:00:57
304000 -- (-674.110) [-673.846] (-672.456) (-672.104) * (-672.773) (-671.659) (-670.607) [-671.474] -- 0:00:59
304500 -- (-677.021) (-673.982) (-671.659) [-672.245] * (-671.276) [-673.271] (-671.018) (-671.498) -- 0:00:59
305000 -- (-676.364) [-672.986] (-672.116) (-671.500) * (-672.272) (-673.030) [-672.269] (-677.128) -- 0:00:59
Average standard deviation of split frequencies: 0.014995
305500 -- (-674.873) [-672.303] (-675.292) (-673.615) * [-675.043] (-680.778) (-674.703) (-675.290) -- 0:00:59
306000 -- (-675.281) (-674.464) (-671.817) [-671.985] * (-674.516) (-672.076) (-673.333) [-672.573] -- 0:00:58
306500 -- [-672.316] (-670.875) (-671.305) (-671.704) * (-670.655) (-674.654) (-672.405) [-673.023] -- 0:00:58
307000 -- (-671.818) (-672.662) [-670.913] (-670.888) * (-671.811) (-674.388) [-671.016] (-673.581) -- 0:00:58
307500 -- (-673.326) (-672.269) [-673.260] (-673.609) * (-673.577) (-672.136) [-673.680] (-671.963) -- 0:00:58
308000 -- (-676.468) (-671.723) [-671.187] (-675.377) * (-671.462) (-675.252) [-671.776] (-673.548) -- 0:00:58
308500 -- (-673.673) (-670.896) [-672.969] (-672.535) * (-676.440) [-671.779] (-671.961) (-672.153) -- 0:00:58
309000 -- [-672.539] (-672.933) (-670.986) (-673.511) * (-674.292) (-670.945) (-675.158) [-672.825] -- 0:00:58
309500 -- [-671.508] (-673.734) (-671.817) (-672.240) * (-674.600) (-671.745) [-670.574] (-673.039) -- 0:00:58
310000 -- [-672.923] (-672.252) (-673.229) (-673.683) * (-672.273) [-673.404] (-670.833) (-675.416) -- 0:00:57
Average standard deviation of split frequencies: 0.015073
310500 -- (-673.811) (-674.070) [-673.087] (-673.007) * (-680.543) [-671.561] (-671.948) (-682.231) -- 0:00:57
311000 -- (-673.499) [-673.972] (-671.413) (-675.090) * (-673.797) (-671.778) [-674.282] (-677.645) -- 0:00:57
311500 -- (-672.070) (-671.779) (-672.459) [-672.521] * (-673.035) (-672.158) (-671.835) [-677.451] -- 0:00:57
312000 -- (-671.962) (-674.223) [-671.761] (-671.510) * (-673.800) [-672.133] (-671.778) (-673.137) -- 0:00:57
312500 -- (-672.731) (-673.909) (-671.174) [-670.798] * (-671.558) (-674.675) (-671.707) [-673.014] -- 0:00:57
313000 -- (-670.911) (-672.851) [-673.890] (-673.319) * (-673.836) [-674.250] (-672.624) (-675.524) -- 0:00:57
313500 -- (-675.163) (-672.889) [-672.503] (-671.421) * (-673.758) (-671.841) (-672.314) [-672.145] -- 0:00:56
314000 -- (-672.160) (-673.660) (-672.574) [-674.848] * (-675.163) (-671.916) [-672.492] (-672.549) -- 0:00:56
314500 -- (-672.084) (-674.578) [-672.935] (-673.775) * [-671.882] (-674.618) (-672.777) (-674.551) -- 0:00:56
315000 -- (-672.658) (-674.172) (-674.109) [-672.567] * (-671.341) [-673.546] (-674.007) (-675.373) -- 0:00:56
Average standard deviation of split frequencies: 0.014918
315500 -- [-672.522] (-673.871) (-672.808) (-672.448) * (-673.737) (-672.080) [-671.539] (-671.865) -- 0:00:56
316000 -- (-671.561) [-674.086] (-674.645) (-671.605) * (-673.039) [-672.954] (-670.948) (-670.917) -- 0:00:58
316500 -- (-671.221) (-671.890) (-673.597) [-676.879] * (-673.227) (-671.213) (-673.794) [-675.029] -- 0:00:58
317000 -- [-672.384] (-671.941) (-672.327) (-673.912) * (-676.008) (-671.264) [-670.985] (-674.591) -- 0:00:58
317500 -- [-672.150] (-671.418) (-674.931) (-673.287) * (-679.530) [-671.048] (-673.335) (-674.014) -- 0:00:58
318000 -- (-674.362) (-672.625) [-671.839] (-679.429) * (-673.385) [-670.908] (-671.791) (-677.378) -- 0:00:57
318500 -- [-674.601] (-676.349) (-676.239) (-678.170) * [-673.998] (-674.254) (-671.134) (-672.651) -- 0:00:57
319000 -- [-673.416] (-671.791) (-673.883) (-678.629) * [-672.258] (-673.227) (-672.279) (-671.757) -- 0:00:57
319500 -- (-674.188) [-672.426] (-676.115) (-672.185) * [-673.026] (-676.509) (-674.250) (-674.499) -- 0:00:57
320000 -- (-673.374) (-672.609) [-672.159] (-673.589) * [-671.943] (-673.517) (-674.353) (-672.735) -- 0:00:57
Average standard deviation of split frequencies: 0.013917
320500 -- (-671.425) (-673.295) (-674.260) [-672.450] * (-673.681) (-671.291) [-675.165] (-672.838) -- 0:00:57
321000 -- (-673.710) (-672.125) [-673.503] (-673.842) * [-671.085] (-671.815) (-672.135) (-674.766) -- 0:00:57
321500 -- [-673.252] (-670.813) (-671.560) (-673.922) * (-670.984) (-671.348) [-673.782] (-672.334) -- 0:00:56
322000 -- (-673.513) (-672.226) (-670.880) [-670.856] * (-672.538) (-676.529) [-670.739] (-674.773) -- 0:00:56
322500 -- (-673.058) (-670.689) (-670.898) [-675.042] * (-672.947) (-675.441) (-671.219) [-674.192] -- 0:00:56
323000 -- (-674.544) (-671.820) (-676.216) [-672.828] * (-675.897) [-673.526] (-671.712) (-673.440) -- 0:00:56
323500 -- [-674.575] (-673.274) (-678.055) (-673.176) * (-674.570) (-672.657) (-673.985) [-673.111] -- 0:00:56
324000 -- (-674.187) (-671.451) [-673.336] (-674.945) * (-672.106) [-674.210] (-672.454) (-674.097) -- 0:00:56
324500 -- (-674.278) (-673.540) [-674.930] (-674.618) * [-671.789] (-674.233) (-673.840) (-673.569) -- 0:00:56
325000 -- (-671.472) (-675.307) (-672.119) [-675.998] * (-671.461) (-676.527) (-671.909) [-672.125] -- 0:00:56
Average standard deviation of split frequencies: 0.013014
325500 -- (-673.191) (-672.871) (-672.350) [-674.510] * (-673.809) (-672.839) [-671.567] (-672.100) -- 0:00:55
326000 -- (-673.832) [-671.104] (-671.677) (-678.551) * (-671.708) [-673.911] (-671.767) (-671.451) -- 0:00:55
326500 -- [-672.993] (-672.824) (-672.531) (-674.233) * [-672.845] (-672.025) (-671.725) (-675.936) -- 0:00:55
327000 -- [-670.813] (-673.122) (-671.675) (-675.132) * (-677.450) (-672.977) [-671.184] (-678.417) -- 0:00:55
327500 -- [-671.448] (-672.808) (-671.612) (-673.039) * [-670.987] (-672.377) (-671.423) (-671.298) -- 0:00:55
328000 -- (-672.692) (-675.712) (-673.293) [-671.544] * [-671.598] (-672.358) (-673.018) (-673.445) -- 0:00:55
328500 -- (-670.917) (-674.957) [-673.482] (-675.616) * (-671.244) [-672.225] (-674.047) (-678.295) -- 0:00:57
329000 -- [-670.983] (-672.668) (-673.865) (-671.834) * (-672.876) [-675.681] (-673.863) (-671.335) -- 0:00:57
329500 -- (-671.077) (-677.247) (-676.092) [-671.429] * [-673.391] (-674.291) (-671.755) (-672.852) -- 0:00:56
330000 -- (-673.438) (-673.292) (-673.151) [-672.336] * (-675.816) [-675.100] (-672.800) (-676.754) -- 0:00:56
Average standard deviation of split frequencies: 0.013989
330500 -- (-671.842) (-674.119) (-673.554) [-671.687] * [-673.566] (-673.306) (-671.502) (-676.419) -- 0:00:56
331000 -- (-673.974) (-671.988) [-673.584] (-679.979) * (-676.047) (-671.836) (-671.252) [-676.300] -- 0:00:56
331500 -- (-671.110) (-671.262) [-671.541] (-672.100) * (-673.215) (-673.902) (-678.306) [-671.851] -- 0:00:56
332000 -- [-670.886] (-672.553) (-671.447) (-676.243) * (-673.556) [-674.878] (-676.640) (-671.387) -- 0:00:56
332500 -- [-673.556] (-671.212) (-671.357) (-673.659) * (-674.355) [-674.153] (-673.175) (-672.490) -- 0:00:56
333000 -- [-672.142] (-672.693) (-672.728) (-674.731) * (-672.362) (-675.381) [-672.733] (-672.458) -- 0:00:56
333500 -- (-671.475) (-671.943) (-673.395) [-671.393] * (-672.025) [-671.411] (-671.436) (-673.672) -- 0:00:55
334000 -- [-673.072] (-672.264) (-673.146) (-672.584) * [-675.649] (-671.112) (-671.668) (-670.896) -- 0:00:55
334500 -- (-671.943) (-672.569) (-671.879) [-672.902] * [-672.195] (-671.884) (-674.138) (-676.139) -- 0:00:55
335000 -- [-671.659] (-671.084) (-671.924) (-671.971) * (-672.196) (-671.600) (-673.748) [-675.988] -- 0:00:55
Average standard deviation of split frequencies: 0.014404
335500 -- [-672.146] (-674.538) (-671.463) (-675.821) * (-672.029) (-674.441) [-673.235] (-673.306) -- 0:00:55
336000 -- [-671.612] (-674.596) (-672.044) (-672.230) * (-673.382) [-674.137] (-674.726) (-676.205) -- 0:00:55
336500 -- (-671.071) (-671.163) (-672.115) [-671.893] * (-675.405) (-673.793) (-671.287) [-672.876] -- 0:00:55
337000 -- (-671.072) [-673.509] (-672.772) (-672.595) * [-671.977] (-672.225) (-672.406) (-674.008) -- 0:00:55
337500 -- (-672.301) (-672.415) (-671.717) [-676.736] * (-672.790) (-675.005) (-672.595) [-673.896] -- 0:00:54
338000 -- (-672.978) [-673.121] (-671.044) (-673.080) * (-674.555) (-676.737) (-671.329) [-674.989] -- 0:00:54
338500 -- (-673.431) (-671.345) (-674.422) [-671.822] * [-671.482] (-672.008) (-676.056) (-673.229) -- 0:00:54
339000 -- (-673.586) [-673.087] (-672.193) (-673.693) * (-675.463) (-673.384) (-673.485) [-674.402] -- 0:00:54
339500 -- (-672.627) (-672.438) [-672.068] (-670.773) * (-676.883) [-674.053] (-676.602) (-671.978) -- 0:00:54
340000 -- (-672.789) (-675.688) (-671.785) [-671.686] * (-673.302) (-673.668) [-673.974] (-674.215) -- 0:00:54
Average standard deviation of split frequencies: 0.013561
340500 -- [-671.295] (-672.107) (-671.675) (-672.133) * (-671.346) [-674.407] (-671.676) (-672.160) -- 0:00:56
341000 -- (-671.437) [-671.526] (-675.354) (-671.339) * (-671.572) [-672.660] (-672.756) (-674.814) -- 0:00:56
341500 -- (-671.020) (-671.368) [-672.129] (-675.144) * (-671.607) (-670.785) [-674.701] (-672.977) -- 0:00:55
342000 -- (-671.233) (-672.262) [-671.946] (-676.343) * (-673.412) (-672.181) (-672.771) [-677.346] -- 0:00:55
342500 -- [-672.286] (-673.319) (-672.789) (-673.652) * (-672.392) (-674.597) (-673.578) [-673.135] -- 0:00:55
343000 -- (-673.633) (-676.523) (-671.913) [-673.188] * (-671.161) (-672.768) (-671.417) [-674.065] -- 0:00:55
343500 -- (-677.236) [-672.379] (-671.144) (-670.818) * (-671.281) (-672.253) (-672.595) [-671.235] -- 0:00:55
344000 -- (-674.204) (-671.686) [-678.335] (-675.562) * (-671.981) (-675.467) (-676.687) [-673.240] -- 0:00:55
344500 -- (-673.757) (-671.789) [-672.506] (-672.860) * (-672.801) (-677.227) [-672.644] (-676.084) -- 0:00:55
345000 -- [-675.152] (-673.935) (-674.838) (-673.617) * (-671.581) (-678.537) [-674.812] (-671.894) -- 0:00:55
Average standard deviation of split frequencies: 0.013369
345500 -- [-672.053] (-671.992) (-671.753) (-673.993) * (-672.760) (-673.874) (-676.095) [-674.708] -- 0:00:54
346000 -- (-675.149) [-672.432] (-679.283) (-672.412) * [-672.078] (-670.953) (-678.203) (-672.369) -- 0:00:54
346500 -- (-671.892) [-673.457] (-679.827) (-672.885) * (-673.244) [-670.659] (-671.472) (-673.907) -- 0:00:54
347000 -- [-671.314] (-671.276) (-672.649) (-675.091) * (-672.327) (-671.440) [-672.722] (-675.574) -- 0:00:54
347500 -- [-673.755] (-673.014) (-672.805) (-674.990) * (-673.533) [-671.648] (-671.865) (-674.249) -- 0:00:54
348000 -- (-674.306) [-671.475] (-672.983) (-675.260) * (-672.260) [-672.372] (-672.359) (-677.461) -- 0:00:54
348500 -- [-673.372] (-673.569) (-673.934) (-673.347) * [-676.139] (-671.721) (-672.359) (-673.247) -- 0:00:54
349000 -- (-674.360) [-675.136] (-673.699) (-676.066) * (-675.119) (-672.345) [-671.610] (-674.901) -- 0:00:54
349500 -- [-672.567] (-675.000) (-675.613) (-673.489) * (-674.094) [-672.563] (-677.451) (-673.235) -- 0:00:53
350000 -- [-673.466] (-672.545) (-673.675) (-674.510) * (-673.393) (-672.903) [-677.797] (-673.938) -- 0:00:53
Average standard deviation of split frequencies: 0.012969
350500 -- (-674.258) [-671.152] (-672.180) (-672.762) * (-672.032) [-671.312] (-684.898) (-674.467) -- 0:00:53
351000 -- (-673.299) [-672.672] (-674.101) (-674.068) * (-671.357) (-674.744) (-673.346) [-672.909] -- 0:00:53
351500 -- (-673.869) (-674.116) (-671.722) [-671.346] * (-674.682) (-674.563) [-675.839] (-674.959) -- 0:00:53
352000 -- (-671.494) (-673.267) [-676.976] (-672.399) * (-671.214) (-676.492) [-671.414] (-673.229) -- 0:00:53
352500 -- (-675.790) (-671.272) [-673.939] (-673.800) * [-672.593] (-671.628) (-672.083) (-675.619) -- 0:00:53
353000 -- [-672.277] (-672.557) (-673.853) (-681.384) * (-673.493) [-673.820] (-672.906) (-672.268) -- 0:00:54
353500 -- [-671.520] (-673.469) (-674.857) (-673.610) * (-672.813) (-672.452) [-671.826] (-671.729) -- 0:00:54
354000 -- (-672.407) (-672.562) [-671.716] (-672.027) * [-672.310] (-672.887) (-671.545) (-672.366) -- 0:00:54
354500 -- (-673.832) [-671.718] (-671.112) (-671.159) * (-675.593) (-671.050) (-671.427) [-673.334] -- 0:00:54
355000 -- (-672.322) (-673.242) [-675.720] (-672.865) * (-672.760) [-670.844] (-671.464) (-674.753) -- 0:00:54
Average standard deviation of split frequencies: 0.013242
355500 -- (-672.236) [-671.018] (-674.529) (-675.823) * (-672.099) [-671.698] (-670.754) (-674.897) -- 0:00:54
356000 -- [-673.013] (-674.085) (-671.893) (-672.183) * (-672.368) [-671.058] (-671.534) (-674.545) -- 0:00:54
356500 -- [-672.285] (-675.812) (-670.961) (-672.005) * (-672.511) (-671.183) (-672.456) [-670.785] -- 0:00:54
357000 -- (-677.201) (-676.594) (-671.484) [-672.997] * [-673.677] (-676.320) (-676.416) (-672.089) -- 0:00:54
357500 -- (-676.455) [-672.871] (-676.307) (-674.204) * (-677.988) (-672.562) (-671.361) [-674.395] -- 0:00:53
358000 -- (-673.526) [-674.080] (-672.515) (-671.322) * (-677.496) (-675.393) [-673.966] (-675.193) -- 0:00:53
358500 -- (-677.582) (-677.496) [-672.634] (-673.479) * (-675.107) (-670.924) (-674.392) [-672.335] -- 0:00:53
359000 -- [-673.965] (-671.630) (-671.928) (-672.639) * (-674.258) [-670.767] (-671.251) (-670.939) -- 0:00:53
359500 -- (-673.001) (-672.986) (-671.662) [-671.934] * (-677.257) [-672.713] (-681.554) (-673.029) -- 0:00:53
360000 -- (-671.158) [-670.795] (-671.224) (-671.886) * (-677.300) (-673.321) (-674.623) [-671.091] -- 0:00:53
Average standard deviation of split frequencies: 0.012809
360500 -- [-672.637] (-674.076) (-673.322) (-671.169) * (-672.377) [-673.561] (-672.586) (-673.354) -- 0:00:53
361000 -- [-673.037] (-671.638) (-672.143) (-676.118) * (-670.993) (-672.126) [-673.582] (-672.970) -- 0:00:53
361500 -- (-672.475) [-673.021] (-671.116) (-671.620) * (-671.107) [-673.927] (-673.331) (-671.774) -- 0:00:52
362000 -- [-673.710] (-672.584) (-672.438) (-673.795) * (-672.348) (-672.268) [-677.047] (-671.374) -- 0:00:52
362500 -- (-672.616) (-671.637) (-674.560) [-673.295] * (-673.332) (-672.221) (-672.670) [-672.876] -- 0:00:52
363000 -- [-671.862] (-674.845) (-675.171) (-673.048) * (-673.343) [-672.224] (-672.329) (-674.500) -- 0:00:52
363500 -- (-671.997) (-671.536) [-673.952] (-673.514) * (-672.940) [-674.614] (-673.346) (-674.997) -- 0:00:52
364000 -- [-670.883] (-671.998) (-671.038) (-674.509) * (-673.629) (-673.484) [-672.985] (-672.292) -- 0:00:52
364500 -- (-673.859) (-674.539) (-671.503) [-673.106] * [-672.921] (-671.304) (-671.511) (-673.065) -- 0:00:52
365000 -- (-671.488) (-670.999) [-672.133] (-677.997) * (-672.065) [-670.476] (-672.134) (-673.344) -- 0:00:52
Average standard deviation of split frequencies: 0.011592
365500 -- (-673.768) (-671.561) (-676.971) [-672.597] * [-673.006] (-670.401) (-674.773) (-671.752) -- 0:00:53
366000 -- [-672.128] (-671.983) (-672.100) (-675.600) * (-670.443) (-670.964) (-674.638) [-670.889] -- 0:00:53
366500 -- (-675.903) [-670.846] (-671.665) (-673.771) * (-670.639) (-671.090) (-677.064) [-671.733] -- 0:00:53
367000 -- [-671.894] (-672.412) (-672.257) (-672.683) * (-671.386) [-673.364] (-676.629) (-674.884) -- 0:00:53
367500 -- (-676.586) (-672.460) (-674.995) [-671.494] * [-673.525] (-672.483) (-680.261) (-672.622) -- 0:00:53
368000 -- (-672.160) (-672.121) (-672.849) [-672.393] * (-675.584) [-671.694] (-673.390) (-674.954) -- 0:00:53
368500 -- (-673.581) (-674.583) (-675.188) [-672.453] * (-671.444) (-678.739) [-670.844] (-677.471) -- 0:00:53
369000 -- (-673.720) (-674.125) [-676.022] (-673.447) * (-675.179) (-673.939) [-674.954] (-677.666) -- 0:00:53
369500 -- (-675.084) (-674.096) [-676.349] (-674.236) * (-676.060) (-671.125) (-674.639) [-671.060] -- 0:00:52
370000 -- (-674.446) (-674.648) (-672.728) [-672.415] * (-676.503) (-673.185) [-673.749] (-673.122) -- 0:00:52
Average standard deviation of split frequencies: 0.012643
370500 -- [-676.206] (-675.525) (-672.207) (-676.697) * (-671.185) (-671.214) (-675.067) [-671.246] -- 0:00:52
371000 -- (-676.770) (-674.438) [-672.283] (-671.366) * (-672.991) (-674.486) [-673.041] (-671.584) -- 0:00:52
371500 -- [-671.677] (-675.039) (-671.279) (-671.869) * (-673.365) (-670.699) (-674.580) [-672.953] -- 0:00:52
372000 -- [-671.654] (-674.444) (-674.326) (-674.190) * (-671.420) (-673.552) (-672.393) [-673.381] -- 0:00:52
372500 -- (-671.537) (-676.342) [-674.898] (-671.134) * (-671.841) [-673.168] (-677.818) (-674.003) -- 0:00:52
373000 -- (-674.305) [-671.580] (-673.769) (-674.128) * [-674.935] (-673.979) (-674.573) (-673.992) -- 0:00:52
373500 -- (-671.710) (-672.158) (-674.330) [-671.835] * (-672.874) (-671.985) [-676.926] (-670.745) -- 0:00:51
374000 -- (-671.608) (-675.598) (-672.801) [-673.970] * [-671.206] (-674.633) (-671.879) (-671.969) -- 0:00:51
374500 -- (-672.147) (-677.550) (-678.076) [-674.721] * (-670.912) (-673.820) (-672.327) [-671.869] -- 0:00:51
375000 -- (-673.740) (-677.696) (-676.824) [-671.827] * (-671.539) (-671.744) (-673.103) [-673.222] -- 0:00:51
Average standard deviation of split frequencies: 0.012169
375500 -- (-676.740) [-675.562] (-673.102) (-677.717) * (-671.339) (-673.803) (-672.659) [-671.694] -- 0:00:51
376000 -- (-673.100) (-676.072) (-672.933) [-674.890] * (-673.457) (-670.873) [-676.485] (-671.562) -- 0:00:51
376500 -- [-671.955] (-675.527) (-680.051) (-675.260) * (-672.049) [-672.571] (-673.593) (-671.871) -- 0:00:51
377000 -- (-676.507) (-675.772) [-675.500] (-672.749) * (-673.317) [-671.024] (-672.213) (-676.180) -- 0:00:51
377500 -- (-679.727) (-672.391) (-672.746) [-672.357] * (-673.292) [-672.052] (-671.888) (-673.911) -- 0:00:52
378000 -- (-673.014) (-672.887) [-672.774] (-678.056) * [-674.092] (-675.627) (-673.309) (-672.578) -- 0:00:52
378500 -- (-672.416) [-671.217] (-675.472) (-671.996) * (-671.939) (-678.905) [-671.928] (-670.806) -- 0:00:52
379000 -- [-671.223] (-672.463) (-671.392) (-674.419) * [-671.566] (-677.914) (-671.226) (-672.216) -- 0:00:52
379500 -- [-671.711] (-671.597) (-672.220) (-674.946) * (-674.071) [-674.080] (-674.839) (-674.412) -- 0:00:52
380000 -- [-672.886] (-673.177) (-672.162) (-673.429) * [-671.360] (-679.613) (-673.670) (-671.402) -- 0:00:52
Average standard deviation of split frequencies: 0.011582
380500 -- [-672.934] (-673.540) (-673.600) (-674.350) * [-671.990] (-671.218) (-673.672) (-674.069) -- 0:00:52
381000 -- (-672.131) (-670.786) [-672.835] (-671.518) * (-677.164) [-674.459] (-674.296) (-671.003) -- 0:00:51
381500 -- (-672.342) [-671.943] (-677.133) (-670.571) * (-673.386) (-674.611) [-672.292] (-671.173) -- 0:00:51
382000 -- (-672.034) [-671.853] (-671.689) (-674.424) * [-675.210] (-674.397) (-680.597) (-671.527) -- 0:00:51
382500 -- (-670.958) [-672.141] (-673.797) (-671.486) * [-673.365] (-676.121) (-675.006) (-672.897) -- 0:00:51
383000 -- (-673.961) (-671.831) (-672.323) [-672.105] * (-671.318) (-672.734) (-674.022) [-672.290] -- 0:00:51
383500 -- (-671.433) [-671.788] (-674.290) (-672.363) * (-672.811) (-675.381) (-671.272) [-671.323] -- 0:00:51
384000 -- [-671.923] (-671.582) (-679.825) (-671.444) * (-678.743) [-671.379] (-673.426) (-672.841) -- 0:00:51
384500 -- (-675.971) [-673.605] (-676.600) (-673.149) * [-678.810] (-671.216) (-671.985) (-672.320) -- 0:00:51
385000 -- (-678.461) (-675.079) [-671.289] (-673.431) * (-677.941) (-671.419) [-672.475] (-671.970) -- 0:00:51
Average standard deviation of split frequencies: 0.011710
385500 -- [-672.641] (-671.599) (-673.740) (-672.588) * (-674.484) (-675.018) [-675.326] (-671.250) -- 0:00:51
386000 -- (-674.923) [-672.243] (-679.023) (-673.289) * (-672.985) (-675.337) [-671.632] (-675.073) -- 0:00:50
386500 -- (-670.813) (-672.871) (-673.456) [-676.096] * [-673.120] (-675.713) (-671.600) (-670.964) -- 0:00:50
387000 -- (-672.533) (-675.210) (-673.205) [-672.383] * (-673.958) [-674.808] (-671.124) (-676.123) -- 0:00:50
387500 -- (-671.837) [-672.138] (-674.316) (-675.149) * (-672.442) [-672.162] (-672.388) (-676.266) -- 0:00:50
388000 -- [-671.769] (-674.600) (-674.177) (-675.410) * [-671.879] (-679.456) (-675.091) (-671.997) -- 0:00:50
388500 -- [-673.149] (-677.935) (-673.589) (-676.268) * (-674.113) (-672.470) (-670.789) [-672.928] -- 0:00:50
389000 -- (-671.329) (-673.056) (-675.964) [-673.864] * (-674.536) [-672.235] (-672.017) (-673.349) -- 0:00:50
389500 -- [-672.808] (-672.210) (-673.687) (-673.261) * (-674.379) [-671.480] (-672.202) (-675.160) -- 0:00:51
390000 -- [-671.922] (-673.356) (-673.216) (-673.863) * (-670.994) (-672.182) (-672.423) [-671.994] -- 0:00:51
Average standard deviation of split frequencies: 0.011783
390500 -- (-671.330) [-672.711] (-675.890) (-675.076) * (-672.444) (-674.888) (-672.125) [-672.385] -- 0:00:51
391000 -- (-673.283) (-679.244) [-673.417] (-674.399) * (-674.352) (-672.505) (-671.995) [-671.259] -- 0:00:51
391500 -- (-671.517) (-673.761) [-672.367] (-676.844) * (-671.042) (-671.315) [-671.464] (-671.788) -- 0:00:51
392000 -- (-672.651) (-672.241) [-672.740] (-674.602) * [-670.969] (-672.255) (-675.784) (-671.999) -- 0:00:51
392500 -- (-673.425) (-672.714) (-673.445) [-672.911] * (-671.288) [-670.899] (-673.360) (-672.362) -- 0:00:51
393000 -- (-671.600) (-672.577) [-672.402] (-674.369) * (-671.432) [-675.283] (-671.130) (-671.086) -- 0:00:50
393500 -- (-671.148) (-671.511) (-671.219) [-671.074] * (-673.933) (-677.444) [-672.765] (-673.438) -- 0:00:50
394000 -- (-674.858) (-675.154) (-673.634) [-673.208] * (-673.018) (-674.840) [-672.223] (-671.296) -- 0:00:50
394500 -- [-672.964] (-676.921) (-671.295) (-675.086) * (-672.226) (-673.082) [-670.956] (-671.221) -- 0:00:50
395000 -- (-673.876) (-674.296) [-670.517] (-673.452) * (-672.074) [-672.723] (-674.571) (-672.890) -- 0:00:50
Average standard deviation of split frequencies: 0.011694
395500 -- (-672.903) (-676.172) (-672.908) [-672.533] * [-672.989] (-671.191) (-671.385) (-672.145) -- 0:00:50
396000 -- (-671.365) (-673.318) [-670.964] (-676.235) * (-672.600) (-672.974) [-671.127] (-670.877) -- 0:00:50
396500 -- (-671.364) [-673.458] (-676.165) (-670.941) * (-674.488) (-672.454) (-673.196) [-673.389] -- 0:00:50
397000 -- [-673.036] (-672.498) (-672.404) (-672.171) * [-671.703] (-673.013) (-676.947) (-672.352) -- 0:00:50
397500 -- (-673.331) (-671.356) [-671.934] (-672.729) * (-674.090) [-672.320] (-675.373) (-672.024) -- 0:00:50
398000 -- (-671.637) (-672.929) [-671.891] (-671.628) * (-672.549) (-671.075) (-674.455) [-675.261] -- 0:00:49
398500 -- (-671.313) (-673.689) (-672.840) [-670.846] * (-671.504) (-672.244) [-671.644] (-672.233) -- 0:00:49
399000 -- [-671.264] (-672.652) (-676.174) (-672.849) * (-672.551) (-674.514) [-678.831] (-672.880) -- 0:00:49
399500 -- [-672.959] (-674.745) (-672.870) (-672.060) * (-671.426) [-673.770] (-679.824) (-672.164) -- 0:00:49
400000 -- (-671.191) (-671.274) (-679.127) [-673.229] * (-673.539) [-673.234] (-673.082) (-670.837) -- 0:00:49
Average standard deviation of split frequencies: 0.011489
400500 -- [-671.086] (-670.892) (-673.704) (-672.503) * [-673.691] (-673.742) (-674.008) (-672.887) -- 0:00:49
401000 -- [-672.658] (-676.400) (-674.279) (-671.627) * (-674.740) [-675.434] (-671.291) (-673.056) -- 0:00:49
401500 -- (-671.514) (-675.415) (-673.408) [-671.517] * [-674.527] (-674.671) (-673.718) (-671.283) -- 0:00:50
402000 -- [-671.908] (-674.634) (-674.734) (-671.640) * (-671.434) (-671.726) [-670.775] (-671.691) -- 0:00:50
402500 -- [-673.854] (-677.959) (-673.332) (-671.926) * [-671.943] (-673.412) (-671.954) (-672.668) -- 0:00:50
403000 -- [-671.866] (-673.460) (-674.245) (-672.168) * (-672.859) (-672.731) [-671.592] (-673.626) -- 0:00:50
403500 -- (-672.616) [-671.184] (-674.886) (-671.985) * [-671.499] (-673.790) (-672.244) (-671.502) -- 0:00:50
404000 -- (-671.724) (-675.630) (-674.158) [-673.924] * (-674.098) (-673.585) (-673.749) [-673.187] -- 0:00:50
404500 -- (-675.724) (-671.726) (-675.120) [-672.989] * [-674.719] (-675.689) (-674.389) (-670.691) -- 0:00:50
405000 -- (-673.739) (-677.854) (-672.168) [-671.879] * [-672.875] (-673.633) (-674.004) (-673.654) -- 0:00:49
Average standard deviation of split frequencies: 0.010966
405500 -- (-675.840) (-671.707) [-674.112] (-675.613) * (-674.945) (-671.901) (-673.507) [-672.815] -- 0:00:49
406000 -- (-675.969) (-674.146) [-674.714] (-671.881) * (-671.637) (-671.517) (-673.009) [-675.467] -- 0:00:49
406500 -- [-676.107] (-672.322) (-673.562) (-670.868) * [-673.273] (-674.237) (-675.192) (-672.353) -- 0:00:49
407000 -- (-671.654) [-673.327] (-672.161) (-671.427) * [-672.383] (-670.802) (-674.240) (-672.080) -- 0:00:49
407500 -- [-671.774] (-672.735) (-671.691) (-671.054) * (-673.632) [-671.774] (-673.494) (-672.006) -- 0:00:49
408000 -- (-670.961) (-671.915) [-672.132] (-673.276) * (-673.649) (-671.605) (-672.981) [-672.356] -- 0:00:49
408500 -- (-677.350) (-672.375) [-673.627] (-674.724) * (-679.006) (-671.980) (-672.962) [-672.158] -- 0:00:49
409000 -- (-671.487) (-671.119) [-674.505] (-675.411) * [-671.279] (-673.399) (-672.124) (-672.230) -- 0:00:49
409500 -- (-673.312) [-671.800] (-672.007) (-673.949) * (-672.653) (-671.574) (-673.189) [-676.242] -- 0:00:49
410000 -- (-673.327) (-673.771) (-680.383) [-673.406] * (-674.341) (-671.741) (-671.617) [-675.167] -- 0:00:48
Average standard deviation of split frequencies: 0.010669
410500 -- (-675.054) (-673.625) [-673.376] (-671.007) * (-671.060) (-673.220) [-671.505] (-672.413) -- 0:00:48
411000 -- (-678.451) (-673.081) (-672.910) [-671.548] * (-672.114) (-676.093) (-670.924) [-673.586] -- 0:00:48
411500 -- (-674.033) (-671.968) [-672.788] (-672.242) * (-672.800) [-675.499] (-677.365) (-671.938) -- 0:00:48
412000 -- (-674.307) [-672.529] (-671.724) (-682.434) * (-675.041) [-672.713] (-672.097) (-673.974) -- 0:00:48
412500 -- (-678.806) (-670.680) [-672.331] (-674.786) * [-673.021] (-672.964) (-671.516) (-671.752) -- 0:00:48
413000 -- (-674.174) [-671.427] (-672.294) (-672.069) * (-673.200) (-675.669) [-674.439] (-671.684) -- 0:00:48
413500 -- (-675.511) (-670.733) (-672.516) [-672.496] * [-674.599] (-672.164) (-673.822) (-671.223) -- 0:00:48
414000 -- (-672.069) (-673.242) [-673.223] (-676.121) * (-672.281) [-674.512] (-673.546) (-670.481) -- 0:00:49
414500 -- [-671.958] (-673.575) (-674.171) (-673.374) * (-672.704) (-670.549) (-672.559) [-672.666] -- 0:00:49
415000 -- (-671.265) (-674.717) (-671.763) [-671.772] * [-672.294] (-673.151) (-674.420) (-672.911) -- 0:00:49
Average standard deviation of split frequencies: 0.009999
415500 -- [-673.625] (-675.331) (-673.564) (-673.097) * (-676.297) (-676.818) [-671.561] (-675.737) -- 0:00:49
416000 -- [-678.657] (-673.638) (-673.634) (-673.836) * (-674.292) [-674.650] (-672.583) (-672.545) -- 0:00:49
416500 -- (-676.101) [-671.876] (-670.932) (-671.872) * (-676.254) [-673.207] (-671.728) (-672.118) -- 0:00:49
417000 -- [-673.976] (-671.811) (-671.586) (-672.614) * (-673.010) (-672.060) [-672.048] (-672.018) -- 0:00:48
417500 -- [-671.850] (-674.728) (-672.521) (-673.104) * [-672.454] (-672.292) (-675.435) (-672.729) -- 0:00:48
418000 -- (-675.552) (-673.246) [-673.212] (-673.612) * (-672.471) (-673.413) [-673.828] (-671.349) -- 0:00:48
418500 -- (-673.949) (-674.414) [-672.802] (-677.342) * (-671.757) (-671.141) (-673.242) [-672.589] -- 0:00:48
419000 -- [-673.323] (-674.784) (-672.293) (-671.964) * (-670.768) (-674.729) [-677.509] (-671.626) -- 0:00:48
419500 -- [-673.265] (-672.689) (-672.026) (-672.951) * (-670.847) (-672.179) (-671.455) [-673.286] -- 0:00:48
420000 -- (-672.895) [-673.593] (-671.493) (-674.721) * (-671.898) (-671.858) (-671.986) [-671.166] -- 0:00:48
Average standard deviation of split frequencies: 0.009945
420500 -- (-673.689) (-673.152) (-670.949) [-671.414] * (-671.622) (-672.834) [-673.481] (-671.978) -- 0:00:48
421000 -- (-680.213) [-672.373] (-670.982) (-672.428) * [-675.084] (-674.920) (-672.001) (-673.651) -- 0:00:48
421500 -- (-671.083) (-672.982) (-671.878) [-671.146] * (-672.898) (-676.316) [-674.759] (-671.331) -- 0:00:48
422000 -- (-671.170) [-672.214] (-672.476) (-671.039) * (-670.956) (-672.996) [-672.286] (-671.230) -- 0:00:47
422500 -- (-671.170) (-670.879) (-679.737) [-671.397] * (-673.842) [-678.171] (-673.328) (-672.547) -- 0:00:47
423000 -- (-672.133) [-673.316] (-678.685) (-673.756) * [-674.458] (-672.817) (-673.291) (-673.013) -- 0:00:47
423500 -- (-671.696) (-675.566) [-672.253] (-672.369) * (-674.365) [-674.519] (-672.523) (-673.869) -- 0:00:47
424000 -- (-671.164) [-672.491] (-672.576) (-672.569) * (-672.308) (-672.237) [-673.805] (-677.785) -- 0:00:47
424500 -- (-672.698) (-673.241) [-672.052] (-671.761) * [-672.447] (-671.750) (-674.533) (-674.707) -- 0:00:47
425000 -- (-671.267) (-672.467) [-674.849] (-674.604) * (-673.543) (-671.059) [-672.338] (-670.843) -- 0:00:47
Average standard deviation of split frequencies: 0.010167
425500 -- (-671.455) (-672.584) [-671.935] (-674.132) * [-673.030] (-670.976) (-674.534) (-670.936) -- 0:00:47
426000 -- (-672.413) [-671.378] (-675.121) (-673.490) * (-672.313) (-671.726) [-671.765] (-671.713) -- 0:00:48
426500 -- (-674.196) (-674.625) [-677.649] (-673.057) * (-674.003) [-674.238] (-670.765) (-671.508) -- 0:00:48
427000 -- [-670.635] (-672.869) (-673.259) (-673.202) * [-674.334] (-672.485) (-676.412) (-676.673) -- 0:00:48
427500 -- (-670.927) (-672.942) (-673.282) [-671.768] * (-675.130) (-674.635) [-673.118] (-671.664) -- 0:00:48
428000 -- (-672.441) [-673.731] (-678.213) (-673.597) * (-676.715) (-671.560) [-673.131] (-670.645) -- 0:00:48
428500 -- (-672.049) (-672.687) (-674.253) [-672.839] * (-671.764) (-673.581) [-673.060] (-671.927) -- 0:00:48
429000 -- (-672.296) (-674.726) [-671.902] (-673.957) * [-673.726] (-674.769) (-673.777) (-673.258) -- 0:00:47
429500 -- (-674.608) [-672.770] (-671.444) (-671.413) * (-675.428) (-673.021) (-671.955) [-673.887] -- 0:00:47
430000 -- (-674.028) (-673.080) (-673.668) [-672.501] * (-675.878) (-673.175) [-671.902] (-671.585) -- 0:00:47
Average standard deviation of split frequencies: 0.009465
430500 -- (-674.896) [-672.384] (-672.373) (-672.321) * (-672.050) (-674.848) [-671.280] (-671.706) -- 0:00:47
431000 -- [-674.327] (-672.481) (-674.259) (-673.047) * (-682.976) [-672.512] (-671.437) (-672.588) -- 0:00:47
431500 -- (-675.598) (-673.775) [-672.983] (-673.007) * [-673.808] (-671.786) (-672.903) (-672.876) -- 0:00:47
432000 -- (-671.808) (-673.608) [-672.849] (-672.814) * (-670.871) (-671.517) (-672.596) [-671.159] -- 0:00:47
432500 -- (-674.255) (-673.567) (-671.783) [-671.590] * (-671.367) (-672.190) [-672.325] (-671.755) -- 0:00:47
433000 -- [-674.137] (-671.415) (-672.433) (-672.853) * (-674.406) [-671.855] (-672.881) (-676.753) -- 0:00:47
433500 -- [-674.895] (-674.181) (-672.377) (-675.840) * (-678.761) [-673.131] (-673.658) (-674.952) -- 0:00:47
434000 -- (-673.744) [-673.134] (-673.099) (-681.183) * [-672.230] (-670.568) (-671.736) (-671.520) -- 0:00:46
434500 -- [-670.707] (-673.133) (-673.800) (-672.492) * [-672.413] (-670.801) (-673.526) (-672.536) -- 0:00:46
435000 -- (-672.537) (-672.905) [-674.223] (-672.807) * (-672.823) (-675.017) (-672.782) [-671.809] -- 0:00:46
Average standard deviation of split frequencies: 0.009958
435500 -- [-673.701] (-673.608) (-672.293) (-673.078) * (-672.601) (-675.436) (-673.134) [-673.167] -- 0:00:46
436000 -- (-672.327) [-675.858] (-672.122) (-672.858) * [-673.799] (-671.603) (-674.559) (-672.900) -- 0:00:46
436500 -- (-675.963) (-672.216) [-674.486] (-674.295) * (-670.821) (-670.888) (-674.168) [-671.046] -- 0:00:46
437000 -- [-676.553] (-674.774) (-675.002) (-672.985) * (-671.985) (-673.470) [-673.223] (-670.669) -- 0:00:46
437500 -- (-672.593) (-671.850) [-671.347] (-671.968) * [-672.843] (-673.610) (-673.243) (-670.669) -- 0:00:46
438000 -- (-673.266) (-674.723) (-670.911) [-671.113] * [-672.997] (-673.704) (-671.679) (-672.316) -- 0:00:47
438500 -- (-672.927) (-671.272) [-671.431] (-671.361) * (-671.706) [-672.299] (-673.976) (-672.683) -- 0:00:47
439000 -- (-675.045) (-676.433) [-672.098] (-671.261) * (-674.557) (-671.166) (-671.936) [-672.362] -- 0:00:47
439500 -- (-672.517) [-671.824] (-673.096) (-673.219) * (-675.897) (-670.693) (-673.585) [-672.545] -- 0:00:47
440000 -- (-673.325) [-671.498] (-670.826) (-671.210) * (-676.072) (-672.951) (-673.113) [-671.158] -- 0:00:47
Average standard deviation of split frequencies: 0.009925
440500 -- (-671.205) [-672.955] (-672.578) (-671.585) * (-674.599) [-670.696] (-674.614) (-674.609) -- 0:00:46
441000 -- (-670.807) (-673.524) [-676.149] (-672.650) * [-673.410] (-671.710) (-675.255) (-670.939) -- 0:00:46
441500 -- (-671.511) (-674.200) (-678.942) [-671.778] * [-675.416] (-671.377) (-672.253) (-670.955) -- 0:00:46
442000 -- [-670.538] (-676.737) (-673.465) (-671.135) * [-674.106] (-671.215) (-671.317) (-671.664) -- 0:00:46
442500 -- [-671.575] (-680.227) (-677.117) (-674.251) * (-676.060) (-673.741) [-672.295] (-671.191) -- 0:00:46
443000 -- (-671.527) (-673.492) [-672.623] (-674.914) * (-670.867) (-673.613) (-674.709) [-673.516] -- 0:00:46
443500 -- [-671.645] (-674.078) (-671.508) (-675.888) * [-671.667] (-676.560) (-673.053) (-675.121) -- 0:00:46
444000 -- (-672.770) (-675.666) (-671.126) [-672.069] * [-672.106] (-674.315) (-676.696) (-671.087) -- 0:00:46
444500 -- (-674.529) (-674.052) (-675.499) [-671.535] * (-672.448) (-674.826) [-675.307] (-672.059) -- 0:00:46
445000 -- [-675.064] (-673.031) (-671.857) (-671.446) * [-674.693] (-673.288) (-673.512) (-673.121) -- 0:00:46
Average standard deviation of split frequencies: 0.010217
445500 -- (-672.505) (-670.879) [-673.629] (-671.611) * (-671.196) [-672.471] (-673.917) (-671.714) -- 0:00:46
446000 -- (-672.896) (-673.583) [-672.780] (-671.999) * (-670.734) (-672.059) [-672.913] (-671.177) -- 0:00:45
446500 -- (-672.174) [-671.796] (-671.484) (-671.728) * [-671.564] (-671.265) (-673.269) (-671.276) -- 0:00:45
447000 -- (-675.632) (-673.531) (-671.604) [-671.573] * (-671.826) (-672.767) [-671.655] (-675.795) -- 0:00:45
447500 -- [-676.384] (-671.083) (-670.632) (-672.171) * (-673.209) (-672.772) [-671.279] (-673.141) -- 0:00:45
448000 -- (-673.487) (-671.756) [-673.405] (-671.606) * (-672.837) [-673.175] (-677.499) (-673.749) -- 0:00:45
448500 -- (-673.593) [-671.224] (-676.790) (-671.987) * [-672.167] (-678.263) (-675.900) (-672.444) -- 0:00:45
449000 -- (-670.780) (-674.814) (-676.020) [-671.642] * (-674.196) (-673.768) [-673.856] (-671.273) -- 0:00:45
449500 -- (-674.067) [-673.321] (-672.023) (-681.967) * (-674.094) (-672.912) (-670.873) [-673.773] -- 0:00:45
450000 -- (-674.762) (-672.056) (-673.019) [-672.580] * (-676.001) [-674.708] (-673.004) (-674.074) -- 0:00:45
Average standard deviation of split frequencies: 0.010228
450500 -- (-672.957) (-674.966) [-671.780] (-672.881) * (-671.907) (-673.786) (-671.563) [-671.299] -- 0:00:46
451000 -- (-676.390) (-672.165) [-672.950] (-673.657) * [-673.463] (-673.770) (-675.496) (-675.129) -- 0:00:46
451500 -- (-677.130) (-675.394) [-672.248] (-678.844) * (-672.652) (-675.168) (-678.320) [-672.465] -- 0:00:46
452000 -- [-677.425] (-673.727) (-672.139) (-675.677) * (-671.586) (-671.540) (-674.021) [-673.574] -- 0:00:46
452500 -- [-673.069] (-671.038) (-673.596) (-671.371) * (-671.023) (-674.202) (-675.342) [-671.367] -- 0:00:45
453000 -- (-673.018) (-671.679) (-674.134) [-672.255] * [-671.819] (-671.650) (-674.013) (-672.968) -- 0:00:45
453500 -- (-673.014) [-672.310] (-674.850) (-672.213) * (-672.244) (-672.105) (-676.776) [-671.461] -- 0:00:45
454000 -- [-670.967] (-673.070) (-672.145) (-673.140) * (-676.973) (-672.864) (-673.829) [-672.058] -- 0:00:45
454500 -- (-672.844) [-673.696] (-671.091) (-671.722) * (-672.349) (-674.780) [-672.167] (-674.445) -- 0:00:45
455000 -- [-673.469] (-673.782) (-671.362) (-672.600) * (-674.651) (-671.348) (-672.092) [-678.844] -- 0:00:45
Average standard deviation of split frequencies: 0.009247
455500 -- (-672.356) (-672.637) (-670.608) [-673.434] * (-670.676) (-676.208) [-674.943] (-674.501) -- 0:00:45
456000 -- (-671.520) [-672.082] (-670.709) (-672.989) * (-672.235) [-673.573] (-671.661) (-674.373) -- 0:00:45
456500 -- [-671.208] (-673.151) (-674.375) (-672.584) * [-670.584] (-673.194) (-674.580) (-672.704) -- 0:00:45
457000 -- [-675.139] (-672.449) (-672.424) (-671.913) * (-670.619) (-673.827) (-672.795) [-674.333] -- 0:00:45
457500 -- (-672.544) (-673.529) [-671.465] (-674.174) * (-673.762) (-672.198) (-678.915) [-673.786] -- 0:00:45
458000 -- (-673.161) (-672.285) (-671.980) [-675.422] * (-673.625) [-672.165] (-673.872) (-675.665) -- 0:00:44
458500 -- [-674.728] (-672.493) (-672.819) (-675.325) * (-673.698) [-671.040] (-673.622) (-671.620) -- 0:00:44
459000 -- (-673.699) (-675.544) [-672.936] (-672.169) * (-671.249) (-673.757) (-671.746) [-672.066] -- 0:00:44
459500 -- (-673.540) [-672.349] (-675.845) (-672.881) * (-672.956) [-672.864] (-675.394) (-672.049) -- 0:00:44
460000 -- [-672.674] (-679.423) (-671.285) (-672.287) * (-674.324) [-673.607] (-672.212) (-671.079) -- 0:00:44
Average standard deviation of split frequencies: 0.009082
460500 -- [-676.168] (-676.551) (-675.688) (-676.217) * (-672.715) [-673.291] (-671.564) (-670.986) -- 0:00:44
461000 -- (-674.356) (-673.330) [-673.935] (-674.952) * (-671.873) (-678.108) (-672.728) [-671.927] -- 0:00:44
461500 -- (-674.021) [-675.369] (-679.390) (-674.724) * (-673.599) (-676.384) (-674.426) [-670.915] -- 0:00:44
462000 -- (-672.924) (-672.918) [-673.723] (-673.887) * (-672.043) [-680.162] (-672.378) (-672.907) -- 0:00:44
462500 -- (-673.687) (-675.867) [-673.722] (-671.707) * (-671.747) [-675.339] (-671.824) (-675.943) -- 0:00:45
463000 -- (-672.175) (-674.266) (-673.684) [-673.348] * [-673.277] (-674.484) (-671.642) (-676.306) -- 0:00:45
463500 -- [-670.700] (-671.793) (-672.525) (-671.831) * (-671.416) [-672.803] (-674.913) (-672.480) -- 0:00:45
464000 -- (-672.856) (-674.258) [-671.620] (-671.025) * (-671.589) (-671.646) [-675.696] (-681.600) -- 0:00:45
464500 -- (-676.781) (-671.886) (-674.285) [-671.598] * (-675.338) [-673.101] (-671.106) (-676.512) -- 0:00:44
465000 -- [-672.986] (-671.739) (-672.142) (-674.620) * [-672.507] (-677.320) (-673.629) (-674.628) -- 0:00:44
Average standard deviation of split frequencies: 0.009878
465500 -- [-671.320] (-671.362) (-675.656) (-672.953) * (-675.424) (-675.666) (-671.574) [-671.127] -- 0:00:44
466000 -- [-670.913] (-672.437) (-674.744) (-673.691) * (-676.450) (-672.724) [-673.303] (-670.934) -- 0:00:44
466500 -- (-671.133) (-671.161) [-671.293] (-672.012) * [-674.136] (-671.800) (-672.355) (-671.737) -- 0:00:44
467000 -- (-671.643) (-672.302) (-673.423) [-674.769] * (-674.385) (-672.390) [-672.970] (-671.668) -- 0:00:44
467500 -- (-671.235) [-672.127] (-675.008) (-672.670) * (-679.327) [-673.710] (-671.536) (-671.868) -- 0:00:44
468000 -- (-671.142) (-671.217) [-673.082] (-671.036) * [-672.271] (-673.711) (-671.682) (-670.790) -- 0:00:44
468500 -- (-672.634) (-672.902) [-672.659] (-672.079) * (-674.561) (-673.281) [-671.906] (-672.294) -- 0:00:44
469000 -- (-676.708) (-673.955) (-672.770) [-676.052] * [-671.972] (-674.997) (-672.435) (-674.013) -- 0:00:44
469500 -- [-672.889] (-673.459) (-675.002) (-677.390) * (-671.211) [-672.599] (-670.620) (-673.472) -- 0:00:44
470000 -- (-671.645) (-675.424) [-672.088] (-671.269) * (-674.347) [-674.373] (-673.747) (-672.295) -- 0:00:43
Average standard deviation of split frequencies: 0.009682
470500 -- [-673.442] (-675.111) (-674.073) (-671.751) * [-673.579] (-673.038) (-673.404) (-672.318) -- 0:00:43
471000 -- (-672.043) (-672.383) (-671.740) [-670.966] * (-670.630) [-673.522] (-671.882) (-671.643) -- 0:00:43
471500 -- (-673.819) (-673.190) (-671.146) [-672.822] * [-671.045] (-673.807) (-672.839) (-679.614) -- 0:00:43
472000 -- (-675.019) (-671.883) (-673.689) [-675.651] * (-673.344) (-676.552) [-671.867] (-673.633) -- 0:00:43
472500 -- (-671.219) (-673.297) [-671.658] (-676.338) * [-672.807] (-672.130) (-673.122) (-673.862) -- 0:00:43
473000 -- [-673.497] (-672.522) (-673.352) (-673.375) * (-675.743) [-671.027] (-674.808) (-672.022) -- 0:00:43
473500 -- (-673.738) [-673.182] (-676.076) (-674.815) * (-672.639) [-671.999] (-675.376) (-672.264) -- 0:00:43
474000 -- (-673.854) [-675.060] (-678.260) (-674.635) * (-674.309) (-671.564) [-675.889] (-672.959) -- 0:00:43
474500 -- (-673.686) [-672.519] (-672.974) (-676.306) * (-671.865) (-672.506) [-673.149] (-672.864) -- 0:00:44
475000 -- (-677.268) (-672.929) [-680.153] (-674.465) * (-674.217) (-673.853) [-671.679] (-678.456) -- 0:00:44
Average standard deviation of split frequencies: 0.009379
475500 -- (-677.823) (-671.467) [-674.264] (-673.149) * (-673.223) (-676.783) [-672.831] (-675.036) -- 0:00:44
476000 -- (-674.418) (-674.660) [-672.195] (-672.585) * [-674.501] (-673.087) (-674.190) (-680.348) -- 0:00:44
476500 -- [-671.169] (-674.822) (-673.892) (-672.483) * (-675.412) (-674.349) (-673.005) [-672.815] -- 0:00:43
477000 -- [-675.091] (-672.667) (-677.908) (-677.975) * (-673.085) (-672.380) [-674.020] (-674.961) -- 0:00:43
477500 -- (-678.275) [-672.539] (-676.755) (-675.584) * (-678.852) (-675.031) (-671.252) [-671.731] -- 0:00:43
478000 -- (-673.634) [-672.794] (-672.052) (-672.182) * (-674.713) (-672.297) [-672.799] (-672.768) -- 0:00:43
478500 -- (-672.371) (-674.649) [-673.602] (-672.497) * (-673.884) (-671.364) (-671.994) [-672.069] -- 0:00:43
479000 -- (-670.713) [-675.374] (-671.730) (-674.370) * (-672.849) [-673.411] (-671.405) (-670.612) -- 0:00:43
479500 -- (-674.546) [-674.648] (-671.524) (-672.261) * [-671.072] (-674.338) (-671.883) (-672.120) -- 0:00:43
480000 -- [-672.459] (-672.162) (-674.245) (-672.694) * (-671.118) (-673.915) [-672.933] (-671.865) -- 0:00:43
Average standard deviation of split frequencies: 0.009317
480500 -- (-674.206) [-671.331] (-675.532) (-672.120) * [-671.225] (-673.530) (-674.055) (-672.749) -- 0:00:43
481000 -- (-672.661) (-677.817) [-674.282] (-674.221) * [-671.430] (-674.402) (-671.672) (-672.308) -- 0:00:43
481500 -- (-671.577) [-672.107] (-672.811) (-674.139) * (-670.955) [-672.280] (-672.094) (-673.891) -- 0:00:43
482000 -- [-672.156] (-673.443) (-673.734) (-673.268) * (-671.463) [-671.516] (-670.945) (-677.584) -- 0:00:42
482500 -- (-672.017) (-672.916) (-672.801) [-671.522] * (-674.550) [-672.695] (-673.654) (-674.544) -- 0:00:42
483000 -- [-673.903] (-672.618) (-673.314) (-672.379) * (-674.299) (-673.594) (-675.540) [-673.921] -- 0:00:42
483500 -- (-680.652) (-673.656) (-671.385) [-674.140] * (-671.404) (-672.237) [-671.059] (-671.990) -- 0:00:42
484000 -- (-676.806) [-673.648] (-671.099) (-671.167) * (-671.799) (-678.996) (-673.824) [-671.094] -- 0:00:42
484500 -- (-672.605) (-675.296) (-673.205) [-671.864] * (-671.842) (-677.153) (-673.569) [-671.542] -- 0:00:42
485000 -- (-674.413) (-675.136) [-676.081] (-676.231) * (-673.065) (-674.056) [-674.211] (-671.788) -- 0:00:43
Average standard deviation of split frequencies: 0.009186
485500 -- [-675.241] (-672.619) (-673.013) (-675.506) * (-672.550) (-673.317) (-672.814) [-672.755] -- 0:00:43
486000 -- (-671.508) [-672.004] (-674.203) (-675.667) * (-671.174) [-670.839] (-671.951) (-671.766) -- 0:00:43
486500 -- (-671.505) (-674.586) (-673.544) [-670.655] * [-674.012] (-671.715) (-671.387) (-673.774) -- 0:00:43
487000 -- [-672.197] (-675.543) (-672.536) (-672.973) * (-673.307) (-672.472) (-674.849) [-673.352] -- 0:00:43
487500 -- [-673.243] (-673.461) (-676.418) (-673.679) * (-675.214) [-673.698] (-674.433) (-671.457) -- 0:00:43
488000 -- [-671.162] (-680.458) (-673.023) (-671.203) * (-672.945) [-672.289] (-673.370) (-674.013) -- 0:00:43
488500 -- (-675.724) (-671.716) (-674.767) [-673.068] * (-672.613) (-672.315) [-672.127] (-671.937) -- 0:00:42
489000 -- (-674.230) (-671.985) [-671.037] (-674.313) * (-671.676) [-675.516] (-672.373) (-671.841) -- 0:00:42
489500 -- (-673.240) (-676.480) (-672.526) [-674.697] * [-670.886] (-673.348) (-671.639) (-673.135) -- 0:00:42
490000 -- [-672.311] (-671.398) (-671.910) (-676.018) * (-674.040) (-671.694) [-672.616] (-672.761) -- 0:00:42
Average standard deviation of split frequencies: 0.008816
490500 -- (-671.527) (-672.256) (-672.512) [-673.989] * (-673.405) (-671.725) [-671.250] (-673.200) -- 0:00:42
491000 -- (-673.601) [-672.028] (-673.234) (-672.324) * (-677.587) (-679.751) [-672.110] (-673.206) -- 0:00:42
491500 -- (-672.379) [-672.435] (-672.697) (-671.784) * (-672.345) (-674.803) [-671.630] (-675.284) -- 0:00:42
492000 -- (-671.460) (-672.653) (-674.195) [-672.300] * [-672.950] (-675.691) (-672.536) (-675.672) -- 0:00:42
492500 -- (-671.474) (-673.869) (-671.383) [-673.979] * (-672.349) [-673.545] (-672.478) (-672.082) -- 0:00:42
493000 -- (-675.360) (-672.821) [-672.521] (-677.127) * [-672.084] (-674.547) (-674.032) (-672.609) -- 0:00:42
493500 -- (-671.539) (-673.199) (-672.799) [-671.086] * [-672.084] (-673.138) (-674.004) (-674.486) -- 0:00:42
494000 -- (-674.600) (-672.199) (-676.192) [-672.288] * (-674.519) (-672.146) [-671.858] (-678.510) -- 0:00:41
494500 -- [-674.162] (-673.375) (-675.013) (-671.372) * [-675.742] (-675.146) (-673.039) (-676.630) -- 0:00:41
495000 -- (-673.377) (-675.007) [-672.803] (-673.989) * (-677.167) (-671.799) [-673.285] (-672.323) -- 0:00:41
Average standard deviation of split frequencies: 0.008777
495500 -- (-675.372) (-675.148) [-676.512] (-671.120) * (-674.698) (-673.306) [-671.055] (-672.052) -- 0:00:41
496000 -- (-671.399) (-672.197) (-673.836) [-673.139] * (-673.003) (-672.286) (-674.412) [-675.696] -- 0:00:41
496500 -- (-674.132) [-672.825] (-674.264) (-675.893) * (-672.671) (-673.024) (-677.615) [-672.011] -- 0:00:41
497000 -- [-674.002] (-674.355) (-679.433) (-676.018) * (-672.255) (-672.143) [-672.646] (-676.149) -- 0:00:42
497500 -- (-671.227) (-677.617) [-674.839] (-671.032) * (-673.683) (-671.372) [-672.252] (-671.724) -- 0:00:42
498000 -- (-673.120) (-670.815) (-671.271) [-672.829] * (-671.687) (-671.365) [-672.162] (-672.019) -- 0:00:42
498500 -- (-673.446) (-670.885) (-671.874) [-672.389] * (-673.755) [-671.473] (-672.160) (-676.206) -- 0:00:42
499000 -- (-672.546) [-672.408] (-673.519) (-672.171) * (-673.347) [-673.918] (-672.845) (-671.934) -- 0:00:42
499500 -- [-673.028] (-673.830) (-672.681) (-673.489) * [-671.710] (-673.025) (-672.969) (-675.679) -- 0:00:42
500000 -- (-673.307) [-676.932] (-673.667) (-672.084) * (-673.792) [-673.087] (-674.763) (-679.782) -- 0:00:42
Average standard deviation of split frequencies: 0.009180
500500 -- (-674.961) (-671.548) [-672.649] (-672.720) * [-675.685] (-671.951) (-675.961) (-678.722) -- 0:00:41
501000 -- (-673.125) (-679.527) (-675.420) [-672.471] * (-674.126) [-674.086] (-672.375) (-672.169) -- 0:00:41
501500 -- (-671.651) (-671.139) (-672.717) [-671.385] * (-677.771) [-675.849] (-676.327) (-672.999) -- 0:00:41
502000 -- [-674.017] (-670.898) (-671.265) (-676.940) * [-674.094] (-673.226) (-671.243) (-673.297) -- 0:00:41
502500 -- (-673.806) [-671.651] (-672.309) (-676.177) * (-675.386) (-671.329) [-671.976] (-672.853) -- 0:00:41
503000 -- [-673.618] (-679.759) (-672.429) (-672.017) * (-672.541) (-672.109) [-672.188] (-673.715) -- 0:00:41
503500 -- [-672.098] (-673.404) (-671.715) (-671.312) * (-673.075) [-672.167] (-675.836) (-672.304) -- 0:00:41
504000 -- (-674.153) [-671.729] (-673.110) (-671.906) * (-674.605) (-673.351) [-673.715] (-673.351) -- 0:00:41
504500 -- (-671.963) (-673.997) [-676.107] (-672.736) * (-675.435) [-671.774] (-671.765) (-672.995) -- 0:00:41
505000 -- [-672.348] (-672.924) (-678.684) (-671.208) * (-671.496) [-674.154] (-673.704) (-673.043) -- 0:00:41
Average standard deviation of split frequencies: 0.009261
505500 -- (-675.857) [-671.893] (-675.969) (-672.324) * (-673.621) [-671.769] (-675.699) (-675.071) -- 0:00:41
506000 -- (-673.935) (-675.282) (-674.562) [-671.755] * (-672.806) (-674.697) [-672.054] (-671.925) -- 0:00:41
506500 -- (-672.724) (-674.551) (-674.918) [-673.383] * (-671.475) (-673.190) (-674.969) [-674.617] -- 0:00:40
507000 -- [-673.390] (-671.996) (-673.199) (-672.562) * (-673.473) (-673.062) [-674.405] (-675.524) -- 0:00:40
507500 -- (-671.938) [-671.982] (-672.376) (-673.776) * [-672.825] (-674.884) (-673.562) (-670.667) -- 0:00:40
508000 -- [-671.786] (-674.826) (-671.147) (-672.470) * [-671.171] (-672.740) (-674.541) (-673.088) -- 0:00:40
508500 -- (-671.791) (-672.696) [-673.854] (-674.084) * (-671.741) [-672.909] (-672.350) (-679.388) -- 0:00:40
509000 -- [-671.853] (-674.258) (-672.112) (-673.126) * (-670.805) (-672.000) [-673.857] (-672.500) -- 0:00:40
509500 -- (-672.293) (-672.091) [-672.155] (-675.940) * (-675.303) [-670.772] (-673.534) (-674.234) -- 0:00:41
510000 -- [-671.947] (-677.395) (-672.349) (-671.482) * (-673.690) [-673.798] (-673.357) (-671.683) -- 0:00:41
Average standard deviation of split frequencies: 0.009828
510500 -- (-673.041) (-674.353) [-674.242] (-674.868) * (-676.201) (-673.057) (-674.094) [-674.316] -- 0:00:41
511000 -- [-672.209] (-672.963) (-686.367) (-679.700) * (-672.388) [-672.025] (-672.919) (-673.749) -- 0:00:41
511500 -- (-672.458) [-673.883] (-690.227) (-673.828) * (-672.911) (-671.100) [-671.145] (-671.655) -- 0:00:41
512000 -- (-672.143) (-671.663) (-681.703) [-675.163] * (-672.875) (-673.570) (-671.512) [-671.824] -- 0:00:40
512500 -- [-677.550] (-671.941) (-679.215) (-671.946) * [-674.856] (-673.392) (-672.216) (-674.603) -- 0:00:40
513000 -- [-673.542] (-674.151) (-679.028) (-672.048) * (-673.432) (-675.504) [-672.443] (-675.635) -- 0:00:40
513500 -- (-674.667) [-672.431] (-674.137) (-674.831) * [-670.857] (-673.908) (-678.085) (-672.885) -- 0:00:40
514000 -- (-675.258) (-674.109) [-673.922] (-671.180) * (-671.868) (-672.544) (-677.453) [-672.392] -- 0:00:40
514500 -- (-675.772) (-673.263) [-672.139] (-672.566) * (-671.473) (-672.094) (-671.056) [-671.224] -- 0:00:40
515000 -- (-674.185) [-674.716] (-672.800) (-676.371) * (-672.886) (-672.563) [-672.518] (-673.699) -- 0:00:40
Average standard deviation of split frequencies: 0.009727
515500 -- (-672.795) [-672.207] (-674.087) (-674.242) * (-672.960) (-672.724) (-676.193) [-673.680] -- 0:00:40
516000 -- (-671.871) [-671.564] (-675.601) (-675.771) * [-673.989] (-673.254) (-671.596) (-673.497) -- 0:00:40
516500 -- (-671.703) (-672.347) (-673.385) [-674.392] * [-671.788] (-674.287) (-674.642) (-674.199) -- 0:00:40
517000 -- (-672.963) [-671.339] (-671.651) (-673.696) * (-670.928) (-674.803) (-675.177) [-673.429] -- 0:00:40
517500 -- (-672.044) (-672.061) [-674.496] (-671.472) * [-672.172] (-672.298) (-672.933) (-673.900) -- 0:00:40
518000 -- (-673.114) (-674.202) (-675.172) [-675.462] * (-673.031) (-679.823) (-673.794) [-672.349] -- 0:00:40
518500 -- [-674.790] (-679.099) (-677.124) (-673.059) * [-671.779] (-673.026) (-671.859) (-676.063) -- 0:00:39
519000 -- (-674.435) (-675.988) [-672.145] (-672.950) * (-673.195) (-676.538) (-672.326) [-671.921] -- 0:00:39
519500 -- (-672.706) [-676.361] (-671.913) (-672.616) * [-672.659] (-673.822) (-676.202) (-671.722) -- 0:00:39
520000 -- (-673.204) (-673.839) (-672.973) [-672.957] * [-671.798] (-671.874) (-671.089) (-672.760) -- 0:00:39
Average standard deviation of split frequencies: 0.009906
520500 -- (-671.531) (-673.191) (-673.498) [-675.266] * (-673.409) (-673.403) (-672.406) [-674.351] -- 0:00:39
521000 -- (-671.526) (-671.803) (-672.692) [-674.057] * (-674.097) (-671.471) (-677.001) [-672.458] -- 0:00:39
521500 -- [-673.175] (-674.430) (-675.203) (-672.535) * (-675.299) [-672.336] (-673.815) (-673.364) -- 0:00:40
522000 -- (-675.009) [-672.297] (-671.825) (-671.895) * (-674.080) (-675.043) (-673.036) [-675.559] -- 0:00:40
522500 -- (-673.276) (-671.919) (-672.684) [-670.629] * (-671.036) [-672.891] (-675.081) (-671.355) -- 0:00:40
523000 -- (-674.494) (-674.629) (-673.368) [-673.636] * (-671.856) [-673.612] (-671.792) (-671.692) -- 0:00:40
523500 -- (-672.791) (-673.717) [-672.954] (-673.068) * (-677.434) (-671.553) (-673.339) [-671.869] -- 0:00:40
524000 -- [-672.913] (-674.621) (-672.373) (-671.122) * (-673.759) (-675.378) [-671.475] (-672.834) -- 0:00:39
524500 -- (-675.514) [-672.187] (-675.140) (-671.881) * [-671.849] (-671.911) (-671.621) (-673.120) -- 0:00:39
525000 -- (-673.325) (-673.346) [-673.265] (-675.227) * [-672.233] (-671.550) (-676.190) (-672.044) -- 0:00:39
Average standard deviation of split frequencies: 0.010069
525500 -- (-673.101) [-671.080] (-674.146) (-674.331) * (-676.266) [-670.815] (-679.034) (-675.648) -- 0:00:39
526000 -- (-671.945) (-673.208) (-673.912) [-670.708] * [-672.138] (-672.001) (-674.398) (-674.695) -- 0:00:39
526500 -- [-673.534] (-672.963) (-672.222) (-677.337) * [-671.638] (-671.749) (-674.018) (-672.091) -- 0:00:39
527000 -- [-672.619] (-675.543) (-672.124) (-676.916) * (-673.417) (-674.525) [-672.368] (-674.998) -- 0:00:39
527500 -- [-671.397] (-673.735) (-672.029) (-671.275) * [-672.690] (-672.337) (-675.362) (-675.270) -- 0:00:39
528000 -- [-671.827] (-673.269) (-671.782) (-671.448) * (-671.576) (-670.725) [-674.096] (-673.348) -- 0:00:39
528500 -- (-674.716) (-671.243) (-671.230) [-672.729] * [-672.991] (-674.159) (-672.182) (-672.532) -- 0:00:39
529000 -- (-671.750) (-672.499) [-670.775] (-672.832) * (-672.435) (-674.228) [-672.727] (-673.841) -- 0:00:39
529500 -- [-673.595] (-672.069) (-670.779) (-672.288) * (-674.801) (-672.092) [-672.597] (-671.665) -- 0:00:39
530000 -- [-674.744] (-672.285) (-671.417) (-672.032) * (-675.286) [-672.884] (-671.783) (-673.197) -- 0:00:39
Average standard deviation of split frequencies: 0.009667
530500 -- (-672.997) [-671.038] (-672.457) (-672.109) * (-674.333) (-671.946) (-671.672) [-676.708] -- 0:00:38
531000 -- (-673.867) (-670.944) [-671.811] (-672.178) * (-673.402) (-673.470) (-675.768) [-672.918] -- 0:00:38
531500 -- (-674.802) [-671.688] (-673.249) (-672.335) * (-674.251) [-671.387] (-671.818) (-674.837) -- 0:00:38
532000 -- (-675.197) (-673.868) (-673.144) [-671.220] * (-675.313) (-674.477) [-671.277] (-673.173) -- 0:00:38
532500 -- (-674.882) (-673.139) [-673.727] (-674.623) * (-673.315) (-673.783) (-677.549) [-676.252] -- 0:00:38
533000 -- (-673.697) (-671.168) [-674.681] (-672.686) * (-674.334) [-672.454] (-670.896) (-675.720) -- 0:00:38
533500 -- [-676.015] (-672.981) (-672.788) (-671.369) * (-672.733) [-672.643] (-671.784) (-671.517) -- 0:00:38
534000 -- [-671.855] (-672.883) (-671.375) (-672.643) * (-673.522) (-675.006) [-671.134] (-672.095) -- 0:00:39
534500 -- [-673.024] (-676.456) (-671.498) (-673.570) * (-675.098) (-671.443) [-671.159] (-671.817) -- 0:00:39
535000 -- (-671.493) (-673.049) [-674.447] (-677.236) * [-680.530] (-673.302) (-673.694) (-671.531) -- 0:00:39
Average standard deviation of split frequencies: 0.009674
535500 -- (-671.506) (-674.360) [-671.836] (-673.457) * [-670.906] (-670.664) (-674.510) (-673.149) -- 0:00:39
536000 -- (-677.015) (-674.210) [-673.054] (-673.364) * (-671.251) (-671.840) [-670.993] (-674.752) -- 0:00:38
536500 -- (-672.456) (-672.188) [-671.327] (-675.428) * (-674.949) (-672.970) [-671.536] (-670.719) -- 0:00:38
537000 -- (-672.747) (-673.662) [-671.249] (-674.026) * [-671.786] (-675.785) (-671.574) (-672.158) -- 0:00:38
537500 -- [-673.017] (-682.598) (-671.359) (-674.319) * [-672.190] (-672.852) (-672.513) (-672.627) -- 0:00:38
538000 -- (-677.983) (-674.332) [-671.416] (-671.620) * (-671.517) (-673.421) [-674.090] (-672.743) -- 0:00:38
538500 -- (-671.266) (-671.145) [-673.027] (-673.789) * [-670.734] (-674.753) (-674.266) (-673.869) -- 0:00:38
539000 -- (-673.176) [-671.347] (-674.142) (-680.653) * (-673.789) (-673.790) [-671.384] (-671.712) -- 0:00:38
539500 -- (-675.550) [-673.511] (-672.451) (-675.053) * (-672.866) (-672.126) [-672.778] (-671.990) -- 0:00:38
540000 -- (-674.438) [-671.401] (-674.786) (-673.375) * (-675.139) (-672.761) [-674.376] (-671.690) -- 0:00:38
Average standard deviation of split frequencies: 0.009334
540500 -- (-671.028) (-671.895) (-672.090) [-672.251] * [-674.799] (-673.099) (-673.234) (-671.825) -- 0:00:38
541000 -- (-671.825) (-672.794) [-673.317] (-674.013) * [-672.561] (-674.789) (-671.432) (-672.468) -- 0:00:38
541500 -- (-673.364) (-671.551) (-674.102) [-671.813] * (-671.707) [-676.126] (-672.683) (-673.976) -- 0:00:38
542000 -- (-672.339) (-671.906) (-675.685) [-674.585] * (-674.336) (-672.327) (-671.368) [-671.598] -- 0:00:38
542500 -- [-672.014] (-675.185) (-674.917) (-671.689) * (-672.189) [-671.444] (-672.234) (-678.068) -- 0:00:37
543000 -- [-673.313] (-672.979) (-671.674) (-673.354) * (-673.379) (-671.047) (-670.892) [-672.246] -- 0:00:37
543500 -- (-671.512) (-671.794) [-674.163] (-671.381) * (-671.632) (-671.264) [-672.518] (-675.540) -- 0:00:37
544000 -- (-671.998) (-673.495) [-674.373] (-671.919) * (-672.203) [-671.544] (-671.139) (-675.050) -- 0:00:37
544500 -- (-670.834) (-671.601) (-675.946) [-673.397] * (-671.563) (-672.905) [-671.102] (-673.128) -- 0:00:37
545000 -- (-674.013) [-671.813] (-673.385) (-673.019) * [-672.696] (-672.973) (-671.638) (-673.477) -- 0:00:37
Average standard deviation of split frequencies: 0.009689
545500 -- [-673.306] (-673.030) (-674.376) (-674.927) * (-671.732) [-680.852] (-673.482) (-670.788) -- 0:00:37
546000 -- (-671.581) (-675.636) (-670.911) [-671.854] * (-672.630) [-676.595] (-677.618) (-673.404) -- 0:00:38
546500 -- [-677.061] (-672.920) (-671.325) (-673.141) * (-673.977) (-676.195) (-677.671) [-673.054] -- 0:00:38
547000 -- (-673.226) (-672.178) (-671.393) [-672.121] * (-675.812) (-675.759) (-676.309) [-671.439] -- 0:00:38
547500 -- [-675.082] (-673.087) (-671.204) (-673.050) * (-674.215) (-671.769) (-674.555) [-671.499] -- 0:00:38
548000 -- (-675.026) [-673.882] (-672.763) (-678.854) * (-674.260) [-673.622] (-671.978) (-674.474) -- 0:00:37
548500 -- (-678.953) [-672.758] (-672.452) (-675.382) * (-672.312) (-674.167) [-670.618] (-676.178) -- 0:00:37
549000 -- (-672.838) [-675.898] (-675.656) (-674.416) * (-673.156) (-670.937) (-671.755) [-672.740] -- 0:00:37
549500 -- [-671.708] (-672.939) (-674.190) (-670.903) * (-678.850) (-672.374) [-671.399] (-674.560) -- 0:00:37
550000 -- [-673.242] (-673.295) (-672.892) (-671.198) * [-675.089] (-672.717) (-672.315) (-674.098) -- 0:00:37
Average standard deviation of split frequencies: 0.009845
550500 -- (-671.944) [-672.011] (-673.804) (-670.928) * [-675.345] (-671.328) (-671.734) (-671.512) -- 0:00:37
551000 -- (-676.728) [-672.474] (-673.996) (-672.289) * [-673.179] (-672.570) (-672.460) (-673.133) -- 0:00:37
551500 -- (-674.926) (-671.494) [-674.539] (-673.382) * [-672.461] (-672.259) (-672.870) (-673.323) -- 0:00:37
552000 -- [-670.599] (-673.812) (-674.868) (-672.177) * [-671.242] (-675.030) (-674.562) (-672.813) -- 0:00:37
552500 -- (-670.900) (-674.801) [-673.514] (-673.528) * [-671.047] (-673.310) (-675.115) (-672.306) -- 0:00:37
553000 -- [-671.028] (-674.160) (-672.274) (-672.300) * (-670.957) (-671.372) [-670.789] (-673.304) -- 0:00:37
553500 -- (-671.278) (-675.396) [-672.025] (-673.026) * (-674.404) (-670.999) [-673.515] (-674.223) -- 0:00:37
554000 -- (-671.635) (-673.292) (-674.721) [-672.135] * (-674.740) [-671.491] (-671.980) (-671.689) -- 0:00:37
554500 -- (-671.583) (-673.268) [-672.582] (-673.710) * (-671.895) [-673.574] (-671.605) (-671.240) -- 0:00:36
555000 -- [-671.179] (-671.902) (-672.763) (-671.741) * [-672.775] (-672.421) (-685.304) (-675.911) -- 0:00:36
Average standard deviation of split frequencies: 0.009426
555500 -- (-673.416) (-674.806) [-673.463] (-676.210) * (-671.565) (-673.406) [-677.509] (-672.458) -- 0:00:36
556000 -- (-672.201) (-675.683) [-671.728] (-677.535) * (-671.119) [-677.651] (-676.042) (-677.467) -- 0:00:36
556500 -- (-672.117) (-681.807) (-676.161) [-681.431] * (-670.655) [-678.436] (-672.214) (-675.520) -- 0:00:36
557000 -- [-674.246] (-675.627) (-674.699) (-683.882) * (-674.679) [-676.884] (-672.300) (-672.090) -- 0:00:36
557500 -- (-673.641) (-674.456) (-680.767) [-672.507] * (-674.920) [-672.776] (-672.103) (-673.039) -- 0:00:36
558000 -- (-671.552) (-673.124) [-680.498] (-674.403) * (-672.095) (-675.851) (-672.252) [-673.576] -- 0:00:36
558500 -- [-670.855] (-674.335) (-676.062) (-673.429) * (-673.469) (-678.901) (-676.677) [-673.841] -- 0:00:37
559000 -- [-674.595] (-674.518) (-676.766) (-674.801) * [-672.039] (-673.294) (-671.695) (-672.693) -- 0:00:37
559500 -- (-674.071) [-672.920] (-679.195) (-672.906) * (-671.786) (-671.369) [-672.147] (-672.759) -- 0:00:37
560000 -- [-673.625] (-672.323) (-673.301) (-677.021) * (-671.321) [-671.389] (-674.271) (-673.833) -- 0:00:36
Average standard deviation of split frequencies: 0.009100
560500 -- (-672.003) [-671.112] (-672.475) (-677.240) * [-671.526] (-671.796) (-672.298) (-673.150) -- 0:00:36
561000 -- (-671.499) (-672.701) [-671.722] (-672.691) * [-674.991] (-672.595) (-677.244) (-677.048) -- 0:00:36
561500 -- (-672.712) (-672.763) (-672.505) [-675.854] * (-674.468) (-675.786) (-674.145) [-671.963] -- 0:00:36
562000 -- (-671.463) [-672.768] (-676.575) (-674.496) * (-671.564) (-672.208) [-670.810] (-670.997) -- 0:00:36
562500 -- [-672.136] (-671.942) (-672.991) (-672.948) * (-671.841) (-673.595) (-676.520) [-674.888] -- 0:00:36
563000 -- [-674.358] (-670.763) (-671.665) (-672.925) * (-671.279) (-672.644) (-676.158) [-674.817] -- 0:00:36
563500 -- (-673.572) [-671.673] (-672.354) (-673.193) * (-673.867) (-672.640) [-672.057] (-670.903) -- 0:00:36
564000 -- (-674.522) (-672.277) [-674.219] (-677.531) * [-671.055] (-675.298) (-673.746) (-677.764) -- 0:00:36
564500 -- (-673.981) (-672.981) [-673.310] (-671.549) * (-671.284) (-675.881) (-672.094) [-672.282] -- 0:00:36
565000 -- (-675.312) (-674.838) (-679.158) [-672.076] * [-671.815] (-674.050) (-671.502) (-671.849) -- 0:00:36
Average standard deviation of split frequencies: 0.009717
565500 -- [-670.928] (-673.269) (-671.392) (-672.762) * (-671.947) (-671.640) (-674.361) [-674.641] -- 0:00:36
566000 -- (-671.436) [-672.660] (-675.873) (-675.306) * (-674.126) (-672.023) (-673.374) [-674.952] -- 0:00:36
566500 -- (-672.896) (-671.877) [-673.161] (-676.246) * (-672.109) [-672.453] (-673.913) (-672.190) -- 0:00:35
567000 -- (-671.770) (-673.980) [-675.253] (-673.401) * (-670.947) (-671.333) [-672.094] (-672.357) -- 0:00:35
567500 -- [-673.456] (-673.982) (-674.354) (-672.073) * (-673.595) (-673.253) [-672.733] (-678.798) -- 0:00:35
568000 -- (-671.032) (-672.226) [-673.668] (-672.830) * (-672.470) [-678.319] (-671.094) (-672.132) -- 0:00:35
568500 -- (-673.009) (-670.990) [-674.939] (-676.003) * (-674.435) (-675.201) (-672.993) [-676.697] -- 0:00:35
569000 -- (-675.095) (-672.419) (-672.729) [-673.564] * (-674.980) (-675.757) [-674.526] (-673.272) -- 0:00:35
569500 -- (-674.039) (-674.002) (-676.142) [-671.668] * (-671.586) (-674.115) [-670.736] (-672.603) -- 0:00:35
570000 -- (-673.902) (-674.670) (-671.765) [-672.080] * (-671.549) (-673.093) [-671.220] (-672.396) -- 0:00:35
Average standard deviation of split frequencies: 0.009224
570500 -- [-671.985] (-673.742) (-674.610) (-671.581) * (-672.601) [-673.352] (-674.558) (-672.239) -- 0:00:36
571000 -- (-674.584) [-672.258] (-672.444) (-673.207) * (-675.067) (-671.109) (-674.340) [-671.705] -- 0:00:36
571500 -- (-674.547) [-670.918] (-672.307) (-672.294) * (-671.442) (-671.522) [-674.488] (-674.162) -- 0:00:35
572000 -- (-677.261) (-671.379) [-678.208] (-673.169) * (-672.358) (-671.584) [-674.551] (-672.252) -- 0:00:35
572500 -- (-675.949) (-673.253) (-672.795) [-674.510] * (-671.387) (-673.004) [-671.364] (-671.658) -- 0:00:35
573000 -- [-670.783] (-673.922) (-672.588) (-671.791) * (-671.540) [-673.303] (-671.741) (-671.672) -- 0:00:35
573500 -- (-671.513) [-673.937] (-674.142) (-674.956) * (-675.610) (-673.400) (-671.942) [-674.411] -- 0:00:35
574000 -- (-672.723) [-673.464] (-673.393) (-674.739) * (-670.603) [-674.979] (-671.838) (-671.716) -- 0:00:35
574500 -- (-674.973) [-674.841] (-671.046) (-672.156) * (-672.059) (-672.645) (-673.409) [-674.416] -- 0:00:35
575000 -- (-672.532) (-675.472) [-674.310] (-674.145) * (-677.519) (-672.251) (-671.724) [-673.762] -- 0:00:35
Average standard deviation of split frequencies: 0.009639
575500 -- (-673.567) (-671.291) (-675.081) [-672.897] * (-673.854) (-671.141) (-673.329) [-671.729] -- 0:00:35
576000 -- (-675.311) [-671.664] (-676.091) (-675.712) * (-672.059) (-671.129) (-673.477) [-673.428] -- 0:00:35
576500 -- (-673.947) (-672.036) [-672.667] (-673.503) * [-671.394] (-672.182) (-672.383) (-672.516) -- 0:00:35
577000 -- [-673.131] (-670.799) (-672.449) (-679.490) * (-671.072) (-674.334) [-672.784] (-673.110) -- 0:00:35
577500 -- [-671.798] (-673.647) (-673.222) (-673.762) * (-673.342) (-670.974) (-672.565) [-670.732] -- 0:00:35
578000 -- (-674.314) (-677.515) (-673.595) [-675.303] * (-673.427) (-674.155) (-673.613) [-671.729] -- 0:00:35
578500 -- [-673.112] (-672.056) (-671.713) (-675.850) * [-673.213] (-671.244) (-671.563) (-672.906) -- 0:00:34
579000 -- (-674.186) (-671.719) [-673.338] (-671.650) * (-672.211) [-670.846] (-674.091) (-673.414) -- 0:00:34
579500 -- (-673.147) [-674.505] (-673.333) (-674.394) * (-671.952) [-674.486] (-672.557) (-672.629) -- 0:00:34
580000 -- (-671.345) (-673.996) (-672.629) [-670.765] * (-674.147) (-671.613) [-672.855] (-673.345) -- 0:00:34
Average standard deviation of split frequencies: 0.009169
580500 -- [-675.184] (-674.395) (-671.304) (-672.864) * [-673.014] (-674.921) (-673.823) (-671.708) -- 0:00:34
581000 -- (-675.825) [-673.926] (-671.173) (-674.259) * [-673.376] (-671.553) (-673.695) (-672.745) -- 0:00:34
581500 -- (-671.508) (-675.194) [-671.254] (-674.625) * [-674.554] (-671.917) (-671.626) (-673.931) -- 0:00:34
582000 -- (-677.830) (-673.502) (-673.302) [-673.399] * [-671.434] (-673.650) (-673.718) (-671.581) -- 0:00:34
582500 -- (-682.162) (-671.246) (-675.615) [-671.253] * (-672.793) (-672.458) (-674.172) [-672.760] -- 0:00:34
583000 -- (-682.208) (-671.692) [-672.491] (-673.988) * (-670.844) (-671.354) (-672.211) [-672.318] -- 0:00:35
583500 -- (-673.803) (-673.645) [-671.770] (-673.032) * (-671.497) (-675.760) [-672.069] (-671.339) -- 0:00:34
584000 -- (-672.508) (-678.491) [-675.761] (-671.261) * (-673.606) (-672.777) [-672.216] (-671.215) -- 0:00:34
584500 -- (-671.251) (-673.237) (-671.900) [-671.429] * (-672.915) (-672.840) (-672.407) [-672.288] -- 0:00:34
585000 -- [-673.957] (-674.949) (-672.933) (-674.629) * [-674.867] (-674.862) (-679.059) (-673.564) -- 0:00:34
Average standard deviation of split frequencies: 0.009475
585500 -- (-674.131) (-674.242) [-671.024] (-671.061) * (-672.428) [-674.335] (-678.056) (-673.322) -- 0:00:34
586000 -- [-670.988] (-673.646) (-671.704) (-671.540) * (-673.432) (-670.881) (-676.606) [-676.541] -- 0:00:34
586500 -- (-671.375) (-671.770) [-671.891] (-676.735) * [-671.933] (-672.559) (-673.992) (-671.713) -- 0:00:34
587000 -- (-671.550) [-676.389] (-672.306) (-675.992) * [-673.996] (-672.960) (-674.501) (-674.391) -- 0:00:34
587500 -- (-671.327) (-670.766) [-672.274] (-671.896) * [-675.807] (-677.282) (-671.791) (-673.366) -- 0:00:34
588000 -- (-672.036) (-671.995) (-672.255) [-675.981] * (-673.132) [-673.780] (-672.863) (-674.569) -- 0:00:34
588500 -- [-673.875] (-671.218) (-671.909) (-673.092) * [-672.149] (-671.643) (-673.025) (-672.485) -- 0:00:34
589000 -- (-673.872) (-673.251) (-674.168) [-672.941] * (-673.217) [-672.311] (-672.825) (-672.533) -- 0:00:34
589500 -- (-675.722) (-671.378) [-673.562] (-672.216) * (-672.014) (-672.465) [-671.972] (-674.911) -- 0:00:34
590000 -- [-672.065] (-674.507) (-674.199) (-672.714) * (-674.297) (-673.428) (-673.483) [-675.283] -- 0:00:34
Average standard deviation of split frequencies: 0.009444
590500 -- [-672.267] (-674.301) (-671.484) (-674.542) * (-672.193) (-672.384) (-672.037) [-673.256] -- 0:00:33
591000 -- (-675.714) (-673.109) (-673.816) [-671.088] * (-670.933) (-673.629) (-671.704) [-672.962] -- 0:00:33
591500 -- (-671.789) [-671.866] (-674.443) (-673.308) * (-671.064) (-670.873) [-672.356] (-670.813) -- 0:00:33
592000 -- (-673.413) (-673.472) (-674.187) [-676.827] * [-670.772] (-672.918) (-671.856) (-672.436) -- 0:00:33
592500 -- [-677.496] (-674.212) (-675.037) (-679.387) * (-671.053) [-679.463] (-675.116) (-673.220) -- 0:00:33
593000 -- (-673.463) (-672.542) (-673.963) [-676.105] * (-671.169) (-672.902) [-672.671] (-675.610) -- 0:00:33
593500 -- [-671.205] (-671.465) (-676.163) (-672.181) * [-671.917] (-674.102) (-675.063) (-673.291) -- 0:00:33
594000 -- (-672.157) [-671.381] (-674.015) (-672.699) * (-670.903) (-673.766) [-672.652] (-672.535) -- 0:00:33
594500 -- (-672.323) [-673.297] (-673.899) (-671.918) * (-671.427) (-673.212) [-672.205] (-672.984) -- 0:00:33
595000 -- [-676.184] (-673.297) (-673.393) (-679.035) * (-672.789) [-672.372] (-672.892) (-675.577) -- 0:00:33
Average standard deviation of split frequencies: 0.009259
595500 -- (-673.136) (-677.059) [-672.868] (-676.714) * (-672.717) (-671.670) [-671.888] (-672.339) -- 0:00:33
596000 -- (-673.269) (-680.477) (-673.260) [-677.993] * (-673.501) (-672.492) [-671.257] (-673.048) -- 0:00:33
596500 -- (-673.564) (-679.336) [-671.035] (-681.293) * (-672.542) (-672.134) [-673.155] (-673.375) -- 0:00:33
597000 -- (-674.085) (-672.233) [-670.592] (-673.048) * (-672.444) (-671.168) [-673.794] (-672.915) -- 0:00:33
597500 -- (-672.507) (-672.538) [-673.395] (-677.173) * (-672.497) [-672.404] (-676.216) (-671.773) -- 0:00:33
598000 -- (-672.323) (-673.497) [-672.784] (-672.083) * (-672.373) [-672.783] (-674.725) (-671.350) -- 0:00:33
598500 -- (-672.304) (-671.311) (-679.455) [-670.779] * [-673.707] (-671.339) (-675.495) (-672.020) -- 0:00:33
599000 -- (-671.878) [-674.265] (-675.931) (-675.237) * (-672.119) [-674.220] (-673.200) (-671.991) -- 0:00:33
599500 -- (-676.084) (-672.634) [-675.345] (-671.363) * (-671.270) (-672.384) (-671.591) [-671.670] -- 0:00:33
600000 -- [-675.097] (-672.579) (-672.077) (-676.288) * (-672.838) [-671.466] (-672.528) (-672.271) -- 0:00:33
Average standard deviation of split frequencies: 0.009464
600500 -- (-675.218) [-672.073] (-671.333) (-673.435) * (-673.975) (-672.783) (-672.805) [-673.683] -- 0:00:33
601000 -- [-672.224] (-671.583) (-677.641) (-676.691) * (-673.286) (-671.167) (-676.142) [-676.297] -- 0:00:33
601500 -- [-673.696] (-672.277) (-674.021) (-679.763) * (-674.552) [-670.590] (-672.785) (-679.477) -- 0:00:33
602000 -- (-680.445) [-671.911] (-675.362) (-674.075) * (-672.719) (-671.884) [-671.332] (-675.881) -- 0:00:33
602500 -- (-676.385) (-674.318) (-680.831) [-672.671] * [-674.787] (-674.075) (-674.077) (-675.420) -- 0:00:32
603000 -- [-672.149] (-672.361) (-674.378) (-674.128) * (-674.773) (-672.634) (-673.728) [-673.652] -- 0:00:32
603500 -- [-672.462] (-676.174) (-673.529) (-674.081) * [-673.078] (-672.387) (-674.053) (-672.116) -- 0:00:32
604000 -- (-671.857) (-672.749) [-672.488] (-674.870) * (-671.268) [-674.220] (-672.400) (-672.115) -- 0:00:32
604500 -- (-673.604) (-670.875) [-672.717] (-674.266) * (-672.148) (-674.800) (-671.404) [-673.411] -- 0:00:32
605000 -- (-672.380) (-671.439) [-672.168] (-671.037) * (-672.271) (-675.358) [-673.881] (-672.868) -- 0:00:32
Average standard deviation of split frequencies: 0.009564
605500 -- (-673.590) [-673.007] (-670.858) (-673.908) * [-670.920] (-670.591) (-673.284) (-672.716) -- 0:00:32
606000 -- (-672.232) (-673.201) [-670.948] (-672.637) * (-673.928) [-670.593] (-673.882) (-671.784) -- 0:00:32
606500 -- [-672.393] (-672.572) (-674.185) (-677.776) * [-674.517] (-673.222) (-673.386) (-672.491) -- 0:00:32
607000 -- (-675.831) [-671.408] (-672.306) (-673.427) * [-671.430] (-672.424) (-671.543) (-671.022) -- 0:00:32
607500 -- (-676.862) (-672.247) [-671.867] (-673.705) * [-671.208] (-672.826) (-671.196) (-670.926) -- 0:00:32
608000 -- (-673.078) (-672.112) [-675.929] (-672.675) * (-679.024) [-672.313] (-672.047) (-672.005) -- 0:00:32
608500 -- (-672.475) (-673.434) [-676.718] (-671.711) * [-671.966] (-673.895) (-671.459) (-677.382) -- 0:00:32
609000 -- (-674.326) (-674.535) [-678.471] (-670.999) * (-671.321) (-672.309) (-678.053) [-677.452] -- 0:00:32
609500 -- (-673.577) [-672.064] (-674.782) (-673.445) * (-671.254) (-676.370) [-672.745] (-672.439) -- 0:00:32
610000 -- (-674.051) [-671.664] (-674.989) (-671.975) * [-671.254] (-672.275) (-673.859) (-673.252) -- 0:00:32
Average standard deviation of split frequencies: 0.009354
610500 -- (-673.887) [-671.783] (-679.544) (-670.837) * [-671.806] (-676.909) (-674.100) (-674.647) -- 0:00:32
611000 -- [-675.327] (-671.982) (-675.616) (-670.917) * [-673.544] (-677.082) (-673.616) (-672.721) -- 0:00:32
611500 -- (-672.434) (-674.392) [-673.198] (-672.775) * (-673.421) (-671.969) [-673.678] (-674.691) -- 0:00:32
612000 -- (-670.868) [-672.429] (-670.883) (-672.316) * [-671.249] (-673.967) (-675.153) (-674.002) -- 0:00:32
612500 -- (-673.488) (-671.511) [-671.751] (-671.529) * (-672.677) (-678.939) [-673.063] (-673.945) -- 0:00:32
613000 -- [-673.035] (-671.693) (-670.892) (-672.763) * [-673.597] (-673.620) (-672.226) (-670.948) -- 0:00:32
613500 -- (-671.250) [-672.081] (-671.676) (-672.270) * (-675.783) (-672.889) [-672.467] (-673.361) -- 0:00:32
614000 -- (-671.070) [-672.419] (-672.884) (-671.822) * (-671.566) (-673.330) [-673.311] (-671.780) -- 0:00:32
614500 -- [-671.047] (-671.987) (-670.706) (-672.323) * [-675.219] (-673.554) (-673.207) (-672.894) -- 0:00:31
615000 -- [-671.841] (-672.775) (-670.612) (-672.040) * [-673.697] (-674.323) (-672.318) (-674.863) -- 0:00:31
Average standard deviation of split frequencies: 0.009228
615500 -- (-671.842) (-674.412) [-674.571] (-677.350) * (-673.742) (-678.527) (-676.595) [-670.862] -- 0:00:31
616000 -- (-675.659) [-674.786] (-673.607) (-675.600) * (-671.205) (-673.077) [-671.381] (-671.160) -- 0:00:31
616500 -- (-674.747) [-670.918] (-672.025) (-672.395) * [-673.511] (-678.527) (-671.964) (-671.415) -- 0:00:31
617000 -- (-672.587) [-670.918] (-671.108) (-671.798) * (-675.112) (-678.928) (-674.624) [-672.199] -- 0:00:31
617500 -- (-674.558) (-673.182) [-671.323] (-674.731) * [-671.820] (-672.549) (-671.837) (-676.473) -- 0:00:31
618000 -- [-671.736] (-673.150) (-671.699) (-672.069) * [-672.162] (-672.465) (-676.971) (-671.206) -- 0:00:31
618500 -- [-673.747] (-676.434) (-673.115) (-671.835) * (-672.435) (-674.340) [-674.952] (-677.510) -- 0:00:31
619000 -- (-674.038) (-677.245) [-674.453] (-672.791) * (-672.419) (-672.231) (-673.058) [-676.333] -- 0:00:31
619500 -- (-673.067) (-674.052) [-672.488] (-672.343) * [-673.661] (-673.261) (-671.772) (-672.223) -- 0:00:31
620000 -- (-673.960) (-671.642) [-672.246] (-676.108) * (-676.005) (-671.430) (-671.517) [-670.948] -- 0:00:31
Average standard deviation of split frequencies: 0.009410
620500 -- (-674.555) (-673.254) (-673.150) [-675.385] * (-672.046) (-674.737) (-678.725) [-671.311] -- 0:00:31
621000 -- (-671.294) (-671.638) (-672.722) [-673.414] * (-672.617) (-677.919) (-674.516) [-672.247] -- 0:00:31
621500 -- (-673.974) (-673.110) [-673.667] (-670.945) * [-673.710] (-679.232) (-671.137) (-671.690) -- 0:00:31
622000 -- (-673.455) (-674.232) (-674.023) [-671.237] * (-674.060) (-674.734) [-670.763] (-671.805) -- 0:00:31
622500 -- (-671.669) (-673.341) [-671.546] (-672.618) * (-670.751) (-674.581) [-671.733] (-673.267) -- 0:00:31
623000 -- (-671.262) (-679.403) [-672.492] (-672.649) * (-674.193) [-670.926] (-672.311) (-675.735) -- 0:00:31
623500 -- (-671.663) (-675.556) (-675.133) [-671.120] * [-672.751] (-672.004) (-672.417) (-676.531) -- 0:00:31
624000 -- [-671.972] (-672.886) (-675.531) (-672.158) * (-673.352) (-676.876) (-671.834) [-672.348] -- 0:00:31
624500 -- (-672.580) [-672.640] (-672.928) (-684.060) * (-677.355) (-675.919) (-673.932) [-673.036] -- 0:00:31
625000 -- (-673.474) [-671.965] (-673.242) (-673.837) * (-678.357) [-671.797] (-673.982) (-677.404) -- 0:00:31
Average standard deviation of split frequencies: 0.009204
625500 -- [-671.130] (-673.590) (-672.355) (-678.649) * (-679.853) (-672.743) (-671.144) [-672.669] -- 0:00:31
626000 -- (-672.112) (-674.028) [-672.309] (-677.575) * (-675.814) (-672.712) [-671.585] (-674.765) -- 0:00:31
626500 -- (-672.138) (-675.456) (-673.827) [-671.586] * (-673.181) [-672.085] (-671.106) (-672.690) -- 0:00:31
627000 -- (-672.111) (-678.130) (-675.881) [-673.444] * (-676.874) [-671.654] (-671.498) (-675.714) -- 0:00:30
627500 -- (-671.668) (-670.641) [-672.421] (-674.582) * [-673.368] (-670.851) (-673.305) (-674.098) -- 0:00:30
628000 -- (-672.927) [-672.212] (-671.780) (-677.704) * [-670.700] (-671.114) (-671.387) (-673.313) -- 0:00:30
628500 -- (-672.782) (-675.992) (-674.348) [-671.898] * (-672.312) [-671.252] (-671.519) (-672.344) -- 0:00:30
629000 -- (-676.315) (-671.653) (-672.637) [-674.519] * (-671.314) (-671.751) (-671.915) [-673.361] -- 0:00:30
629500 -- [-676.256] (-672.383) (-672.471) (-671.854) * (-671.288) (-672.665) (-674.694) [-672.987] -- 0:00:30
630000 -- (-670.936) (-674.260) (-672.034) [-672.709] * (-670.871) (-672.776) (-674.444) [-672.602] -- 0:00:30
Average standard deviation of split frequencies: 0.009509
630500 -- [-672.490] (-672.647) (-674.524) (-675.772) * (-672.451) [-671.029] (-674.241) (-672.230) -- 0:00:30
631000 -- [-674.163] (-673.641) (-672.355) (-673.294) * (-672.892) (-671.291) (-671.355) [-671.378] -- 0:00:30
631500 -- (-671.871) (-672.075) (-673.731) [-672.572] * (-672.378) (-671.910) [-674.348] (-679.861) -- 0:00:30
632000 -- (-672.891) (-676.367) [-671.358] (-672.558) * (-671.489) (-673.849) (-674.045) [-673.480] -- 0:00:30
632500 -- (-672.548) (-672.807) (-673.034) [-671.432] * (-672.346) (-671.381) (-673.573) [-672.456] -- 0:00:30
633000 -- (-679.211) (-676.414) (-672.790) [-671.052] * (-673.818) (-672.370) (-674.432) [-671.359] -- 0:00:30
633500 -- (-672.819) (-675.549) [-676.779] (-673.806) * (-673.146) (-672.729) (-672.588) [-671.177] -- 0:00:30
634000 -- (-672.785) (-679.701) (-677.138) [-676.610] * (-671.685) [-672.488] (-673.151) (-671.765) -- 0:00:30
634500 -- (-672.921) (-679.444) (-674.762) [-675.341] * (-671.659) [-671.848] (-674.051) (-672.195) -- 0:00:30
635000 -- [-672.378] (-678.421) (-672.295) (-675.313) * [-673.355] (-676.877) (-674.889) (-675.737) -- 0:00:30
Average standard deviation of split frequencies: 0.009594
635500 -- [-671.326] (-672.735) (-670.750) (-673.712) * [-674.615] (-672.656) (-672.365) (-674.579) -- 0:00:30
636000 -- (-674.526) (-672.078) (-671.824) [-670.671] * [-672.123] (-673.291) (-676.512) (-673.301) -- 0:00:30
636500 -- (-671.058) (-672.331) [-672.093] (-671.963) * (-671.958) [-672.248] (-673.377) (-674.307) -- 0:00:30
637000 -- (-672.450) (-672.188) (-671.438) [-672.036] * (-672.454) (-672.004) [-676.623] (-677.156) -- 0:00:30
637500 -- (-672.813) (-673.718) (-672.371) [-671.835] * (-671.759) (-671.600) (-675.369) [-674.871] -- 0:00:30
638000 -- [-673.398] (-673.297) (-672.371) (-671.805) * (-673.103) (-671.522) (-674.528) [-671.755] -- 0:00:30
638500 -- (-674.007) (-672.545) [-673.437] (-671.654) * [-676.028] (-674.035) (-673.872) (-672.194) -- 0:00:30
639000 -- [-679.781] (-674.554) (-671.715) (-673.314) * (-671.881) (-671.771) (-675.231) [-671.009] -- 0:00:29
639500 -- (-674.142) (-671.140) [-676.236] (-670.886) * (-674.299) (-674.808) (-673.193) [-671.007] -- 0:00:29
640000 -- (-672.083) [-672.027] (-671.828) (-671.455) * (-673.669) (-678.752) (-671.166) [-674.850] -- 0:00:29
Average standard deviation of split frequencies: 0.008911
640500 -- (-676.402) (-673.058) (-671.979) [-670.804] * (-674.135) (-672.292) [-670.917] (-677.788) -- 0:00:29
641000 -- (-674.208) (-673.280) (-671.810) [-670.961] * (-672.969) [-676.573] (-674.163) (-676.602) -- 0:00:29
641500 -- (-678.990) (-672.773) [-671.622] (-671.478) * [-671.392] (-673.479) (-675.943) (-672.936) -- 0:00:29
642000 -- [-673.645] (-672.346) (-671.626) (-674.085) * (-674.603) (-672.090) (-671.059) [-673.425] -- 0:00:29
642500 -- (-673.198) (-671.535) [-673.241] (-673.845) * (-673.272) (-677.574) [-673.936] (-674.482) -- 0:00:29
643000 -- [-671.136] (-681.782) (-671.764) (-674.984) * [-670.537] (-681.518) (-674.429) (-671.002) -- 0:00:29
643500 -- (-675.425) [-672.765] (-673.487) (-672.885) * [-671.644] (-677.598) (-677.100) (-675.556) -- 0:00:29
644000 -- [-672.562] (-673.768) (-671.834) (-676.517) * [-673.049] (-671.944) (-673.020) (-673.131) -- 0:00:29
644500 -- (-672.683) [-672.313] (-671.570) (-673.199) * (-671.120) (-670.722) (-671.796) [-671.416] -- 0:00:29
645000 -- (-674.451) [-671.942] (-672.277) (-675.331) * (-674.399) [-673.606] (-671.861) (-677.453) -- 0:00:29
Average standard deviation of split frequencies: 0.008554
645500 -- (-680.695) [-670.947] (-672.718) (-673.654) * (-675.458) [-672.719] (-671.897) (-673.480) -- 0:00:29
646000 -- (-676.083) (-672.773) (-671.858) [-671.339] * [-671.779] (-673.226) (-672.436) (-674.243) -- 0:00:29
646500 -- (-673.105) (-673.152) [-672.505] (-672.945) * [-673.258] (-671.077) (-672.323) (-672.516) -- 0:00:29
647000 -- (-676.119) (-672.685) (-673.362) [-674.662] * [-671.410] (-671.605) (-673.001) (-674.903) -- 0:00:29
647500 -- (-673.455) [-674.497] (-675.456) (-672.905) * [-673.626] (-672.640) (-674.666) (-672.037) -- 0:00:29
648000 -- [-671.418] (-671.518) (-671.474) (-672.414) * (-672.968) (-673.160) [-671.469] (-672.451) -- 0:00:29
648500 -- (-672.384) [-674.416] (-671.091) (-674.778) * (-673.563) (-674.886) [-674.131] (-672.249) -- 0:00:29
649000 -- (-673.308) [-672.173] (-673.034) (-674.030) * (-673.068) [-670.670] (-673.434) (-670.824) -- 0:00:29
649500 -- (-672.534) [-671.541] (-674.621) (-671.992) * (-673.331) (-672.395) (-671.875) [-672.356] -- 0:00:29
650000 -- [-673.186] (-673.162) (-672.703) (-672.899) * [-675.109] (-673.194) (-671.720) (-671.150) -- 0:00:29
Average standard deviation of split frequencies: 0.008895
650500 -- [-672.774] (-676.623) (-671.918) (-675.121) * [-670.990] (-673.521) (-676.867) (-672.468) -- 0:00:29
651000 -- [-671.113] (-674.224) (-671.322) (-672.125) * (-673.404) [-673.386] (-671.152) (-672.179) -- 0:00:28
651500 -- (-671.712) (-671.365) (-670.959) [-671.563] * (-673.836) (-671.903) (-674.341) [-673.129] -- 0:00:28
652000 -- [-672.778] (-674.196) (-671.692) (-672.886) * [-672.162] (-672.718) (-673.425) (-676.312) -- 0:00:28
652500 -- [-674.400] (-672.547) (-671.545) (-672.712) * (-672.651) [-672.834] (-671.607) (-673.731) -- 0:00:28
653000 -- (-673.553) (-674.973) (-673.529) [-671.846] * [-675.752] (-673.713) (-673.211) (-673.153) -- 0:00:28
653500 -- (-672.548) (-671.650) (-672.498) [-670.855] * (-672.272) (-674.183) [-673.816] (-674.278) -- 0:00:28
654000 -- (-672.723) (-672.821) (-671.843) [-671.020] * (-673.061) (-672.597) [-671.301] (-676.130) -- 0:00:28
654500 -- (-674.383) (-671.343) (-672.354) [-671.130] * (-671.500) [-672.853] (-676.838) (-674.286) -- 0:00:28
655000 -- (-678.142) [-671.125] (-677.147) (-673.464) * (-671.440) (-672.935) [-672.147] (-672.808) -- 0:00:28
Average standard deviation of split frequencies: 0.009062
655500 -- (-676.450) (-677.512) (-670.867) [-672.761] * (-676.957) [-672.853] (-672.305) (-672.015) -- 0:00:28
656000 -- [-674.464] (-674.325) (-671.230) (-674.191) * (-673.817) (-674.107) (-671.299) [-672.664] -- 0:00:28
656500 -- [-672.144] (-672.562) (-672.016) (-673.664) * [-673.185] (-678.050) (-672.056) (-671.803) -- 0:00:28
657000 -- [-671.384] (-673.431) (-673.506) (-672.153) * (-671.879) (-675.125) [-672.925] (-671.094) -- 0:00:28
657500 -- (-673.398) (-673.594) [-672.171] (-672.828) * (-672.356) (-671.953) [-674.358] (-671.265) -- 0:00:28
658000 -- (-675.521) [-673.252] (-677.058) (-671.847) * (-673.895) (-671.793) [-674.942] (-672.248) -- 0:00:28
658500 -- (-672.755) [-672.888] (-676.144) (-673.412) * [-671.587] (-675.588) (-678.101) (-672.487) -- 0:00:28
659000 -- (-671.626) (-673.271) [-671.570] (-673.826) * (-674.354) (-671.696) [-680.394] (-675.510) -- 0:00:28
659500 -- [-671.390] (-674.776) (-672.516) (-672.155) * [-670.672] (-672.757) (-679.226) (-674.398) -- 0:00:28
660000 -- [-672.038] (-671.440) (-671.836) (-671.305) * (-671.608) [-672.894] (-673.075) (-672.519) -- 0:00:28
Average standard deviation of split frequencies: 0.008562
660500 -- (-672.779) (-673.808) [-673.003] (-670.984) * (-673.316) [-672.923] (-673.327) (-674.226) -- 0:00:28
661000 -- (-672.950) [-675.265] (-674.110) (-673.378) * [-673.428] (-671.940) (-672.611) (-671.931) -- 0:00:28
661500 -- (-672.014) [-671.560] (-674.066) (-673.475) * [-673.223] (-676.330) (-676.819) (-674.848) -- 0:00:28
662000 -- (-672.924) (-672.687) (-671.380) [-673.273] * (-672.901) [-675.901] (-679.180) (-673.319) -- 0:00:28
662500 -- (-675.496) (-672.361) [-670.701] (-672.408) * (-671.197) [-673.639] (-671.495) (-673.642) -- 0:00:28
663000 -- [-672.929] (-671.067) (-670.541) (-672.443) * (-673.198) (-672.071) (-678.723) [-672.312] -- 0:00:27
663500 -- (-673.290) (-671.096) [-670.692] (-671.748) * [-674.132] (-672.899) (-672.807) (-674.250) -- 0:00:27
664000 -- (-674.525) [-673.072] (-671.855) (-673.164) * (-672.425) (-675.731) [-674.478] (-672.751) -- 0:00:27
664500 -- (-675.223) (-671.993) (-675.765) [-671.598] * (-671.532) (-674.589) (-671.552) [-672.664] -- 0:00:27
665000 -- (-677.214) (-671.884) [-673.383] (-671.994) * [-671.072] (-673.564) (-671.613) (-672.655) -- 0:00:27
Average standard deviation of split frequencies: 0.008651
665500 -- (-672.943) [-672.183] (-678.517) (-674.325) * (-672.750) (-672.669) [-674.400] (-670.913) -- 0:00:27
666000 -- [-673.486] (-673.356) (-673.205) (-673.421) * (-679.049) [-673.471] (-672.213) (-671.495) -- 0:00:27
666500 -- [-671.780] (-672.115) (-672.390) (-672.555) * (-675.919) (-675.418) [-672.413] (-675.623) -- 0:00:27
667000 -- (-671.676) [-673.459] (-672.514) (-670.653) * [-672.426] (-674.187) (-675.274) (-672.299) -- 0:00:27
667500 -- (-671.687) (-672.007) [-673.177] (-672.240) * [-672.753] (-674.730) (-671.859) (-677.493) -- 0:00:27
668000 -- (-671.952) (-671.718) [-672.560] (-674.714) * (-673.924) [-670.891] (-672.175) (-675.025) -- 0:00:27
668500 -- (-672.263) (-672.335) [-676.124] (-670.856) * [-673.261] (-672.044) (-671.670) (-671.725) -- 0:00:27
669000 -- (-674.671) (-677.622) [-673.332] (-672.938) * (-673.078) [-673.218] (-670.811) (-676.344) -- 0:00:27
669500 -- (-680.534) [-675.654] (-672.233) (-672.700) * (-674.384) (-672.278) (-675.414) [-673.414] -- 0:00:27
670000 -- [-673.224] (-672.886) (-674.399) (-671.144) * (-681.637) (-670.621) (-676.345) [-672.801] -- 0:00:27
Average standard deviation of split frequencies: 0.008630
670500 -- [-670.695] (-673.084) (-674.276) (-672.797) * (-676.342) [-671.832] (-671.679) (-674.312) -- 0:00:27
671000 -- (-670.665) [-672.199] (-674.870) (-672.195) * (-673.593) (-674.592) [-672.471] (-674.365) -- 0:00:27
671500 -- (-673.880) (-672.290) (-671.539) [-671.565] * (-680.097) (-671.637) (-672.845) [-672.415] -- 0:00:27
672000 -- (-670.862) [-673.894] (-670.902) (-670.758) * (-672.177) (-671.543) [-671.499] (-671.806) -- 0:00:27
672500 -- (-671.258) (-675.184) (-672.851) [-672.520] * (-672.006) (-671.381) [-671.654] (-673.902) -- 0:00:27
673000 -- (-671.163) (-672.649) (-673.755) [-671.147] * (-671.683) (-674.567) (-673.969) [-673.583] -- 0:00:27
673500 -- (-671.742) (-672.095) (-672.708) [-672.262] * [-673.078] (-673.298) (-671.097) (-675.171) -- 0:00:27
674000 -- [-671.821] (-671.461) (-673.461) (-672.456) * [-672.636] (-672.884) (-672.504) (-673.511) -- 0:00:27
674500 -- (-672.221) (-671.399) [-671.062] (-676.969) * [-675.568] (-671.892) (-672.445) (-671.110) -- 0:00:27
675000 -- [-672.147] (-671.947) (-674.729) (-672.020) * (-676.127) [-675.613] (-671.038) (-671.768) -- 0:00:26
Average standard deviation of split frequencies: 0.008252
675500 -- (-670.869) (-677.182) (-674.926) [-676.406] * (-673.521) (-674.613) [-671.078] (-671.310) -- 0:00:26
676000 -- (-671.223) (-672.079) (-673.791) [-671.999] * (-671.452) [-672.324] (-671.023) (-671.669) -- 0:00:26
676500 -- [-673.858] (-670.907) (-676.063) (-673.048) * (-674.262) (-673.930) (-671.566) [-672.364] -- 0:00:26
677000 -- (-673.683) (-670.971) [-672.626] (-673.375) * (-672.556) [-674.321] (-671.559) (-672.844) -- 0:00:26
677500 -- (-673.311) (-672.542) (-675.635) [-677.755] * (-672.664) (-672.480) [-671.518] (-672.892) -- 0:00:26
678000 -- (-673.587) (-672.385) [-674.130] (-671.753) * (-672.649) (-674.015) [-673.299] (-673.818) -- 0:00:26
678500 -- (-672.120) (-671.190) (-680.353) [-672.140] * (-673.748) (-675.243) [-672.599] (-671.154) -- 0:00:26
679000 -- (-672.346) (-671.969) [-673.494] (-671.599) * (-678.732) (-672.335) (-671.101) [-670.862] -- 0:00:26
679500 -- (-675.116) (-675.822) [-672.907] (-672.916) * (-671.387) (-673.055) (-672.172) [-670.867] -- 0:00:26
680000 -- (-672.492) (-672.913) [-672.281] (-674.425) * (-673.481) [-674.498] (-671.484) (-674.928) -- 0:00:26
Average standard deviation of split frequencies: 0.008542
680500 -- (-671.767) (-675.645) [-671.244] (-672.906) * (-673.125) [-670.782] (-670.698) (-672.893) -- 0:00:26
681000 -- [-672.947] (-672.624) (-674.280) (-670.686) * [-673.082] (-671.167) (-670.545) (-672.687) -- 0:00:26
681500 -- (-675.563) (-672.233) [-674.293] (-672.930) * [-673.642] (-671.922) (-676.076) (-676.470) -- 0:00:26
682000 -- (-672.721) [-672.691] (-674.418) (-675.912) * (-677.167) (-676.135) [-671.271] (-673.126) -- 0:00:26
682500 -- [-671.801] (-670.888) (-672.596) (-672.191) * (-673.578) (-677.053) (-671.636) [-672.439] -- 0:00:26
683000 -- (-671.392) [-671.712] (-670.931) (-675.176) * [-672.295] (-672.556) (-673.117) (-672.588) -- 0:00:26
683500 -- (-672.291) [-671.635] (-672.101) (-673.658) * (-671.924) (-670.970) (-672.698) [-672.396] -- 0:00:26
684000 -- (-672.069) (-671.886) (-672.031) [-672.668] * (-673.012) (-673.043) [-672.423] (-675.276) -- 0:00:26
684500 -- (-672.573) (-672.030) (-673.413) [-673.228] * (-671.598) (-673.967) [-671.018] (-674.445) -- 0:00:26
685000 -- (-674.681) [-671.247] (-671.721) (-673.977) * (-671.125) (-671.183) [-671.780] (-672.332) -- 0:00:26
Average standard deviation of split frequencies: 0.008132
685500 -- (-672.857) [-675.462] (-672.857) (-673.726) * (-674.867) [-672.419] (-674.754) (-673.598) -- 0:00:26
686000 -- [-672.846] (-671.477) (-673.938) (-673.658) * [-671.948] (-675.098) (-672.135) (-672.403) -- 0:00:26
686500 -- [-671.903] (-672.049) (-673.174) (-673.282) * (-675.852) (-673.115) [-673.804] (-674.198) -- 0:00:26
687000 -- (-675.591) [-675.147] (-673.974) (-671.310) * (-673.237) (-674.296) [-675.849] (-675.583) -- 0:00:25
687500 -- [-673.888] (-672.411) (-675.044) (-673.218) * (-671.953) (-674.849) [-672.630] (-674.020) -- 0:00:25
688000 -- [-671.182] (-670.987) (-675.024) (-672.573) * (-672.437) (-673.739) (-673.914) [-672.930] -- 0:00:25
688500 -- (-672.807) (-673.334) (-677.158) [-672.983] * (-673.264) (-673.330) (-676.350) [-672.218] -- 0:00:25
689000 -- (-673.075) (-672.420) (-672.586) [-672.731] * (-670.621) [-672.329] (-672.717) (-673.307) -- 0:00:25
689500 -- (-673.264) [-679.022] (-674.948) (-673.043) * (-670.921) (-673.279) [-670.960] (-672.114) -- 0:00:25
690000 -- (-671.560) (-673.955) (-676.019) [-673.315] * (-673.128) (-670.970) [-673.067] (-671.686) -- 0:00:25
Average standard deviation of split frequencies: 0.007887
690500 -- [-671.824] (-676.773) (-674.540) (-671.484) * (-673.349) (-671.391) [-670.993] (-673.614) -- 0:00:25
691000 -- (-674.136) (-678.204) (-671.223) [-671.215] * (-672.721) (-671.098) (-671.716) [-671.933] -- 0:00:25
691500 -- [-672.319] (-674.320) (-671.794) (-671.617) * [-671.388] (-670.881) (-673.804) (-674.656) -- 0:00:25
692000 -- [-673.370] (-671.711) (-671.513) (-674.305) * (-672.640) (-672.291) (-675.980) [-672.771] -- 0:00:25
692500 -- (-673.276) (-673.068) (-675.924) [-673.048] * (-671.862) (-675.065) [-676.600] (-672.921) -- 0:00:25
693000 -- (-672.943) [-675.212] (-671.706) (-673.708) * (-672.300) [-673.196] (-672.320) (-673.433) -- 0:00:25
693500 -- (-672.796) (-672.540) [-674.536] (-672.856) * (-673.982) [-672.187] (-676.185) (-673.375) -- 0:00:25
694000 -- [-672.282] (-672.423) (-673.602) (-672.313) * (-673.438) (-672.603) (-674.489) [-674.656] -- 0:00:25
694500 -- (-672.220) (-672.457) (-673.625) [-671.247] * (-673.137) (-675.432) [-672.031] (-675.299) -- 0:00:25
695000 -- (-673.696) (-671.423) (-675.484) [-671.979] * (-672.983) [-671.707] (-671.841) (-673.146) -- 0:00:25
Average standard deviation of split frequencies: 0.008606
695500 -- (-674.368) (-672.019) (-677.238) [-677.761] * (-674.348) [-670.921] (-671.684) (-672.542) -- 0:00:25
696000 -- (-671.348) [-672.888] (-675.029) (-672.928) * (-673.552) (-672.912) (-673.029) [-671.864] -- 0:00:25
696500 -- (-671.633) [-672.574] (-675.417) (-672.588) * (-674.144) (-675.087) [-672.922] (-673.982) -- 0:00:25
697000 -- (-671.214) (-671.146) (-679.961) [-672.900] * (-674.129) [-672.946] (-672.626) (-675.200) -- 0:00:25
697500 -- [-673.732] (-671.145) (-676.308) (-671.026) * [-673.273] (-674.224) (-672.766) (-672.895) -- 0:00:25
698000 -- (-677.606) [-671.973] (-672.451) (-676.539) * (-673.139) (-673.402) [-672.916] (-672.466) -- 0:00:25
698500 -- (-674.434) [-673.924] (-674.727) (-680.359) * [-673.724] (-672.396) (-672.301) (-671.733) -- 0:00:25
699000 -- (-671.975) (-672.259) [-671.804] (-675.106) * (-671.879) (-674.571) (-673.463) [-672.660] -- 0:00:24
699500 -- (-673.881) [-672.074] (-676.337) (-672.034) * (-672.819) [-673.731] (-671.863) (-674.941) -- 0:00:24
700000 -- (-673.005) [-673.653] (-677.610) (-672.646) * [-672.915] (-672.103) (-671.725) (-676.222) -- 0:00:24
Average standard deviation of split frequencies: 0.008271
700500 -- (-670.874) (-673.074) (-672.923) [-673.818] * (-673.183) (-672.202) (-671.397) [-675.263] -- 0:00:24
701000 -- (-672.074) [-671.864] (-678.061) (-671.690) * (-674.746) (-673.358) [-671.934] (-677.812) -- 0:00:24
701500 -- (-673.831) [-672.212] (-674.225) (-674.769) * (-671.014) (-674.602) [-672.694] (-671.796) -- 0:00:24
702000 -- [-671.691] (-671.411) (-671.198) (-672.730) * (-673.774) (-672.666) (-673.469) [-672.538] -- 0:00:24
702500 -- (-674.107) (-671.068) (-675.677) [-672.437] * (-673.994) (-674.093) (-673.068) [-672.547] -- 0:00:24
703000 -- (-673.321) [-672.001] (-673.494) (-673.506) * [-670.884] (-675.043) (-673.926) (-672.880) -- 0:00:24
703500 -- [-675.111] (-673.173) (-672.555) (-674.009) * [-672.710] (-672.013) (-673.295) (-674.276) -- 0:00:24
704000 -- (-672.992) (-671.126) (-671.376) [-672.632] * [-670.634] (-673.102) (-675.376) (-673.300) -- 0:00:24
704500 -- [-672.723] (-671.453) (-674.599) (-672.797) * [-673.623] (-670.704) (-676.571) (-674.692) -- 0:00:24
705000 -- (-674.645) (-674.658) [-673.134] (-677.294) * [-674.406] (-671.615) (-671.890) (-675.884) -- 0:00:24
Average standard deviation of split frequencies: 0.008170
705500 -- [-672.963] (-674.209) (-683.604) (-673.097) * (-671.312) (-673.707) [-671.040] (-672.642) -- 0:00:24
706000 -- (-671.524) [-672.708] (-673.562) (-676.658) * [-670.736] (-671.633) (-671.686) (-672.631) -- 0:00:24
706500 -- (-673.166) [-674.204] (-673.715) (-673.650) * (-676.235) [-672.720] (-671.488) (-676.867) -- 0:00:24
707000 -- (-675.677) (-673.598) (-672.554) [-672.560] * (-671.811) (-674.694) (-673.055) [-672.240] -- 0:00:24
707500 -- (-675.049) [-674.457] (-673.233) (-673.691) * (-671.387) (-670.865) [-672.674] (-672.219) -- 0:00:24
708000 -- (-673.138) (-673.537) (-672.512) [-673.690] * [-674.494] (-675.520) (-671.922) (-677.629) -- 0:00:24
708500 -- [-673.202] (-676.432) (-671.680) (-673.182) * (-675.259) (-671.861) [-671.859] (-674.832) -- 0:00:24
709000 -- [-673.467] (-677.766) (-672.279) (-671.612) * (-673.345) (-672.311) [-672.086] (-674.283) -- 0:00:24
709500 -- [-672.881] (-673.017) (-673.671) (-672.315) * (-675.451) (-674.538) [-672.485] (-674.063) -- 0:00:24
710000 -- (-672.927) (-673.917) [-675.932] (-672.735) * (-673.138) (-673.279) [-673.265] (-671.300) -- 0:00:24
Average standard deviation of split frequencies: 0.007843
710500 -- (-672.749) (-676.695) [-672.377] (-670.907) * (-678.313) [-676.321] (-676.026) (-675.330) -- 0:00:24
711000 -- (-672.720) (-672.500) (-673.775) [-672.883] * (-672.667) (-677.003) [-671.651] (-672.045) -- 0:00:23
711500 -- [-673.809] (-670.990) (-671.877) (-672.008) * (-675.519) (-674.266) (-673.546) [-674.008] -- 0:00:23
712000 -- (-671.513) (-671.781) (-672.277) [-672.814] * [-673.136] (-674.013) (-674.236) (-676.501) -- 0:00:23
712500 -- (-674.291) [-670.540] (-671.907) (-673.716) * (-672.228) (-674.023) [-670.825] (-671.378) -- 0:00:23
713000 -- (-674.545) (-670.686) (-671.955) [-672.408] * (-671.641) (-672.071) (-671.635) [-673.014] -- 0:00:23
713500 -- [-671.530] (-671.609) (-673.158) (-675.856) * (-672.757) [-672.852] (-673.531) (-673.922) -- 0:00:23
714000 -- (-672.496) (-675.108) (-675.507) [-671.363] * [-672.800] (-672.591) (-672.619) (-672.897) -- 0:00:23
714500 -- (-672.517) [-673.264] (-672.791) (-673.982) * (-672.318) (-672.985) (-671.788) [-671.689] -- 0:00:23
715000 -- (-671.895) (-676.849) (-674.536) [-673.720] * (-672.252) (-672.106) [-674.837] (-672.762) -- 0:00:23
Average standard deviation of split frequencies: 0.007206
715500 -- [-672.730] (-675.182) (-673.237) (-672.820) * (-673.306) [-671.231] (-673.557) (-674.502) -- 0:00:23
716000 -- [-670.948] (-671.566) (-670.886) (-672.011) * (-671.622) (-672.628) (-672.305) [-673.945] -- 0:00:23
716500 -- [-671.998] (-671.470) (-672.438) (-676.926) * (-673.512) [-670.992] (-671.574) (-671.684) -- 0:00:23
717000 -- (-672.934) (-671.909) (-674.216) [-672.474] * (-674.090) (-672.087) [-674.904] (-672.599) -- 0:00:23
717500 -- (-673.404) (-670.936) (-672.260) [-671.373] * (-675.576) (-675.581) [-673.439] (-674.569) -- 0:00:23
718000 -- (-673.301) [-673.312] (-670.783) (-674.615) * (-671.800) (-672.736) [-671.858] (-672.838) -- 0:00:23
718500 -- (-672.628) [-671.599] (-671.557) (-672.369) * (-671.160) [-674.707] (-675.689) (-671.247) -- 0:00:23
719000 -- [-673.246] (-672.144) (-671.597) (-674.820) * (-672.671) (-674.329) (-673.414) [-672.424] -- 0:00:23
719500 -- [-673.360] (-671.054) (-672.054) (-671.549) * (-672.707) (-674.524) [-673.284] (-671.913) -- 0:00:23
720000 -- (-672.604) (-673.938) [-671.611] (-671.740) * [-673.444] (-675.881) (-673.760) (-672.117) -- 0:00:23
Average standard deviation of split frequencies: 0.007849
720500 -- (-673.947) [-673.973] (-672.545) (-671.575) * (-675.204) (-673.119) [-672.644] (-673.028) -- 0:00:23
721000 -- (-673.492) (-674.523) (-677.121) [-671.576] * (-678.546) [-671.243] (-679.001) (-672.184) -- 0:00:23
721500 -- (-674.479) [-672.693] (-676.399) (-672.740) * [-672.509] (-671.576) (-679.325) (-674.316) -- 0:00:23
722000 -- (-674.189) (-672.471) (-672.932) [-675.257] * (-672.374) (-676.699) (-675.554) [-674.057] -- 0:00:23
722500 -- [-672.347] (-673.554) (-671.624) (-672.269) * (-676.562) [-671.320] (-672.538) (-673.354) -- 0:00:23
723000 -- (-673.021) (-675.105) [-671.939] (-672.298) * (-674.920) (-672.293) (-673.031) [-671.095] -- 0:00:22
723500 -- [-672.245] (-676.193) (-672.725) (-671.926) * [-674.612] (-673.378) (-670.888) (-673.491) -- 0:00:22
724000 -- [-672.554] (-677.829) (-672.902) (-673.657) * (-672.553) (-671.413) [-672.645] (-675.847) -- 0:00:22
724500 -- (-673.219) (-673.175) (-672.440) [-671.639] * [-672.016] (-674.666) (-673.893) (-679.957) -- 0:00:22
725000 -- [-673.063] (-674.798) (-672.568) (-673.605) * (-670.825) (-674.807) (-672.590) [-671.876] -- 0:00:22
Average standard deviation of split frequencies: 0.007410
725500 -- (-676.180) (-675.060) [-677.041] (-673.953) * (-675.237) (-675.183) [-674.473] (-670.924) -- 0:00:22
726000 -- [-672.272] (-671.618) (-671.487) (-672.538) * (-672.144) (-672.032) (-679.043) [-672.851] -- 0:00:22
726500 -- (-673.075) [-673.884] (-672.781) (-673.096) * [-671.291] (-671.905) (-677.133) (-675.233) -- 0:00:22
727000 -- (-672.642) [-670.936] (-670.876) (-671.737) * (-672.940) (-673.843) [-671.203] (-673.440) -- 0:00:22
727500 -- [-672.021] (-671.247) (-671.309) (-674.657) * (-671.003) (-678.196) [-672.269] (-673.931) -- 0:00:22
728000 -- (-672.002) (-671.741) (-672.219) [-672.505] * [-671.627] (-677.516) (-672.370) (-673.921) -- 0:00:22
728500 -- (-681.692) (-675.072) (-670.818) [-672.799] * [-672.067] (-673.022) (-673.041) (-673.783) -- 0:00:22
729000 -- (-678.213) (-672.476) (-671.576) [-672.935] * [-680.437] (-672.167) (-674.591) (-671.803) -- 0:00:22
729500 -- (-672.633) [-673.808] (-680.852) (-675.626) * (-675.687) [-672.601] (-671.249) (-673.046) -- 0:00:22
730000 -- (-672.737) (-676.826) (-675.962) [-672.155] * [-671.445] (-673.188) (-671.671) (-677.677) -- 0:00:22
Average standard deviation of split frequencies: 0.006907
730500 -- (-671.241) (-671.585) (-673.992) [-676.954] * (-670.898) [-672.441] (-673.611) (-672.800) -- 0:00:22
731000 -- (-671.478) (-672.418) [-671.666] (-675.111) * [-671.846] (-674.449) (-671.688) (-671.624) -- 0:00:22
731500 -- [-672.069] (-672.101) (-670.992) (-672.838) * (-672.705) (-671.973) [-672.618] (-671.522) -- 0:00:22
732000 -- [-673.253] (-672.180) (-674.305) (-671.649) * [-671.003] (-672.364) (-675.421) (-673.907) -- 0:00:22
732500 -- (-673.292) [-674.391] (-670.970) (-673.570) * [-671.742] (-674.836) (-674.051) (-676.296) -- 0:00:22
733000 -- (-675.467) [-672.028] (-671.205) (-672.950) * (-675.098) (-671.654) (-673.044) [-673.259] -- 0:00:22
733500 -- (-674.062) [-675.550] (-672.910) (-672.003) * [-673.799] (-676.084) (-673.354) (-673.482) -- 0:00:22
734000 -- (-672.747) (-676.122) (-673.865) [-670.944] * (-673.010) (-672.032) (-673.117) [-672.681] -- 0:00:22
734500 -- [-670.517] (-672.552) (-672.953) (-673.464) * (-671.345) [-671.277] (-673.785) (-675.385) -- 0:00:22
735000 -- (-674.052) [-677.187] (-675.569) (-672.482) * [-672.123] (-670.799) (-671.938) (-672.097) -- 0:00:21
Average standard deviation of split frequencies: 0.007272
735500 -- [-672.151] (-673.023) (-678.103) (-672.300) * (-671.635) (-672.448) (-670.882) [-673.736] -- 0:00:21
736000 -- (-672.809) (-673.107) [-670.742] (-673.748) * [-672.017] (-671.576) (-674.658) (-670.862) -- 0:00:21
736500 -- [-673.657] (-675.500) (-672.484) (-677.370) * (-673.122) (-672.478) (-672.367) [-672.773] -- 0:00:21
737000 -- [-670.894] (-672.900) (-671.525) (-672.564) * (-676.182) (-675.539) [-672.761] (-675.260) -- 0:00:21
737500 -- (-674.162) (-674.624) (-670.574) [-673.340] * (-672.539) [-673.564] (-674.283) (-672.220) -- 0:00:21
738000 -- (-671.408) (-674.053) (-670.836) [-674.680] * (-672.857) [-672.313] (-677.326) (-672.661) -- 0:00:21
738500 -- (-671.366) [-677.371] (-674.265) (-670.974) * [-673.053] (-671.858) (-671.515) (-670.628) -- 0:00:21
739000 -- (-672.015) (-671.553) [-672.527] (-674.403) * [-676.843] (-672.855) (-671.986) (-670.980) -- 0:00:21
739500 -- (-671.356) [-671.232] (-671.338) (-675.840) * [-674.380] (-679.211) (-671.520) (-671.316) -- 0:00:21
740000 -- (-673.978) (-673.409) (-672.900) [-672.288] * (-672.184) [-673.400] (-672.650) (-671.697) -- 0:00:21
Average standard deviation of split frequencies: 0.007240
740500 -- (-672.916) (-672.101) (-677.319) [-672.300] * (-673.029) (-673.727) (-672.052) [-672.758] -- 0:00:21
741000 -- (-672.342) (-675.864) [-677.627] (-673.245) * (-673.454) (-672.433) (-670.910) [-672.220] -- 0:00:21
741500 -- (-674.322) (-676.529) [-673.025] (-672.100) * [-671.040] (-673.376) (-672.175) (-672.350) -- 0:00:21
742000 -- (-675.624) [-677.802] (-672.483) (-675.675) * (-672.710) (-675.303) [-673.955] (-673.779) -- 0:00:21
742500 -- (-671.671) (-680.209) (-671.089) [-679.653] * (-671.864) (-674.513) [-671.918] (-675.861) -- 0:00:21
743000 -- [-671.647] (-672.892) (-676.075) (-675.353) * (-671.731) (-671.614) [-673.407] (-673.140) -- 0:00:21
743500 -- [-672.770] (-670.615) (-676.979) (-671.717) * (-671.644) [-676.137] (-675.023) (-673.639) -- 0:00:21
744000 -- (-673.041) [-675.344] (-679.395) (-672.333) * (-673.869) (-671.582) (-675.934) [-671.918] -- 0:00:21
744500 -- (-674.160) [-675.406] (-674.341) (-672.097) * [-671.224] (-673.056) (-673.115) (-675.131) -- 0:00:21
745000 -- [-671.443] (-673.460) (-674.492) (-671.791) * (-670.580) [-672.076] (-672.189) (-672.051) -- 0:00:21
Average standard deviation of split frequencies: 0.007509
745500 -- (-672.957) (-672.242) [-672.314] (-670.998) * [-673.537] (-672.157) (-675.473) (-678.310) -- 0:00:21
746000 -- (-672.046) (-677.528) [-673.184] (-675.176) * (-671.197) [-673.007] (-674.243) (-671.999) -- 0:00:21
746500 -- [-672.851] (-676.520) (-672.419) (-675.474) * (-675.608) (-675.416) [-672.077] (-671.179) -- 0:00:21
747000 -- (-674.725) (-673.135) [-673.308] (-672.236) * (-672.428) (-673.560) (-671.379) [-672.551] -- 0:00:20
747500 -- [-675.841] (-675.107) (-675.482) (-672.193) * (-673.605) (-673.295) (-672.476) [-673.260] -- 0:00:20
748000 -- (-675.801) (-673.910) [-672.552] (-671.151) * (-671.801) [-675.877] (-673.470) (-673.856) -- 0:00:20
748500 -- (-671.247) (-672.801) [-673.370] (-672.800) * (-672.230) (-674.579) (-672.690) [-672.283] -- 0:00:20
749000 -- [-674.957] (-674.788) (-674.303) (-670.916) * (-670.753) (-676.527) (-673.082) [-672.136] -- 0:00:20
749500 -- [-674.682] (-671.191) (-671.642) (-670.611) * [-671.212] (-674.755) (-671.916) (-671.679) -- 0:00:20
750000 -- (-674.271) (-673.978) [-672.745] (-671.510) * (-672.500) (-673.712) (-671.599) [-672.809] -- 0:00:20
Average standard deviation of split frequencies: 0.006986
750500 -- (-675.913) (-676.165) [-671.812] (-676.683) * [-673.786] (-675.527) (-672.006) (-674.898) -- 0:00:20
751000 -- (-674.842) (-670.698) (-672.050) [-674.698] * (-671.886) (-675.380) [-674.051] (-671.915) -- 0:00:20
751500 -- (-672.968) (-672.355) (-672.689) [-672.756] * [-673.270] (-674.594) (-673.065) (-672.326) -- 0:00:20
752000 -- (-672.762) [-676.162] (-673.685) (-671.851) * (-672.172) [-673.819] (-675.762) (-672.195) -- 0:00:20
752500 -- [-673.710] (-677.495) (-672.096) (-671.950) * (-675.570) (-671.419) [-671.317] (-673.800) -- 0:00:20
753000 -- [-671.030] (-671.498) (-673.072) (-672.221) * (-672.144) (-672.560) (-671.185) [-674.912] -- 0:00:20
753500 -- (-671.522) (-672.229) (-671.118) [-671.839] * (-673.914) (-674.990) [-672.791] (-672.318) -- 0:00:20
754000 -- (-672.928) [-674.372] (-672.867) (-672.012) * (-672.044) [-672.779] (-675.424) (-671.186) -- 0:00:20
754500 -- (-672.579) (-673.110) [-670.537] (-674.136) * (-672.390) [-673.490] (-672.966) (-673.995) -- 0:00:20
755000 -- (-672.188) [-673.625] (-671.091) (-674.404) * [-673.308] (-671.955) (-672.852) (-678.258) -- 0:00:20
Average standard deviation of split frequencies: 0.007327
755500 -- (-671.624) [-672.354] (-676.053) (-670.923) * [-671.743] (-672.283) (-673.879) (-674.109) -- 0:00:20
756000 -- (-673.435) [-671.832] (-672.653) (-671.225) * (-671.932) (-671.235) [-676.466] (-674.371) -- 0:00:20
756500 -- (-676.546) (-675.518) (-672.634) [-672.237] * (-671.524) [-670.772] (-677.641) (-674.074) -- 0:00:20
757000 -- (-672.852) (-676.057) (-671.666) [-672.011] * [-672.718] (-672.701) (-674.018) (-673.661) -- 0:00:20
757500 -- (-672.186) [-672.995] (-671.574) (-671.939) * (-673.916) [-676.062] (-671.721) (-671.287) -- 0:00:20
758000 -- (-674.353) (-676.119) (-672.486) [-674.391] * [-677.324] (-671.619) (-677.015) (-671.562) -- 0:00:20
758500 -- (-674.300) (-674.969) (-672.394) [-672.130] * (-675.041) (-672.253) [-673.334] (-674.274) -- 0:00:20
759000 -- (-671.380) (-676.823) (-672.967) [-672.191] * (-673.643) (-674.265) (-673.700) [-671.472] -- 0:00:20
759500 -- [-673.217] (-674.519) (-671.812) (-672.947) * [-672.856] (-673.473) (-673.197) (-672.273) -- 0:00:19
760000 -- [-672.179] (-673.744) (-674.723) (-671.680) * [-672.735] (-676.910) (-671.442) (-674.485) -- 0:00:19
Average standard deviation of split frequencies: 0.007514
760500 -- (-673.264) [-671.049] (-673.295) (-671.030) * [-672.612] (-671.352) (-672.450) (-674.933) -- 0:00:19
761000 -- (-671.561) (-673.711) (-671.701) [-673.208] * (-673.481) [-671.213] (-674.464) (-674.240) -- 0:00:19
761500 -- (-671.399) [-674.202] (-672.570) (-673.077) * (-673.426) [-672.799] (-671.948) (-675.495) -- 0:00:19
762000 -- (-674.537) (-674.033) (-670.876) [-673.672] * [-674.076] (-673.150) (-672.239) (-673.080) -- 0:00:19
762500 -- (-673.749) [-672.238] (-671.896) (-671.631) * (-672.720) (-673.879) [-674.777] (-672.721) -- 0:00:19
763000 -- (-671.864) (-672.245) (-673.473) [-672.828] * (-672.276) (-673.678) (-673.053) [-674.186] -- 0:00:19
763500 -- (-671.545) (-673.608) [-673.925] (-671.663) * (-672.398) [-671.398] (-671.140) (-674.197) -- 0:00:19
764000 -- [-674.828] (-674.376) (-671.097) (-671.665) * (-674.729) [-671.595] (-671.030) (-674.463) -- 0:00:19
764500 -- (-676.765) (-672.061) (-675.040) [-673.995] * (-674.118) [-671.839] (-671.643) (-672.415) -- 0:00:19
765000 -- (-676.260) (-672.515) (-674.182) [-672.791] * (-670.577) (-674.702) [-671.248] (-670.908) -- 0:00:19
Average standard deviation of split frequencies: 0.007231
765500 -- (-672.564) (-675.405) (-671.405) [-672.237] * (-671.317) (-670.985) [-672.526] (-672.477) -- 0:00:19
766000 -- (-673.073) [-673.672] (-673.322) (-671.887) * (-673.345) (-671.001) [-674.034] (-673.293) -- 0:00:19
766500 -- (-673.046) (-676.193) (-672.083) [-672.065] * (-673.664) [-672.601] (-675.283) (-671.972) -- 0:00:19
767000 -- (-673.078) (-674.067) [-672.622] (-672.011) * (-674.249) (-671.494) [-673.135] (-674.159) -- 0:00:19
767500 -- [-676.931] (-673.093) (-672.049) (-673.820) * [-673.759] (-674.067) (-671.854) (-675.411) -- 0:00:19
768000 -- [-673.170] (-673.626) (-672.899) (-671.451) * (-674.525) (-673.934) [-671.129] (-672.059) -- 0:00:19
768500 -- (-670.815) (-673.353) (-673.127) [-674.264] * [-671.295] (-672.935) (-674.409) (-675.737) -- 0:00:19
769000 -- [-672.948] (-675.721) (-674.694) (-672.635) * [-671.071] (-671.396) (-670.998) (-676.423) -- 0:00:19
769500 -- (-673.428) (-672.720) [-674.882] (-675.201) * (-675.305) (-674.326) (-671.756) [-670.933] -- 0:00:19
770000 -- (-672.266) (-671.950) (-676.471) [-672.570] * [-672.326] (-677.107) (-674.603) (-672.133) -- 0:00:19
Average standard deviation of split frequencies: 0.008168
770500 -- (-672.600) [-675.240] (-672.238) (-674.020) * [-671.263] (-677.510) (-671.270) (-674.674) -- 0:00:19
771000 -- (-672.335) (-677.788) (-672.626) [-672.939] * (-675.177) (-680.541) [-672.394] (-671.169) -- 0:00:19
771500 -- (-671.754) (-672.546) (-674.841) [-671.591] * [-671.499] (-674.860) (-677.458) (-670.799) -- 0:00:18
772000 -- (-674.225) (-677.695) (-674.218) [-674.520] * (-671.384) [-672.648] (-676.583) (-672.122) -- 0:00:18
772500 -- (-671.167) (-675.617) (-674.911) [-673.505] * (-673.336) (-671.287) [-674.375] (-671.591) -- 0:00:18
773000 -- (-675.520) (-678.903) [-675.605] (-671.329) * (-674.139) [-672.108] (-677.638) (-677.909) -- 0:00:18
773500 -- [-671.246] (-676.024) (-672.015) (-671.071) * [-675.011] (-676.142) (-673.847) (-671.548) -- 0:00:18
774000 -- (-671.379) (-671.961) [-672.590] (-673.711) * (-673.429) (-675.083) [-673.811] (-671.623) -- 0:00:18
774500 -- (-672.088) (-671.410) [-677.001] (-671.699) * (-672.850) (-670.837) [-675.886] (-670.717) -- 0:00:18
775000 -- (-674.964) (-671.941) (-671.267) [-673.127] * (-671.412) (-671.768) (-673.296) [-675.042] -- 0:00:18
Average standard deviation of split frequencies: 0.008219
775500 -- (-674.526) (-675.255) [-673.094] (-678.162) * (-673.704) (-673.087) [-671.883] (-671.836) -- 0:00:18
776000 -- (-673.055) (-673.281) (-672.522) [-674.644] * (-673.516) (-672.011) (-675.457) [-677.500] -- 0:00:18
776500 -- (-673.145) (-676.641) (-671.438) [-671.955] * (-674.070) [-672.367] (-675.143) (-673.019) -- 0:00:18
777000 -- [-671.803] (-672.126) (-675.815) (-672.245) * (-673.621) [-675.165] (-671.945) (-675.260) -- 0:00:18
777500 -- (-671.165) [-671.437] (-672.247) (-673.327) * (-676.729) (-675.692) [-670.552] (-672.784) -- 0:00:18
778000 -- (-670.764) (-675.318) (-671.086) [-671.543] * (-674.193) (-671.281) (-672.000) [-670.883] -- 0:00:18
778500 -- (-674.269) (-671.384) (-670.689) [-673.425] * (-672.105) [-672.398] (-677.888) (-673.629) -- 0:00:18
779000 -- (-671.571) (-675.545) [-672.347] (-672.329) * (-671.214) (-673.082) [-673.397] (-671.115) -- 0:00:18
779500 -- (-675.109) [-674.469] (-671.404) (-672.602) * [-672.546] (-674.881) (-673.370) (-671.462) -- 0:00:18
780000 -- (-673.272) [-675.295] (-673.830) (-673.644) * (-671.571) [-674.290] (-673.919) (-673.089) -- 0:00:18
Average standard deviation of split frequencies: 0.008276
780500 -- [-672.178] (-673.160) (-674.355) (-672.932) * (-671.296) (-671.548) (-673.191) [-672.457] -- 0:00:18
781000 -- (-674.700) (-673.589) (-673.934) [-671.779] * [-671.318] (-673.535) (-671.762) (-673.505) -- 0:00:18
781500 -- (-673.693) (-673.198) (-671.805) [-676.218] * (-674.842) (-672.657) (-670.618) [-672.026] -- 0:00:18
782000 -- [-673.094] (-671.914) (-671.852) (-674.778) * [-673.892] (-671.419) (-671.355) (-674.735) -- 0:00:18
782500 -- (-675.295) (-672.331) (-677.089) [-671.605] * (-674.112) (-676.519) [-672.852] (-674.821) -- 0:00:18
783000 -- (-672.914) (-670.962) (-672.382) [-671.639] * [-671.811] (-675.101) (-670.835) (-671.870) -- 0:00:18
783500 -- (-671.483) (-673.377) [-670.650] (-672.305) * (-672.260) [-674.184] (-671.139) (-674.694) -- 0:00:17
784000 -- (-672.701) [-671.484] (-672.767) (-672.698) * (-670.784) (-673.745) [-672.870] (-674.724) -- 0:00:17
784500 -- (-674.936) (-673.410) [-671.692] (-675.650) * [-671.168] (-673.554) (-674.534) (-672.864) -- 0:00:17
785000 -- (-673.853) (-674.981) [-671.879] (-671.968) * [-672.177] (-674.951) (-672.816) (-674.579) -- 0:00:17
Average standard deviation of split frequencies: 0.008230
785500 -- (-675.117) (-675.116) [-673.756] (-674.108) * (-672.515) [-671.698] (-675.917) (-674.241) -- 0:00:17
786000 -- (-671.938) (-670.809) [-673.901] (-674.024) * (-670.755) (-671.098) [-674.841] (-671.157) -- 0:00:17
786500 -- [-671.649] (-671.795) (-677.336) (-671.257) * (-676.020) [-671.805] (-674.449) (-677.885) -- 0:00:17
787000 -- [-672.848] (-671.732) (-676.590) (-670.478) * [-673.245] (-672.850) (-671.597) (-673.232) -- 0:00:17
787500 -- [-672.030] (-675.215) (-673.938) (-670.478) * (-672.744) (-674.532) [-672.902] (-674.105) -- 0:00:17
788000 -- (-674.803) (-673.798) [-672.113] (-671.085) * (-671.575) (-673.808) [-671.185] (-671.903) -- 0:00:17
788500 -- (-673.461) [-672.368] (-672.388) (-671.489) * (-672.742) (-673.385) (-670.948) [-671.933] -- 0:00:17
789000 -- (-670.978) (-672.723) [-673.396] (-671.847) * (-673.621) (-671.556) [-675.515] (-671.998) -- 0:00:17
789500 -- (-671.883) (-672.135) [-672.908] (-672.012) * (-675.398) (-671.689) (-677.813) [-670.947] -- 0:00:17
790000 -- [-671.524] (-672.335) (-673.109) (-672.510) * (-673.304) [-672.275] (-673.369) (-671.724) -- 0:00:17
Average standard deviation of split frequencies: 0.008312
790500 -- (-672.107) (-674.537) (-674.707) [-674.449] * (-673.924) (-672.688) [-671.358] (-672.784) -- 0:00:17
791000 -- (-674.483) [-673.913] (-678.023) (-675.421) * (-672.975) [-673.852] (-671.984) (-670.947) -- 0:00:17
791500 -- (-673.935) [-672.027] (-678.791) (-673.176) * (-674.089) (-671.506) (-673.152) [-671.108] -- 0:00:17
792000 -- (-673.070) (-673.960) [-676.209] (-673.991) * [-672.390] (-674.914) (-673.748) (-673.034) -- 0:00:17
792500 -- (-671.949) [-671.679] (-675.522) (-671.805) * [-674.729] (-674.459) (-671.888) (-671.237) -- 0:00:17
793000 -- (-673.255) (-672.282) (-672.826) [-672.430] * (-676.762) (-671.537) (-672.163) [-671.885] -- 0:00:17
793500 -- [-672.810] (-671.670) (-673.105) (-674.404) * (-673.162) (-675.428) (-672.973) [-672.731] -- 0:00:17
794000 -- (-671.980) (-675.286) (-673.451) [-671.027] * (-672.065) (-672.608) [-674.894] (-672.995) -- 0:00:17
794500 -- (-673.312) (-672.011) (-672.819) [-675.843] * (-673.944) (-676.702) (-673.531) [-673.549] -- 0:00:17
795000 -- (-671.718) (-672.053) [-671.144] (-676.323) * (-673.710) [-676.160] (-677.932) (-675.981) -- 0:00:17
Average standard deviation of split frequencies: 0.007863
795500 -- (-671.733) (-674.985) [-672.276] (-670.541) * (-677.400) (-673.119) [-678.665] (-672.093) -- 0:00:16
796000 -- (-674.375) (-674.859) (-672.058) [-670.676] * (-675.358) (-671.698) (-678.632) [-675.119] -- 0:00:16
796500 -- (-678.806) (-671.704) (-672.170) [-675.246] * [-673.558] (-673.366) (-672.616) (-677.477) -- 0:00:16
797000 -- [-673.034] (-673.421) (-672.404) (-672.089) * (-674.342) (-672.100) (-671.535) [-673.763] -- 0:00:16
797500 -- [-672.815] (-672.352) (-672.257) (-673.104) * (-673.794) [-672.536] (-672.272) (-675.118) -- 0:00:16
798000 -- [-672.535] (-672.497) (-672.830) (-673.857) * [-673.996] (-671.977) (-672.146) (-671.579) -- 0:00:16
798500 -- (-671.846) (-672.891) (-672.866) [-671.454] * (-671.004) (-673.852) (-676.329) [-672.307] -- 0:00:16
799000 -- (-673.912) (-672.646) (-672.620) [-671.066] * (-676.432) [-670.983] (-674.581) (-676.885) -- 0:00:16
799500 -- [-674.344] (-673.234) (-673.633) (-671.433) * (-672.600) (-673.840) [-673.462] (-673.151) -- 0:00:16
800000 -- (-674.795) (-671.635) [-673.264] (-673.997) * (-671.701) (-674.217) [-670.433] (-672.390) -- 0:00:16
Average standard deviation of split frequencies: 0.007758
800500 -- (-676.758) [-673.717] (-674.137) (-675.553) * (-673.541) (-672.651) [-671.253] (-672.400) -- 0:00:16
801000 -- (-673.115) (-678.637) (-670.874) [-671.551] * (-672.484) (-672.311) (-671.582) [-672.444] -- 0:00:16
801500 -- (-674.492) (-675.690) [-673.517] (-672.577) * (-672.824) [-673.748] (-681.688) (-671.456) -- 0:00:16
802000 -- (-675.104) (-672.172) (-671.627) [-672.663] * (-678.244) (-672.665) (-671.837) [-674.486] -- 0:00:16
802500 -- (-671.091) (-672.356) [-672.847] (-675.820) * (-673.069) (-675.587) (-679.434) [-673.397] -- 0:00:16
803000 -- [-673.184] (-672.439) (-671.757) (-674.840) * (-672.087) (-679.943) (-673.168) [-675.551] -- 0:00:16
803500 -- (-676.449) (-674.467) [-671.533] (-673.627) * (-674.513) [-673.590] (-671.995) (-672.950) -- 0:00:16
804000 -- (-671.673) (-672.297) (-673.598) [-671.377] * [-672.052] (-674.544) (-673.371) (-673.436) -- 0:00:16
804500 -- [-671.328] (-671.662) (-672.116) (-672.570) * (-672.232) [-675.456] (-675.404) (-676.876) -- 0:00:16
805000 -- (-673.335) (-671.250) (-672.519) [-676.883] * (-671.869) (-671.967) [-674.738] (-673.093) -- 0:00:16
Average standard deviation of split frequencies: 0.007810
805500 -- (-673.122) (-671.406) (-673.167) [-671.751] * [-671.554] (-671.310) (-673.890) (-675.403) -- 0:00:16
806000 -- [-672.748] (-675.006) (-673.137) (-672.051) * (-671.399) (-672.704) [-673.391] (-671.665) -- 0:00:16
806500 -- (-673.975) (-673.385) [-671.638] (-672.328) * (-672.087) (-673.135) [-673.783] (-671.662) -- 0:00:16
807000 -- (-674.083) (-671.951) [-673.726] (-670.876) * (-672.626) (-673.079) (-674.515) [-672.629] -- 0:00:16
807500 -- (-681.388) [-671.327] (-675.433) (-674.059) * (-672.892) (-674.156) (-673.627) [-673.022] -- 0:00:15
808000 -- (-673.841) (-673.289) (-674.941) [-675.373] * (-671.554) (-671.889) (-677.620) [-672.105] -- 0:00:15
808500 -- (-672.276) [-671.405] (-672.355) (-676.405) * (-672.752) [-672.554] (-673.396) (-672.572) -- 0:00:15
809000 -- (-673.551) (-675.231) (-672.804) [-675.345] * (-673.243) (-670.732) [-671.724] (-675.600) -- 0:00:15
809500 -- (-672.483) (-676.668) (-673.596) [-676.909] * [-674.887] (-674.813) (-671.976) (-672.644) -- 0:00:15
810000 -- (-675.195) (-673.816) (-672.412) [-676.697] * (-671.900) [-672.707] (-673.679) (-671.356) -- 0:00:15
Average standard deviation of split frequencies: 0.007628
810500 -- (-673.589) (-671.591) (-671.617) [-673.392] * (-671.473) (-673.053) [-676.688] (-670.731) -- 0:00:15
811000 -- [-671.820] (-674.138) (-671.865) (-674.290) * [-672.545] (-671.719) (-677.686) (-672.558) -- 0:00:15
811500 -- (-673.093) (-675.484) [-672.126] (-673.110) * [-671.387] (-670.804) (-676.556) (-671.738) -- 0:00:15
812000 -- [-673.505] (-675.818) (-673.189) (-671.911) * (-671.479) (-678.748) (-671.616) [-674.118] -- 0:00:15
812500 -- (-674.842) [-672.368] (-671.483) (-677.071) * (-675.904) (-674.171) (-671.653) [-672.266] -- 0:00:15
813000 -- (-673.148) (-673.436) [-671.387] (-673.486) * (-675.662) (-673.730) (-670.872) [-674.694] -- 0:00:15
813500 -- (-671.753) [-675.944] (-673.214) (-673.580) * (-671.926) [-672.500] (-677.719) (-674.948) -- 0:00:15
814000 -- (-673.208) [-674.809] (-673.338) (-674.788) * [-672.523] (-673.789) (-673.959) (-674.927) -- 0:00:15
814500 -- (-674.098) (-675.532) [-674.110] (-671.654) * [-673.441] (-672.375) (-674.731) (-672.100) -- 0:00:15
815000 -- (-672.234) (-674.711) (-670.951) [-671.311] * (-672.654) (-673.009) (-673.891) [-672.098] -- 0:00:15
Average standard deviation of split frequencies: 0.007714
815500 -- [-672.745] (-674.092) (-672.434) (-671.479) * (-672.232) (-675.081) (-672.099) [-671.928] -- 0:00:15
816000 -- (-676.029) (-671.135) (-673.031) [-672.224] * [-671.894] (-681.008) (-671.754) (-672.507) -- 0:00:15
816500 -- (-675.761) (-672.084) [-673.020] (-673.001) * [-673.208] (-674.755) (-673.988) (-672.682) -- 0:00:15
817000 -- (-672.586) (-673.944) (-674.386) [-672.098] * (-673.842) (-672.870) [-671.576] (-675.088) -- 0:00:15
817500 -- (-674.158) (-675.772) (-673.021) [-672.672] * (-674.892) (-672.829) (-674.137) [-673.110] -- 0:00:15
818000 -- [-671.603] (-673.834) (-672.567) (-671.515) * (-674.628) (-671.630) [-672.031] (-671.983) -- 0:00:15
818500 -- (-672.493) (-670.990) [-674.324] (-674.477) * [-671.871] (-673.666) (-671.893) (-673.934) -- 0:00:15
819000 -- (-672.840) [-670.953] (-672.418) (-672.685) * (-671.913) (-671.883) (-672.534) [-673.248] -- 0:00:15
819500 -- (-671.940) [-670.868] (-672.122) (-673.927) * (-677.918) [-673.435] (-673.182) (-672.030) -- 0:00:14
820000 -- (-672.432) (-671.767) [-670.976] (-677.182) * (-671.832) [-673.485] (-680.764) (-675.255) -- 0:00:14
Average standard deviation of split frequencies: 0.008245
820500 -- (-676.286) [-675.867] (-671.297) (-675.558) * (-672.560) (-671.522) (-675.151) [-673.846] -- 0:00:14
821000 -- (-672.861) (-675.539) (-671.337) [-671.395] * (-673.457) [-671.591] (-671.950) (-673.852) -- 0:00:14
821500 -- [-677.738] (-674.168) (-672.069) (-672.354) * (-672.195) [-671.614] (-673.523) (-671.910) -- 0:00:14
822000 -- (-672.630) [-674.713] (-673.000) (-673.460) * (-672.189) (-671.619) [-671.322] (-671.676) -- 0:00:14
822500 -- (-673.684) [-672.933] (-672.073) (-671.627) * [-671.601] (-672.117) (-672.431) (-677.004) -- 0:00:14
823000 -- (-674.601) (-682.402) [-673.572] (-671.755) * (-672.634) (-671.189) [-671.951] (-677.180) -- 0:00:14
823500 -- (-673.938) (-673.646) (-672.357) [-671.354] * (-674.608) [-672.305] (-671.208) (-674.851) -- 0:00:14
824000 -- (-673.924) (-671.229) (-673.288) [-673.879] * [-674.170] (-672.356) (-671.022) (-672.168) -- 0:00:14
824500 -- (-675.206) [-672.199] (-672.964) (-671.980) * (-671.635) (-673.831) (-672.578) [-671.820] -- 0:00:14
825000 -- [-675.791] (-671.461) (-673.285) (-672.330) * (-673.061) (-673.022) [-672.593] (-672.092) -- 0:00:14
Average standard deviation of split frequencies: 0.008225
825500 -- (-672.074) [-673.003] (-673.846) (-671.478) * (-672.358) [-674.441] (-671.812) (-672.067) -- 0:00:14
826000 -- (-673.938) (-672.983) [-673.230] (-672.230) * [-671.271] (-673.338) (-671.373) (-672.200) -- 0:00:14
826500 -- [-674.010] (-671.774) (-672.115) (-672.657) * [-672.153] (-673.134) (-671.766) (-671.819) -- 0:00:14
827000 -- (-673.359) (-672.913) [-671.979] (-671.079) * (-673.662) (-673.401) [-677.361] (-671.446) -- 0:00:14
827500 -- (-673.111) (-671.471) (-671.399) [-671.596] * (-673.246) [-672.667] (-672.878) (-671.489) -- 0:00:14
828000 -- (-677.000) (-673.992) [-673.057] (-673.234) * (-673.141) [-671.254] (-675.028) (-677.796) -- 0:00:14
828500 -- (-674.232) (-675.446) [-674.497] (-673.712) * [-672.212] (-673.220) (-672.786) (-673.500) -- 0:00:14
829000 -- (-675.188) [-673.701] (-676.930) (-672.183) * (-671.625) (-671.309) (-671.711) [-675.979] -- 0:00:14
829500 -- [-672.633] (-674.261) (-672.295) (-677.103) * (-671.753) [-672.685] (-672.580) (-678.124) -- 0:00:14
830000 -- (-671.253) [-672.322] (-671.111) (-674.539) * (-674.699) (-670.787) (-671.968) [-672.204] -- 0:00:14
Average standard deviation of split frequencies: 0.008481
830500 -- (-673.055) (-675.075) (-673.973) [-673.538] * (-672.873) (-673.339) (-673.585) [-672.967] -- 0:00:14
831000 -- (-672.045) (-671.484) (-673.368) [-673.464] * (-675.539) (-675.142) (-672.169) [-671.981] -- 0:00:14
831500 -- (-672.015) (-671.366) [-672.213] (-673.293) * (-675.754) (-673.389) (-673.082) [-670.951] -- 0:00:13
832000 -- (-672.093) [-671.973] (-672.795) (-672.551) * (-674.434) (-672.338) [-670.765] (-672.495) -- 0:00:13
832500 -- (-674.269) (-670.935) [-673.224] (-672.147) * (-674.538) [-671.975] (-672.578) (-672.864) -- 0:00:13
833000 -- (-671.860) (-670.652) [-672.386] (-675.303) * (-674.472) [-671.878] (-671.536) (-673.410) -- 0:00:13
833500 -- (-675.257) [-671.031] (-671.350) (-674.040) * (-671.995) [-673.975] (-672.423) (-674.851) -- 0:00:13
834000 -- (-674.247) [-671.582] (-675.548) (-675.075) * [-671.749] (-670.855) (-672.267) (-675.334) -- 0:00:13
834500 -- (-672.483) (-674.076) (-671.801) [-672.684] * (-674.908) (-673.373) (-671.420) [-672.159] -- 0:00:13
835000 -- (-671.955) [-672.882] (-676.547) (-675.435) * (-671.401) (-672.052) [-671.617] (-676.604) -- 0:00:13
Average standard deviation of split frequencies: 0.008396
835500 -- (-672.698) (-671.636) [-672.953] (-675.368) * [-672.778] (-671.849) (-674.124) (-672.409) -- 0:00:13
836000 -- (-671.302) (-672.208) (-671.899) [-671.903] * (-673.147) (-671.291) [-678.390] (-671.095) -- 0:00:13
836500 -- (-670.980) (-671.679) (-673.112) [-673.698] * [-675.310] (-676.486) (-674.558) (-673.301) -- 0:00:13
837000 -- (-674.297) [-672.374] (-679.034) (-672.853) * (-672.909) (-673.542) (-670.638) [-674.294] -- 0:00:13
837500 -- (-673.015) [-671.758] (-672.290) (-671.897) * (-672.022) (-672.996) (-677.006) [-672.844] -- 0:00:13
838000 -- (-672.115) (-675.158) [-670.738] (-672.746) * [-670.693] (-673.820) (-673.429) (-675.931) -- 0:00:13
838500 -- (-671.979) (-671.786) (-674.128) [-674.811] * (-672.008) [-671.299] (-674.135) (-680.081) -- 0:00:13
839000 -- (-674.238) (-673.193) [-672.837] (-674.140) * (-671.179) (-674.562) [-672.432] (-672.249) -- 0:00:13
839500 -- [-674.417] (-675.535) (-672.037) (-675.632) * (-670.606) [-671.621] (-672.265) (-671.834) -- 0:00:13
840000 -- (-678.067) (-674.656) (-674.950) [-674.403] * (-671.471) [-670.999] (-674.475) (-672.573) -- 0:00:13
Average standard deviation of split frequencies: 0.008287
840500 -- (-674.456) (-672.077) [-673.009] (-674.614) * [-671.500] (-670.931) (-673.237) (-673.552) -- 0:00:13
841000 -- [-674.253] (-677.017) (-671.782) (-671.998) * (-671.202) (-676.290) (-671.304) [-673.651] -- 0:00:13
841500 -- [-672.139] (-672.996) (-672.490) (-674.005) * (-670.959) [-672.812] (-674.379) (-673.939) -- 0:00:13
842000 -- (-670.898) (-671.972) [-672.871] (-674.573) * [-673.106] (-673.997) (-673.519) (-673.526) -- 0:00:13
842500 -- (-672.913) (-674.294) (-673.802) [-672.727] * [-671.764] (-673.519) (-671.140) (-672.280) -- 0:00:13
843000 -- (-672.776) (-671.191) [-672.754] (-673.040) * (-673.994) (-671.697) (-674.311) [-672.291] -- 0:00:13
843500 -- (-673.327) [-672.849] (-671.202) (-673.005) * (-671.984) (-673.501) (-671.724) [-675.748] -- 0:00:12
844000 -- (-673.241) (-671.657) (-671.732) [-671.113] * (-671.747) [-672.694] (-674.896) (-675.537) -- 0:00:12
844500 -- (-671.277) (-671.713) [-671.167] (-671.647) * (-672.106) (-672.832) [-671.726] (-676.688) -- 0:00:12
845000 -- (-671.372) (-671.335) [-673.135] (-671.709) * (-673.478) [-670.853] (-674.893) (-673.822) -- 0:00:12
Average standard deviation of split frequencies: 0.008327
845500 -- (-672.154) [-672.680] (-673.935) (-673.139) * (-673.088) [-672.088] (-672.417) (-674.684) -- 0:00:12
846000 -- (-672.701) [-674.828] (-674.292) (-672.702) * (-677.870) [-671.283] (-678.824) (-674.216) -- 0:00:12
846500 -- (-670.728) [-672.120] (-671.722) (-673.648) * (-674.797) (-671.630) [-672.565] (-671.058) -- 0:00:12
847000 -- [-670.990] (-672.398) (-672.219) (-674.449) * (-675.794) (-675.207) [-672.271] (-671.856) -- 0:00:12
847500 -- (-673.727) (-671.885) [-671.797] (-674.501) * (-674.906) (-675.596) [-675.218] (-671.515) -- 0:00:12
848000 -- (-671.003) (-672.141) [-670.798] (-674.163) * [-673.517] (-673.654) (-674.191) (-671.063) -- 0:00:12
848500 -- [-671.011] (-677.516) (-671.092) (-672.285) * (-677.384) [-673.123] (-672.445) (-672.576) -- 0:00:12
849000 -- [-671.819] (-673.550) (-671.134) (-673.768) * [-672.093] (-673.641) (-678.229) (-671.742) -- 0:00:12
849500 -- (-671.109) (-672.191) [-672.594] (-674.594) * (-672.246) (-672.934) [-674.899] (-674.353) -- 0:00:12
850000 -- (-675.844) (-673.848) (-672.987) [-673.964] * (-672.699) (-670.954) (-672.901) [-671.650] -- 0:00:12
Average standard deviation of split frequencies: 0.008620
850500 -- (-670.950) (-672.155) [-671.766] (-670.814) * (-672.797) [-672.811] (-671.170) (-673.558) -- 0:00:12
851000 -- (-671.246) (-672.128) (-672.786) [-671.494] * (-674.918) [-672.280] (-671.449) (-673.953) -- 0:00:12
851500 -- [-671.702] (-671.546) (-673.198) (-671.478) * [-673.487] (-672.928) (-671.391) (-671.350) -- 0:00:12
852000 -- (-673.610) (-670.790) [-671.107] (-674.306) * (-672.644) [-671.997] (-671.641) (-676.500) -- 0:00:12
852500 -- [-671.147] (-672.219) (-671.107) (-671.878) * [-671.906] (-672.637) (-672.474) (-672.521) -- 0:00:12
853000 -- [-670.753] (-670.947) (-672.539) (-671.823) * (-673.137) (-674.400) (-675.265) [-675.121] -- 0:00:12
853500 -- [-670.999] (-678.648) (-674.085) (-675.467) * (-672.031) (-671.753) [-677.096] (-677.330) -- 0:00:12
854000 -- (-670.863) [-673.517] (-672.089) (-671.589) * (-670.880) (-671.731) (-678.686) [-671.483] -- 0:00:12
854500 -- [-672.669] (-672.509) (-671.631) (-671.333) * [-671.164] (-671.939) (-683.641) (-672.026) -- 0:00:12
855000 -- [-672.292] (-671.523) (-672.832) (-670.639) * (-670.895) (-670.623) [-676.209] (-674.276) -- 0:00:12
Average standard deviation of split frequencies: 0.008720
855500 -- [-671.545] (-672.742) (-677.789) (-673.231) * (-672.507) (-670.898) [-672.139] (-673.356) -- 0:00:11
856000 -- (-671.624) (-676.634) [-672.806] (-673.536) * (-672.135) (-672.325) [-672.916] (-673.645) -- 0:00:11
856500 -- [-675.690] (-675.398) (-675.369) (-673.739) * (-677.618) (-671.812) (-671.331) [-673.683] -- 0:00:11
857000 -- (-673.928) [-673.830] (-675.148) (-673.035) * (-673.500) (-672.280) [-671.506] (-670.965) -- 0:00:11
857500 -- [-673.138] (-675.738) (-671.075) (-673.062) * (-673.503) (-672.995) [-671.202] (-672.070) -- 0:00:11
858000 -- (-675.179) (-673.696) (-672.733) [-671.833] * (-671.832) (-671.804) (-673.451) [-671.932] -- 0:00:11
858500 -- [-673.562] (-671.979) (-672.260) (-672.335) * (-672.421) (-670.887) (-671.705) [-671.930] -- 0:00:11
859000 -- (-672.246) [-674.695] (-673.999) (-671.519) * (-672.025) (-673.528) (-672.912) [-674.043] -- 0:00:11
859500 -- (-671.288) (-673.608) (-679.383) [-671.486] * [-673.887] (-673.477) (-674.560) (-675.355) -- 0:00:11
860000 -- [-672.737] (-676.173) (-675.390) (-671.549) * (-673.040) (-672.227) [-675.206] (-677.666) -- 0:00:11
Average standard deviation of split frequencies: 0.008338
860500 -- (-673.104) (-675.491) (-674.285) [-671.549] * (-673.494) [-672.815] (-674.913) (-671.235) -- 0:00:11
861000 -- [-672.493] (-673.820) (-674.773) (-674.925) * (-675.341) (-672.212) (-671.636) [-674.089] -- 0:00:11
861500 -- [-671.651] (-672.466) (-678.147) (-672.107) * [-675.622] (-671.941) (-671.995) (-672.948) -- 0:00:11
862000 -- [-672.332] (-672.553) (-671.505) (-672.894) * (-672.583) [-674.096] (-671.751) (-674.907) -- 0:00:11
862500 -- (-673.380) (-672.936) (-673.151) [-672.293] * (-671.697) (-672.226) [-671.482] (-673.117) -- 0:00:11
863000 -- (-673.918) [-671.025] (-674.051) (-672.964) * (-673.615) (-671.410) (-674.562) [-673.002] -- 0:00:11
863500 -- [-671.317] (-675.533) (-676.444) (-673.512) * (-675.082) (-671.529) [-673.408] (-672.289) -- 0:00:11
864000 -- [-671.392] (-673.376) (-677.454) (-676.516) * (-677.301) (-672.913) (-672.453) [-676.895] -- 0:00:11
864500 -- [-670.539] (-675.636) (-672.583) (-673.176) * [-673.053] (-674.677) (-671.838) (-674.431) -- 0:00:11
865000 -- (-671.394) [-672.543] (-672.952) (-674.489) * (-673.708) (-671.970) [-672.045] (-672.776) -- 0:00:11
Average standard deviation of split frequencies: 0.008528
865500 -- (-671.397) [-675.671] (-673.152) (-674.347) * [-671.646] (-671.507) (-670.788) (-672.150) -- 0:00:11
866000 -- (-672.019) [-675.199] (-673.356) (-671.103) * [-671.970] (-671.650) (-672.388) (-672.090) -- 0:00:11
866500 -- (-672.003) (-672.219) (-671.640) [-672.983] * (-673.904) [-671.088] (-671.041) (-673.131) -- 0:00:11
867000 -- (-672.026) (-671.604) (-671.334) [-671.366] * (-670.758) (-672.865) [-671.431] (-671.815) -- 0:00:11
867500 -- [-672.161] (-673.345) (-674.304) (-673.531) * (-673.393) (-677.079) [-670.752] (-672.516) -- 0:00:10
868000 -- (-674.026) (-673.177) (-673.143) [-671.699] * (-671.670) [-670.784] (-671.275) (-672.693) -- 0:00:10
868500 -- (-671.265) [-674.878] (-674.653) (-673.326) * [-671.286] (-671.405) (-672.661) (-672.792) -- 0:00:10
869000 -- (-670.860) (-672.003) (-674.319) [-673.194] * (-673.386) (-675.535) [-672.365] (-671.378) -- 0:00:10
869500 -- [-672.010] (-673.347) (-672.560) (-675.148) * (-673.072) (-671.508) (-672.689) [-671.233] -- 0:00:10
870000 -- (-675.510) [-673.128] (-671.620) (-671.973) * [-671.675] (-674.769) (-673.640) (-675.494) -- 0:00:10
Average standard deviation of split frequencies: 0.008663
870500 -- (-672.532) (-673.649) (-671.441) [-675.667] * [-673.642] (-673.474) (-671.894) (-675.659) -- 0:00:10
871000 -- (-672.113) [-676.555] (-672.805) (-674.724) * [-672.855] (-673.306) (-671.735) (-672.457) -- 0:00:10
871500 -- (-674.005) [-673.292] (-675.016) (-673.788) * (-672.895) [-675.332] (-672.869) (-672.845) -- 0:00:10
872000 -- (-676.707) (-672.182) (-671.535) [-676.607] * [-672.019] (-677.489) (-674.102) (-670.837) -- 0:00:10
872500 -- (-672.371) [-674.897] (-679.769) (-672.249) * [-672.912] (-672.719) (-673.883) (-670.666) -- 0:00:10
873000 -- [-672.422] (-676.462) (-674.682) (-672.413) * (-675.227) (-672.214) [-672.894] (-670.784) -- 0:00:10
873500 -- (-671.769) [-672.715] (-673.647) (-670.816) * (-677.603) (-671.778) [-672.416] (-671.942) -- 0:00:10
874000 -- (-673.475) (-671.177) [-671.035] (-672.304) * (-674.116) [-673.627] (-672.256) (-674.195) -- 0:00:10
874500 -- (-676.814) (-670.876) (-671.956) [-674.141] * (-674.081) [-671.444] (-671.313) (-671.869) -- 0:00:10
875000 -- (-672.700) [-674.305] (-672.068) (-672.634) * (-677.009) (-674.053) [-673.728] (-672.795) -- 0:00:10
Average standard deviation of split frequencies: 0.008730
875500 -- (-672.628) (-673.675) [-671.057] (-672.202) * (-676.490) (-673.906) [-672.550] (-672.608) -- 0:00:10
876000 -- (-671.380) (-672.414) [-673.505] (-676.136) * (-672.445) (-675.506) (-675.046) [-672.606] -- 0:00:10
876500 -- (-673.332) [-671.114] (-674.346) (-675.095) * (-674.300) [-674.386] (-674.997) (-672.574) -- 0:00:10
877000 -- (-671.359) (-671.547) (-675.449) [-674.356] * [-672.224] (-676.169) (-674.942) (-676.949) -- 0:00:10
877500 -- (-676.653) (-672.924) [-674.176] (-673.508) * (-672.471) (-671.112) [-675.219] (-672.190) -- 0:00:10
878000 -- [-672.284] (-671.664) (-673.918) (-675.438) * [-671.140] (-670.716) (-673.614) (-676.278) -- 0:00:10
878500 -- (-672.856) (-674.601) [-673.399] (-672.569) * (-671.530) [-670.498] (-675.685) (-671.905) -- 0:00:10
879000 -- (-675.092) [-674.553] (-673.263) (-671.890) * [-673.807] (-671.418) (-674.742) (-672.618) -- 0:00:10
879500 -- [-672.971] (-670.970) (-671.666) (-672.375) * (-671.749) (-671.174) [-673.152] (-675.029) -- 0:00:10
880000 -- (-673.021) [-670.878] (-671.879) (-672.600) * (-673.846) [-672.664] (-671.202) (-671.935) -- 0:00:09
Average standard deviation of split frequencies: 0.009040
880500 -- (-672.278) (-673.455) [-673.157] (-674.465) * (-674.361) [-672.172] (-672.465) (-673.484) -- 0:00:09
881000 -- (-677.117) [-671.015] (-672.323) (-671.673) * (-678.845) (-672.837) [-673.084] (-674.985) -- 0:00:09
881500 -- (-672.960) [-672.359] (-672.298) (-671.712) * (-675.580) [-671.713] (-672.733) (-673.918) -- 0:00:09
882000 -- (-673.259) (-673.722) (-671.286) [-673.752] * [-672.616] (-674.202) (-671.152) (-676.017) -- 0:00:09
882500 -- (-672.273) (-671.855) (-673.600) [-673.164] * (-674.350) (-672.574) (-671.129) [-673.922] -- 0:00:09
883000 -- [-676.533] (-671.024) (-671.984) (-671.119) * (-673.596) [-676.028] (-674.562) (-674.768) -- 0:00:09
883500 -- (-672.209) (-672.650) (-672.321) [-672.083] * [-673.862] (-672.126) (-673.139) (-675.863) -- 0:00:09
884000 -- [-675.092] (-671.675) (-676.511) (-672.638) * (-672.861) [-677.341] (-673.154) (-673.215) -- 0:00:09
884500 -- (-672.302) (-672.840) (-678.076) [-672.218] * (-674.378) [-675.917] (-672.368) (-673.206) -- 0:00:09
885000 -- (-675.416) [-673.899] (-673.740) (-671.397) * (-673.128) (-675.777) (-671.624) [-673.124] -- 0:00:09
Average standard deviation of split frequencies: 0.008986
885500 -- (-673.711) (-670.993) (-672.172) [-673.755] * (-671.028) (-671.119) (-676.002) [-671.673] -- 0:00:09
886000 -- [-678.579] (-671.854) (-671.829) (-673.849) * (-671.621) (-674.294) (-671.862) [-673.896] -- 0:00:09
886500 -- (-674.174) (-672.464) (-672.011) [-672.494] * [-671.747] (-673.017) (-674.520) (-674.062) -- 0:00:09
887000 -- [-674.315] (-672.463) (-672.379) (-674.544) * (-672.254) [-675.623] (-673.798) (-673.280) -- 0:00:09
887500 -- (-674.598) [-673.192] (-671.653) (-673.080) * (-673.381) (-671.593) [-672.762] (-672.899) -- 0:00:09
888000 -- (-677.253) (-672.104) (-671.222) [-670.803] * (-671.806) [-672.480] (-680.874) (-671.842) -- 0:00:09
888500 -- (-674.866) (-677.110) (-671.788) [-672.652] * (-671.441) [-672.843] (-681.124) (-675.008) -- 0:00:09
889000 -- (-677.741) (-675.152) [-671.451] (-671.551) * (-672.789) (-674.069) [-677.569] (-678.545) -- 0:00:09
889500 -- (-673.761) [-670.848] (-670.900) (-671.690) * [-671.342] (-678.583) (-678.900) (-673.952) -- 0:00:09
890000 -- (-674.954) (-671.403) [-672.814] (-670.890) * (-672.769) [-672.869] (-672.353) (-671.820) -- 0:00:09
Average standard deviation of split frequencies: 0.009292
890500 -- (-672.276) (-671.296) (-671.940) [-672.649] * (-672.489) [-673.654] (-674.216) (-671.815) -- 0:00:09
891000 -- (-671.608) [-671.123] (-672.262) (-671.095) * [-672.422] (-673.358) (-676.172) (-674.712) -- 0:00:09
891500 -- (-671.347) (-671.241) [-675.442] (-671.164) * (-673.180) (-678.138) (-672.850) [-671.514] -- 0:00:09
892000 -- [-673.946] (-674.205) (-673.667) (-671.590) * (-675.885) (-675.912) [-671.108] (-671.340) -- 0:00:08
892500 -- (-671.636) (-672.666) (-673.458) [-671.604] * (-675.017) (-675.665) [-672.223] (-671.854) -- 0:00:08
893000 -- (-671.763) (-672.463) (-673.110) [-672.172] * [-673.710] (-673.331) (-674.012) (-672.798) -- 0:00:08
893500 -- [-671.158] (-672.943) (-674.680) (-674.829) * (-680.369) [-672.952] (-676.481) (-673.328) -- 0:00:08
894000 -- (-671.078) (-674.046) [-671.844] (-676.004) * (-676.735) [-671.450] (-673.289) (-673.233) -- 0:00:08
894500 -- (-671.177) (-674.664) [-673.183] (-670.971) * (-670.998) (-672.355) (-672.023) [-671.722] -- 0:00:08
895000 -- [-678.101] (-673.263) (-672.396) (-671.827) * [-670.568] (-673.238) (-672.527) (-672.645) -- 0:00:08
Average standard deviation of split frequencies: 0.009315
895500 -- (-673.036) (-672.198) [-671.304] (-678.901) * (-670.865) (-671.102) [-671.986] (-670.957) -- 0:00:08
896000 -- (-671.061) (-671.427) [-671.260] (-672.621) * (-677.111) [-674.738] (-674.603) (-674.231) -- 0:00:08
896500 -- (-673.404) [-671.664] (-671.012) (-672.759) * (-675.881) (-676.532) [-673.772] (-675.611) -- 0:00:08
897000 -- (-675.906) (-673.813) [-673.660] (-672.362) * [-671.257] (-671.996) (-675.502) (-677.365) -- 0:00:08
897500 -- (-677.110) [-671.139] (-671.423) (-672.864) * [-672.727] (-673.041) (-672.679) (-679.260) -- 0:00:08
898000 -- (-673.395) [-671.863] (-671.181) (-674.618) * [-674.809] (-671.705) (-676.185) (-676.443) -- 0:00:08
898500 -- (-673.064) (-673.076) (-671.651) [-674.485] * (-674.534) [-672.530] (-671.319) (-674.431) -- 0:00:08
899000 -- (-673.374) (-673.065) [-672.695] (-674.932) * (-671.807) (-671.718) [-672.058] (-676.630) -- 0:00:08
899500 -- [-675.298] (-675.073) (-673.647) (-675.030) * (-677.184) (-670.885) (-672.875) [-680.328] -- 0:00:08
900000 -- [-672.048] (-676.372) (-671.854) (-673.637) * [-674.295] (-672.198) (-673.715) (-678.165) -- 0:00:08
Average standard deviation of split frequencies: 0.009770
900500 -- (-670.522) (-675.051) [-671.565] (-670.864) * (-674.042) (-672.653) [-670.639] (-675.398) -- 0:00:08
901000 -- (-670.500) [-672.478] (-672.533) (-672.302) * [-673.130] (-675.497) (-673.224) (-673.432) -- 0:00:08
901500 -- (-672.896) [-673.369] (-677.328) (-675.745) * (-672.549) [-672.850] (-671.132) (-673.033) -- 0:00:08
902000 -- (-670.704) (-672.834) (-673.178) [-672.523] * (-671.555) [-672.787] (-671.839) (-671.310) -- 0:00:08
902500 -- (-672.379) (-673.588) (-671.146) [-672.478] * [-674.568] (-672.894) (-673.150) (-674.132) -- 0:00:08
903000 -- (-671.620) (-673.469) [-670.874] (-674.509) * (-672.785) (-672.700) [-672.626] (-672.118) -- 0:00:08
903500 -- [-671.273] (-677.487) (-671.763) (-673.195) * [-670.672] (-672.611) (-675.621) (-670.972) -- 0:00:08
904000 -- [-678.019] (-673.704) (-671.767) (-675.607) * (-672.679) [-673.216] (-670.943) (-675.475) -- 0:00:07
904500 -- (-676.909) (-674.476) [-673.037] (-676.195) * (-676.175) (-672.868) (-675.690) [-672.652] -- 0:00:07
905000 -- (-675.527) (-671.915) [-671.651] (-676.205) * (-672.479) [-672.513] (-676.180) (-671.372) -- 0:00:07
Average standard deviation of split frequencies: 0.009799
905500 -- (-674.407) (-671.082) (-675.519) [-675.874] * (-672.537) (-671.075) (-673.870) [-672.526] -- 0:00:07
906000 -- [-671.573] (-674.478) (-675.048) (-670.827) * (-671.883) (-671.412) (-672.993) [-671.452] -- 0:00:07
906500 -- (-671.949) [-673.189] (-672.980) (-672.027) * (-674.362) (-672.108) (-671.546) [-674.714] -- 0:00:07
907000 -- [-671.640] (-671.952) (-672.492) (-676.745) * [-672.210] (-672.453) (-671.144) (-674.620) -- 0:00:07
907500 -- (-671.546) (-672.438) [-672.060] (-676.970) * (-674.422) (-672.665) [-674.050] (-672.278) -- 0:00:07
908000 -- (-671.393) (-671.686) [-671.249] (-673.878) * [-673.117] (-672.585) (-671.956) (-677.466) -- 0:00:07
908500 -- [-670.831] (-676.474) (-671.471) (-673.457) * [-672.328] (-672.253) (-673.691) (-678.558) -- 0:00:07
909000 -- [-671.700] (-671.355) (-672.306) (-675.815) * (-675.000) (-672.702) [-674.414] (-671.970) -- 0:00:07
909500 -- (-671.665) (-676.445) [-673.188] (-675.157) * (-676.642) [-672.785] (-672.773) (-672.517) -- 0:00:07
910000 -- (-673.891) [-675.199] (-674.094) (-672.933) * [-673.279] (-673.208) (-671.622) (-671.343) -- 0:00:07
Average standard deviation of split frequencies: 0.010123
910500 -- (-672.331) (-672.957) (-673.216) [-671.650] * (-673.539) [-674.926] (-672.973) (-677.354) -- 0:00:07
911000 -- [-674.561] (-674.967) (-674.946) (-675.555) * (-671.992) (-675.190) (-671.267) [-673.499] -- 0:00:07
911500 -- (-673.713) (-675.083) [-674.213] (-677.018) * (-671.697) (-674.792) (-671.912) [-675.942] -- 0:00:07
912000 -- (-673.403) (-674.445) [-671.878] (-675.713) * (-678.851) [-671.408] (-671.113) (-672.261) -- 0:00:07
912500 -- [-672.925] (-679.182) (-672.526) (-673.867) * [-673.512] (-673.716) (-672.367) (-675.490) -- 0:00:07
913000 -- (-672.257) (-677.358) (-671.048) [-674.505] * (-673.728) (-672.485) [-674.479] (-675.559) -- 0:00:07
913500 -- [-672.250] (-679.531) (-672.371) (-675.288) * (-672.599) (-676.840) [-672.167] (-674.183) -- 0:00:07
914000 -- (-676.045) (-673.411) [-675.386] (-673.392) * (-676.529) (-674.942) [-673.751] (-672.472) -- 0:00:07
914500 -- (-673.690) (-670.944) (-671.056) [-672.472] * (-671.922) [-673.800] (-673.845) (-671.900) -- 0:00:07
915000 -- (-671.964) [-670.965] (-675.411) (-676.627) * (-673.224) (-673.050) [-671.539] (-672.599) -- 0:00:07
Average standard deviation of split frequencies: 0.010178
915500 -- (-671.005) (-671.463) [-675.134] (-673.747) * (-674.921) (-672.982) [-671.382] (-671.313) -- 0:00:07
916000 -- (-670.953) (-671.633) [-675.274] (-671.342) * [-673.504] (-672.590) (-673.692) (-670.951) -- 0:00:06
916500 -- (-671.003) (-672.658) (-675.324) [-672.429] * (-675.382) (-675.089) (-673.053) [-672.264] -- 0:00:06
917000 -- [-672.402] (-673.192) (-675.191) (-673.290) * (-671.884) [-671.789] (-672.556) (-674.055) -- 0:00:06
917500 -- [-672.094] (-672.142) (-672.880) (-675.787) * [-672.302] (-674.159) (-673.127) (-673.156) -- 0:00:06
918000 -- [-671.865] (-671.538) (-672.832) (-678.282) * (-673.472) (-672.732) (-671.196) [-672.212] -- 0:00:06
918500 -- (-674.850) (-671.853) (-672.205) [-673.026] * (-674.036) (-672.183) (-671.359) [-672.362] -- 0:00:06
919000 -- (-676.086) (-673.340) [-671.835] (-673.871) * (-672.690) [-673.742] (-674.193) (-672.541) -- 0:00:06
919500 -- [-673.747] (-674.749) (-672.822) (-673.298) * (-674.635) [-676.006] (-674.068) (-672.557) -- 0:00:06
920000 -- [-671.907] (-676.330) (-673.307) (-670.908) * (-677.717) [-671.471] (-672.702) (-671.409) -- 0:00:06
Average standard deviation of split frequencies: 0.010155
920500 -- (-672.894) (-671.509) (-674.951) [-670.669] * (-671.304) [-671.891] (-672.922) (-677.671) -- 0:00:06
921000 -- [-672.243] (-672.772) (-673.468) (-671.731) * (-671.117) (-671.199) [-676.117] (-671.859) -- 0:00:06
921500 -- (-672.436) [-672.578] (-675.205) (-672.494) * (-671.553) [-671.596] (-671.603) (-671.717) -- 0:00:06
922000 -- [-670.948] (-672.540) (-673.735) (-674.478) * [-672.560] (-672.699) (-674.513) (-673.253) -- 0:00:06
922500 -- (-671.339) (-673.281) (-673.720) [-672.617] * (-673.571) (-671.837) [-671.293] (-672.427) -- 0:00:06
923000 -- [-676.418] (-672.367) (-672.785) (-674.917) * [-672.445] (-672.547) (-675.397) (-672.239) -- 0:00:06
923500 -- (-675.207) (-674.452) (-673.222) [-674.270] * [-673.149] (-676.487) (-678.026) (-677.840) -- 0:00:06
924000 -- (-673.076) (-674.877) [-672.819] (-672.702) * [-672.130] (-674.339) (-673.068) (-675.554) -- 0:00:06
924500 -- (-672.102) (-675.914) [-673.697] (-675.761) * (-671.767) [-673.794] (-674.533) (-675.535) -- 0:00:06
925000 -- (-675.160) [-671.924] (-675.112) (-673.629) * (-671.158) (-672.479) (-674.875) [-673.352] -- 0:00:06
Average standard deviation of split frequencies: 0.010379
925500 -- (-679.702) (-673.951) (-671.652) [-672.147] * (-673.425) (-676.413) (-673.463) [-672.167] -- 0:00:06
926000 -- [-678.272] (-674.254) (-675.511) (-672.145) * (-674.936) (-673.378) [-673.648] (-672.710) -- 0:00:06
926500 -- (-676.609) [-672.494] (-675.332) (-673.350) * (-674.430) (-670.888) [-673.031] (-672.049) -- 0:00:06
927000 -- (-676.905) (-674.493) (-673.385) [-670.672] * (-675.315) (-671.835) [-673.039] (-671.778) -- 0:00:06
927500 -- (-672.967) (-673.663) (-674.614) [-671.920] * (-673.899) [-671.850] (-672.100) (-672.504) -- 0:00:06
928000 -- (-675.295) (-673.188) (-676.298) [-671.950] * (-673.403) [-673.911] (-676.286) (-673.010) -- 0:00:05
928500 -- (-674.336) (-675.465) (-682.249) [-671.017] * [-674.217] (-674.662) (-675.025) (-674.023) -- 0:00:05
929000 -- (-672.691) [-671.768] (-673.259) (-675.768) * (-672.040) [-671.494] (-671.637) (-673.582) -- 0:00:05
929500 -- (-671.130) [-671.562] (-673.162) (-672.020) * [-672.941] (-671.388) (-674.257) (-674.650) -- 0:00:05
930000 -- [-672.268] (-672.031) (-670.796) (-672.119) * [-671.345] (-671.786) (-672.572) (-674.140) -- 0:00:05
Average standard deviation of split frequencies: 0.010553
930500 -- [-671.531] (-671.461) (-674.973) (-673.388) * [-675.483] (-671.977) (-670.913) (-673.068) -- 0:00:05
931000 -- (-673.512) (-673.286) [-670.848] (-673.794) * (-672.383) [-672.169] (-671.496) (-673.914) -- 0:00:05
931500 -- (-672.699) (-674.687) (-670.687) [-671.796] * [-674.317] (-672.922) (-672.880) (-675.647) -- 0:00:05
932000 -- (-676.183) (-674.311) [-674.463] (-671.495) * (-671.712) (-672.427) [-672.537] (-672.509) -- 0:00:05
932500 -- [-672.517] (-672.055) (-671.075) (-672.463) * (-671.743) [-672.069] (-672.477) (-672.364) -- 0:00:05
933000 -- (-672.476) (-676.570) [-676.924] (-674.215) * (-673.070) (-672.616) [-670.491] (-677.336) -- 0:00:05
933500 -- (-674.629) (-674.260) (-672.774) [-671.332] * (-671.716) [-671.841] (-674.537) (-672.338) -- 0:00:05
934000 -- (-673.951) (-676.470) [-674.540] (-675.607) * (-671.824) (-672.633) [-675.218] (-671.160) -- 0:00:05
934500 -- (-670.736) (-671.756) (-671.541) [-675.546] * (-674.340) (-674.815) [-673.009] (-671.763) -- 0:00:05
935000 -- (-670.547) (-672.928) (-676.207) [-680.377] * (-671.048) (-673.051) [-671.952] (-671.602) -- 0:00:05
Average standard deviation of split frequencies: 0.010604
935500 -- [-672.604] (-671.979) (-674.252) (-676.701) * (-670.872) (-672.654) (-672.488) [-671.528] -- 0:00:05
936000 -- [-673.196] (-675.764) (-673.675) (-672.141) * (-671.330) (-674.332) (-673.313) [-674.496] -- 0:00:05
936500 -- [-673.070] (-673.639) (-671.119) (-671.265) * [-673.637] (-673.631) (-673.563) (-673.854) -- 0:00:05
937000 -- (-671.728) (-673.859) [-671.033] (-671.378) * [-672.717] (-672.571) (-672.412) (-671.357) -- 0:00:05
937500 -- (-671.113) (-672.761) (-671.125) [-673.340] * (-675.533) [-670.881] (-672.815) (-677.907) -- 0:00:05
938000 -- [-677.326] (-673.306) (-671.319) (-674.433) * (-673.677) (-673.083) [-674.353] (-675.981) -- 0:00:05
938500 -- (-673.612) (-673.750) (-672.670) [-674.109] * (-674.825) [-670.963] (-672.235) (-674.239) -- 0:00:05
939000 -- (-672.029) (-672.995) [-672.934] (-672.774) * [-670.689] (-672.354) (-673.103) (-675.663) -- 0:00:05
939500 -- (-673.721) (-674.298) [-671.765] (-672.278) * (-671.126) [-672.175] (-671.387) (-671.537) -- 0:00:05
940000 -- [-671.414] (-676.109) (-677.023) (-672.318) * (-673.124) (-671.227) (-674.613) [-671.212] -- 0:00:04
Average standard deviation of split frequencies: 0.010802
940500 -- [-672.802] (-673.123) (-674.025) (-673.455) * (-674.867) (-671.614) [-671.818] (-676.241) -- 0:00:04
941000 -- [-675.177] (-672.820) (-672.208) (-673.450) * (-675.240) (-672.955) [-675.265] (-671.589) -- 0:00:04
941500 -- (-670.825) (-671.745) (-672.548) [-672.191] * [-671.877] (-671.658) (-675.954) (-671.924) -- 0:00:04
942000 -- (-670.517) (-670.860) (-671.682) [-671.975] * (-673.506) (-671.531) (-673.845) [-671.051] -- 0:00:04
942500 -- (-670.724) (-672.802) [-673.396] (-677.565) * (-673.864) (-670.889) (-673.059) [-670.626] -- 0:00:04
943000 -- (-672.816) [-671.525] (-673.947) (-672.989) * (-675.783) [-670.779] (-670.940) (-671.254) -- 0:00:04
943500 -- (-671.001) [-671.080] (-675.637) (-672.837) * (-672.411) [-672.420] (-671.524) (-671.623) -- 0:00:04
944000 -- (-674.045) [-671.878] (-673.826) (-671.519) * [-671.056] (-671.732) (-672.841) (-671.555) -- 0:00:04
944500 -- (-676.661) [-673.350] (-670.666) (-672.397) * (-673.899) (-679.097) [-671.209] (-671.283) -- 0:00:04
945000 -- [-673.233] (-675.229) (-671.498) (-673.116) * (-671.207) (-675.257) (-673.344) [-672.090] -- 0:00:04
Average standard deviation of split frequencies: 0.011129
945500 -- (-671.382) [-675.600] (-674.289) (-671.625) * [-671.327] (-671.145) (-672.381) (-671.693) -- 0:00:04
946000 -- (-671.522) [-672.092] (-677.417) (-673.805) * [-671.433] (-673.442) (-674.495) (-673.758) -- 0:00:04
946500 -- (-672.782) [-671.548] (-671.062) (-671.490) * (-674.539) (-674.356) (-672.730) [-672.945] -- 0:00:04
947000 -- (-671.437) (-671.012) (-670.566) [-674.424] * [-673.032] (-673.070) (-671.262) (-672.426) -- 0:00:04
947500 -- (-670.529) (-675.885) (-675.505) [-671.591] * (-673.180) [-671.324] (-673.576) (-671.426) -- 0:00:04
948000 -- (-672.424) (-673.793) (-671.363) [-672.335] * (-676.557) (-672.005) (-671.855) [-671.825] -- 0:00:04
948500 -- (-671.260) [-673.396] (-672.513) (-671.859) * (-675.605) [-672.553] (-672.874) (-673.625) -- 0:00:04
949000 -- (-671.898) (-672.898) [-672.898] (-673.816) * (-671.524) (-671.888) [-671.264] (-672.137) -- 0:00:04
949500 -- (-672.826) (-674.288) [-673.960] (-673.143) * (-672.425) [-674.163] (-672.935) (-673.805) -- 0:00:04
950000 -- (-675.594) (-675.089) (-671.664) [-672.224] * [-674.022] (-673.932) (-672.728) (-674.643) -- 0:00:04
Average standard deviation of split frequencies: 0.010909
950500 -- (-671.810) [-673.037] (-672.918) (-674.255) * (-673.327) [-675.268] (-671.897) (-672.235) -- 0:00:04
951000 -- (-672.315) (-674.245) [-674.478] (-673.608) * (-674.248) [-671.611] (-671.703) (-672.490) -- 0:00:04
951500 -- [-676.252] (-671.899) (-672.402) (-672.264) * (-671.991) (-679.315) (-670.838) [-672.810] -- 0:00:04
952000 -- (-675.996) (-671.078) [-674.806] (-673.989) * (-672.973) (-672.310) [-671.394] (-670.913) -- 0:00:03
952500 -- (-677.647) (-674.555) [-675.225] (-674.157) * [-672.920] (-674.948) (-671.954) (-670.550) -- 0:00:03
953000 -- (-672.632) (-674.769) [-675.120] (-675.588) * (-674.771) [-674.973] (-671.138) (-673.467) -- 0:00:03
953500 -- (-671.425) [-673.357] (-670.754) (-674.087) * (-676.215) (-672.267) [-674.086] (-672.172) -- 0:00:03
954000 -- [-671.343] (-673.698) (-672.845) (-671.813) * [-675.536] (-672.638) (-671.068) (-672.399) -- 0:00:03
954500 -- [-671.413] (-671.990) (-673.561) (-672.098) * (-674.730) (-672.364) (-672.007) [-671.775] -- 0:00:03
955000 -- (-674.965) [-673.973] (-672.285) (-673.809) * (-672.586) [-674.196] (-672.279) (-671.610) -- 0:00:03
Average standard deviation of split frequencies: 0.010876
955500 -- (-673.103) (-676.650) [-673.490] (-674.511) * [-673.449] (-674.760) (-673.622) (-671.946) -- 0:00:03
956000 -- (-675.001) [-671.478] (-674.507) (-672.915) * (-672.299) [-672.645] (-672.779) (-672.146) -- 0:00:03
956500 -- [-672.921] (-672.069) (-673.146) (-670.934) * (-675.881) [-671.226] (-673.059) (-671.957) -- 0:00:03
957000 -- (-671.774) [-671.751] (-671.472) (-671.559) * [-676.067] (-671.211) (-672.888) (-672.470) -- 0:00:03
957500 -- (-675.303) [-672.041] (-675.046) (-674.867) * (-672.364) [-672.962] (-672.211) (-677.502) -- 0:00:03
958000 -- [-674.133] (-673.270) (-672.187) (-673.512) * (-674.914) [-674.423] (-673.064) (-676.233) -- 0:00:03
958500 -- (-675.938) (-673.360) (-673.063) [-673.455] * (-674.813) (-678.254) (-673.442) [-672.412] -- 0:00:03
959000 -- [-671.329] (-672.478) (-671.196) (-673.777) * (-674.282) (-676.650) [-672.223] (-672.707) -- 0:00:03
959500 -- (-672.341) [-672.064] (-674.557) (-674.479) * (-676.575) [-673.132] (-671.420) (-672.407) -- 0:00:03
960000 -- (-674.541) (-671.479) (-672.031) [-673.171] * (-671.788) (-671.348) [-671.358] (-672.888) -- 0:00:03
Average standard deviation of split frequencies: 0.010905
960500 -- (-675.886) (-671.393) [-672.995] (-674.205) * (-672.566) (-672.260) [-672.755] (-671.631) -- 0:00:03
961000 -- (-672.416) (-672.251) [-673.460] (-673.675) * (-672.053) (-672.796) [-672.498] (-672.733) -- 0:00:03
961500 -- (-675.335) (-675.748) (-671.791) [-672.482] * (-674.174) (-672.877) [-672.923] (-671.686) -- 0:00:03
962000 -- (-672.941) [-673.665] (-675.680) (-673.877) * (-672.953) [-671.498] (-675.550) (-672.534) -- 0:00:03
962500 -- [-671.524] (-671.279) (-674.899) (-673.050) * (-672.990) (-670.835) [-674.012] (-671.800) -- 0:00:03
963000 -- [-672.545] (-673.337) (-677.166) (-674.735) * (-673.626) [-674.034] (-671.776) (-676.762) -- 0:00:03
963500 -- (-672.230) [-671.578] (-672.651) (-675.469) * (-675.156) [-672.009] (-671.580) (-671.289) -- 0:00:03
964000 -- (-674.086) (-672.315) (-671.764) [-672.158] * (-671.371) (-674.808) [-674.652] (-672.953) -- 0:00:02
964500 -- (-676.050) (-676.685) (-672.827) [-672.374] * (-671.497) [-670.921] (-671.769) (-674.166) -- 0:00:02
965000 -- [-673.400] (-671.703) (-672.885) (-671.596) * (-673.531) (-676.406) [-673.088] (-672.891) -- 0:00:02
Average standard deviation of split frequencies: 0.011224
965500 -- (-676.377) (-673.765) [-670.455] (-672.619) * (-671.287) (-675.869) [-672.648] (-673.086) -- 0:00:02
966000 -- (-675.590) (-672.560) [-671.068] (-672.209) * (-673.161) [-670.566] (-673.639) (-673.212) -- 0:00:02
966500 -- (-671.341) (-674.834) [-671.214] (-673.130) * [-673.639] (-671.809) (-673.949) (-672.979) -- 0:00:02
967000 -- (-671.791) [-672.479] (-670.914) (-672.726) * (-670.998) [-674.357] (-673.822) (-673.804) -- 0:00:02
967500 -- (-672.025) (-672.906) (-674.679) [-671.836] * (-671.239) [-672.594] (-673.300) (-671.953) -- 0:00:02
968000 -- (-672.197) [-672.435] (-673.743) (-672.170) * (-671.694) (-673.330) [-671.967] (-671.642) -- 0:00:02
968500 -- (-671.238) (-673.706) [-673.762] (-673.510) * (-670.641) (-676.060) [-671.037] (-670.888) -- 0:00:02
969000 -- (-676.784) [-672.698] (-672.626) (-671.474) * (-671.949) (-681.510) (-671.299) [-672.330] -- 0:00:02
969500 -- (-672.869) (-672.864) (-672.737) [-671.030] * (-672.811) (-674.454) [-674.820] (-674.295) -- 0:00:02
970000 -- (-673.396) [-670.821] (-673.097) (-673.478) * (-673.820) [-672.328] (-676.454) (-673.254) -- 0:00:02
Average standard deviation of split frequencies: 0.010873
970500 -- (-671.766) (-671.612) [-674.234] (-671.199) * (-677.094) (-673.966) [-672.293] (-673.091) -- 0:00:02
971000 -- (-671.280) [-673.881] (-675.883) (-671.606) * (-675.456) [-673.965] (-675.794) (-672.874) -- 0:00:02
971500 -- [-673.362] (-674.280) (-676.207) (-676.095) * (-672.359) (-674.563) [-682.859] (-674.935) -- 0:00:02
972000 -- (-674.432) [-676.728] (-676.311) (-675.558) * (-672.442) (-673.826) (-676.794) [-672.025] -- 0:00:02
972500 -- [-672.835] (-677.418) (-673.536) (-675.725) * [-673.122] (-674.363) (-672.795) (-674.153) -- 0:00:02
973000 -- [-673.092] (-675.515) (-677.422) (-675.629) * [-672.383] (-672.349) (-672.340) (-672.319) -- 0:00:02
973500 -- (-673.175) [-670.897] (-673.740) (-674.210) * (-671.965) [-672.684] (-677.687) (-671.741) -- 0:00:02
974000 -- (-674.550) [-673.078] (-672.311) (-672.837) * (-672.101) (-672.225) (-677.912) [-673.081] -- 0:00:02
974500 -- (-673.387) (-671.304) (-671.744) [-671.818] * (-672.676) (-671.071) [-681.428] (-670.850) -- 0:00:02
975000 -- (-673.717) (-673.561) [-673.804] (-671.293) * (-672.279) (-675.592) (-676.852) [-673.030] -- 0:00:02
Average standard deviation of split frequencies: 0.010358
975500 -- (-673.647) (-675.115) [-672.584] (-672.649) * (-675.515) [-672.215] (-675.276) (-671.818) -- 0:00:02
976000 -- (-672.249) [-676.660] (-673.812) (-674.443) * (-675.463) (-673.646) (-672.379) [-671.930] -- 0:00:01
976500 -- [-671.219] (-672.327) (-670.996) (-674.310) * [-671.650] (-671.069) (-673.905) (-672.359) -- 0:00:01
977000 -- [-672.723] (-672.433) (-672.269) (-675.672) * (-671.643) (-671.509) [-673.332] (-672.435) -- 0:00:01
977500 -- (-673.583) (-679.749) (-672.997) [-671.737] * [-671.750] (-670.804) (-671.522) (-671.866) -- 0:00:01
978000 -- (-671.466) (-675.718) [-672.989] (-671.705) * (-671.826) (-672.749) (-672.878) [-670.833] -- 0:00:01
978500 -- (-675.372) [-671.650] (-671.182) (-677.032) * (-673.553) (-674.496) (-672.914) [-673.326] -- 0:00:01
979000 -- (-673.564) [-672.024] (-671.820) (-674.898) * (-674.978) [-673.067] (-671.805) (-673.512) -- 0:00:01
979500 -- (-673.613) (-671.684) [-672.890] (-676.056) * (-672.870) (-671.073) (-674.198) [-672.843] -- 0:00:01
980000 -- [-673.758] (-672.036) (-671.740) (-678.802) * (-674.679) [-671.496] (-674.866) (-671.699) -- 0:00:01
Average standard deviation of split frequencies: 0.010068
980500 -- (-674.279) (-676.576) (-671.490) [-674.213] * (-673.565) (-673.440) (-671.549) [-675.079] -- 0:00:01
981000 -- (-673.978) (-674.626) [-672.368] (-675.432) * (-670.942) [-673.940] (-671.430) (-674.655) -- 0:00:01
981500 -- (-674.414) (-672.589) [-671.775] (-674.780) * (-672.933) [-674.004] (-671.014) (-672.747) -- 0:00:01
982000 -- (-673.096) (-671.163) [-672.168] (-672.928) * (-677.306) [-672.804] (-670.998) (-677.178) -- 0:00:01
982500 -- (-676.965) [-670.712] (-672.536) (-671.394) * (-672.998) (-677.484) (-671.410) [-674.144] -- 0:00:01
983000 -- (-677.564) [-670.897] (-675.949) (-672.048) * (-672.045) [-676.439] (-671.486) (-673.989) -- 0:00:01
983500 -- (-676.782) [-673.400] (-675.648) (-671.352) * [-673.259] (-673.966) (-675.584) (-675.883) -- 0:00:01
984000 -- [-673.666] (-673.780) (-677.703) (-678.878) * (-671.999) [-672.518] (-671.329) (-672.917) -- 0:00:01
984500 -- (-671.827) (-672.193) (-677.696) [-671.803] * [-672.589] (-676.429) (-671.742) (-674.357) -- 0:00:01
985000 -- (-673.468) [-672.384] (-674.739) (-674.179) * (-673.629) [-672.837] (-675.528) (-673.172) -- 0:00:01
Average standard deviation of split frequencies: 0.010040
985500 -- (-671.433) [-672.228] (-673.160) (-673.547) * (-671.520) [-672.104] (-671.225) (-671.964) -- 0:00:01
986000 -- (-677.327) [-673.843] (-670.839) (-673.561) * (-672.118) (-671.622) [-672.873] (-674.570) -- 0:00:01
986500 -- (-676.917) (-673.168) [-673.662] (-673.548) * (-672.892) (-672.704) (-672.022) [-672.766] -- 0:00:01
987000 -- (-672.816) [-672.355] (-674.236) (-671.342) * (-671.883) [-674.094] (-672.230) (-674.045) -- 0:00:01
987500 -- [-671.786] (-672.524) (-675.395) (-671.348) * (-674.011) (-672.843) [-672.475] (-673.979) -- 0:00:01
988000 -- (-672.546) (-672.796) (-670.628) [-671.364] * (-671.553) (-673.811) [-672.655] (-673.655) -- 0:00:00
988500 -- (-675.302) (-671.348) (-671.367) [-671.529] * (-673.448) (-673.743) (-673.363) [-673.229] -- 0:00:00
989000 -- (-675.497) (-673.340) [-670.993] (-674.639) * [-673.345] (-676.983) (-671.358) (-672.558) -- 0:00:00
989500 -- [-672.372] (-673.788) (-672.524) (-673.919) * [-673.630] (-673.874) (-671.903) (-671.940) -- 0:00:00
990000 -- [-673.402] (-673.497) (-675.889) (-672.045) * (-674.558) [-673.674] (-673.145) (-673.475) -- 0:00:00
Average standard deviation of split frequencies: 0.009993
990500 -- (-673.966) [-673.473] (-674.885) (-671.125) * (-671.820) (-673.637) (-672.606) [-673.324] -- 0:00:00
991000 -- (-673.051) (-675.772) [-673.583] (-672.169) * [-675.490] (-671.382) (-676.412) (-672.515) -- 0:00:00
991500 -- (-673.597) [-671.275] (-675.906) (-670.797) * (-677.900) (-672.660) (-671.018) [-673.576] -- 0:00:00
992000 -- (-672.048) (-673.626) (-673.248) [-671.912] * (-677.864) (-674.614) [-672.977] (-672.206) -- 0:00:00
992500 -- [-672.974] (-672.368) (-673.681) (-671.719) * [-673.580] (-673.272) (-671.790) (-671.483) -- 0:00:00
993000 -- [-672.855] (-673.097) (-674.362) (-672.762) * (-670.950) [-672.436] (-675.200) (-671.919) -- 0:00:00
993500 -- [-672.842] (-675.159) (-674.127) (-674.028) * [-671.218] (-670.579) (-670.754) (-672.875) -- 0:00:00
994000 -- (-672.527) [-671.414] (-672.813) (-670.502) * [-673.018] (-675.056) (-671.798) (-672.587) -- 0:00:00
994500 -- (-673.859) (-671.067) (-674.818) [-673.441] * (-672.033) (-676.293) [-674.422] (-675.072) -- 0:00:00
995000 -- (-671.669) [-673.149] (-674.271) (-672.394) * (-673.210) (-673.812) (-672.270) [-673.258] -- 0:00:00
Average standard deviation of split frequencies: 0.009911
995500 -- (-673.067) [-671.795] (-673.520) (-671.017) * (-671.811) (-675.490) [-674.280] (-673.384) -- 0:00:00
996000 -- (-671.899) (-674.521) (-675.692) [-673.143] * (-673.620) (-672.574) (-675.685) [-672.929] -- 0:00:00
996500 -- (-672.878) (-673.898) [-673.036] (-672.671) * (-671.575) (-674.254) [-678.386] (-672.850) -- 0:00:00
997000 -- [-670.764] (-671.494) (-675.065) (-671.116) * (-671.013) (-672.850) [-672.494] (-672.867) -- 0:00:00
997500 -- (-672.895) (-671.196) (-672.495) [-674.865] * (-671.965) (-673.400) [-672.336] (-671.449) -- 0:00:00
998000 -- (-672.033) (-674.634) (-672.966) [-671.200] * (-673.633) (-672.421) (-675.605) [-672.009] -- 0:00:00
998500 -- (-675.506) (-673.252) (-673.321) [-671.341] * [-673.273] (-674.618) (-679.728) (-673.294) -- 0:00:00
999000 -- (-673.965) (-672.643) (-673.070) [-670.924] * (-671.412) [-672.042] (-677.245) (-672.766) -- 0:00:00
999500 -- [-673.390] (-673.418) (-676.125) (-671.415) * [-672.216] (-674.440) (-672.707) (-673.440) -- 0:00:00
1000000 -- [-673.483] (-670.727) (-674.408) (-671.325) * (-674.459) (-672.474) (-675.758) [-671.762] -- 0:00:00
Average standard deviation of split frequencies: 0.009948
Analysis completed in 1 mins 23 seconds
Analysis used 81.66 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -670.39
Likelihood of best state for "cold" chain of run 2 was -670.39
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.9 % ( 32 %) Dirichlet(Pi{all})
32.9 % ( 24 %) Slider(Pi{all})
78.6 % ( 59 %) Multiplier(Alpha{1,2})
77.8 % ( 51 %) Multiplier(Alpha{3})
24.3 % ( 31 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 32 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 74 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
31.6 % ( 32 %) Dirichlet(Pi{all})
33.1 % ( 28 %) Slider(Pi{all})
78.3 % ( 41 %) Multiplier(Alpha{1,2})
77.5 % ( 63 %) Multiplier(Alpha{3})
23.7 % ( 32 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 79 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 28 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.7 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166603 0.82 0.67
3 | 167327 166815 0.83
4 | 166413 165990 166852
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166763 0.82 0.67
3 | 167058 166146 0.84
4 | 166080 166391 167562
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -671.93
| 2 |
| |
| 1 1 1 |
|1 2 1 2 1 12 1 1|
| 1 2 1 12 12 2 * |
| 22 1 12 2 22 2 2 2222 211 11 1 |
|2 11 1* 1 2 1 2 2 11 2 1 2 1 22 |
| 12 2 1* 2 1 12 12 22111 2 |
| 2 2 2 2 1 1 21 111 1 1 * |
| 12 1 1 1 2 22 2 2|
| 1 2 2 1 1 2 2 * |
| 2 1 1 2 |
| 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -674.06
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -672.14 -675.56
2 -672.14 -676.34
--------------------------------------
TOTAL -672.14 -676.02
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898207 0.094608 0.364984 1.511781 0.872993 1355.40 1428.20 1.001
r(A<->C){all} 0.171384 0.020606 0.000014 0.450323 0.134509 132.79 214.70 1.002
r(A<->G){all} 0.168370 0.020503 0.000008 0.456746 0.135009 165.64 199.56 1.001
r(A<->T){all} 0.165826 0.020934 0.000052 0.462839 0.123981 280.66 307.58 1.000
r(C<->G){all} 0.169307 0.019676 0.000145 0.449158 0.135962 211.98 237.11 1.001
r(C<->T){all} 0.165661 0.018938 0.000088 0.438375 0.133011 168.40 231.42 1.002
r(G<->T){all} 0.159453 0.018659 0.000038 0.440636 0.126055 252.74 297.26 1.000
pi(A){all} 0.197118 0.000314 0.163442 0.232302 0.196943 1229.62 1339.83 1.000
pi(C){all} 0.261371 0.000394 0.224044 0.300942 0.260711 1136.35 1259.49 1.002
pi(G){all} 0.314222 0.000447 0.270770 0.352456 0.314377 1349.40 1379.44 1.001
pi(T){all} 0.227288 0.000350 0.189814 0.261492 0.226805 1286.19 1322.02 1.000
alpha{1,2} 0.403997 0.211337 0.000142 1.346516 0.236889 1150.88 1177.17 1.000
alpha{3} 0.448293 0.225653 0.000370 1.460072 0.291368 1072.07 1160.24 1.000
pinvar{all} 0.996669 0.000016 0.989086 0.999998 0.998000 1187.64 1210.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- ..*..*
9 -- ..****
10 -- .*...*
11 -- .*.*..
12 -- .***.*
13 -- ..*.*.
14 -- ....**
15 -- ...**.
16 -- ..**..
17 -- .**...
18 -- ...*.*
19 -- .*.***
20 -- .****.
21 -- .*..*.
22 -- .**..*
23 -- ..*.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 480 0.159893 0.013191 0.150566 0.169221 2
8 474 0.157895 0.009422 0.151233 0.164557 2
9 454 0.151233 0.003769 0.148568 0.153897 2
10 439 0.146236 0.015546 0.135243 0.157229 2
11 433 0.144237 0.000471 0.143904 0.144570 2
12 425 0.141572 0.012719 0.132578 0.150566 2
13 424 0.141239 0.016959 0.129247 0.153231 2
14 421 0.140240 0.018373 0.127249 0.153231 2
15 420 0.139907 0.003769 0.137242 0.142572 2
16 415 0.138241 0.001413 0.137242 0.139241 2
17 412 0.137242 0.010364 0.129913 0.144570 2
18 412 0.137242 0.009422 0.130580 0.143904 2
19 411 0.136909 0.014604 0.126582 0.147235 2
20 409 0.136243 0.003298 0.133911 0.138574 2
21 405 0.134910 0.018373 0.121919 0.147901 2
22 301 0.100266 0.005182 0.096602 0.103931 2
23 290 0.096602 0.012248 0.087941 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099321 0.009880 0.000144 0.299966 0.067645 1.000 2
length{all}[2] 0.103161 0.011625 0.000053 0.309995 0.068780 1.000 2
length{all}[3] 0.098042 0.009545 0.000000 0.290976 0.067679 1.000 2
length{all}[4] 0.097807 0.009676 0.000044 0.300509 0.068646 1.000 2
length{all}[5] 0.100928 0.010662 0.000047 0.303829 0.070793 1.000 2
length{all}[6] 0.097545 0.009767 0.000100 0.304018 0.066848 1.000 2
length{all}[7] 0.092573 0.009018 0.000128 0.286942 0.059594 1.002 2
length{all}[8] 0.093846 0.008553 0.000112 0.264842 0.070291 1.000 2
length{all}[9] 0.098069 0.011531 0.000010 0.290371 0.064126 0.998 2
length{all}[10] 0.095586 0.008926 0.000098 0.320838 0.059312 0.998 2
length{all}[11] 0.100282 0.009419 0.000197 0.298655 0.069492 0.998 2
length{all}[12] 0.102328 0.010181 0.000073 0.303274 0.065585 0.998 2
length{all}[13] 0.103523 0.012060 0.000045 0.341336 0.069051 0.998 2
length{all}[14] 0.101396 0.010706 0.000014 0.302736 0.067577 0.999 2
length{all}[15] 0.106139 0.011849 0.001051 0.338650 0.068380 1.004 2
length{all}[16] 0.103876 0.010694 0.000136 0.300783 0.073662 1.007 2
length{all}[17] 0.111354 0.012799 0.000585 0.331697 0.072241 0.998 2
length{all}[18] 0.109735 0.013712 0.000112 0.362013 0.069853 0.999 2
length{all}[19] 0.091839 0.007741 0.000080 0.253678 0.063751 0.998 2
length{all}[20] 0.102491 0.011850 0.000275 0.319836 0.067407 0.998 2
length{all}[21] 0.108830 0.011329 0.000164 0.294784 0.078019 1.013 2
length{all}[22] 0.096457 0.009213 0.000640 0.295739 0.072589 1.003 2
length{all}[23] 0.089989 0.007648 0.001482 0.267989 0.064433 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009948
Maximum standard deviation of split frequencies = 0.018373
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.013
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 537
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
48 ambiguity characters in seq. 1
48 ambiguity characters in seq. 2
48 ambiguity characters in seq. 3
48 ambiguity characters in seq. 4
96 ambiguity characters in seq. 5
96 ambiguity characters in seq. 6
32 sites are removed. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 147 / 147 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 147 / 147 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.094733 0.102079 0.082038 0.016512 0.086100 0.094285 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -656.129261
Iterating by ming2
Initial: fx= 656.129261
x= 0.09473 0.10208 0.08204 0.01651 0.08610 0.09428 0.30000 1.30000
1 h-m-p 0.0000 0.0001 352.2119 ++ 642.026686 m 0.0001 13 | 1/8
2 h-m-p 0.0009 0.0127 38.9834 -----------.. | 1/8
3 h-m-p 0.0000 0.0005 321.7432 +++ 594.548302 m 0.0005 45 | 2/8
4 h-m-p 0.0044 0.0344 29.4819 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 291.0674 ++ 592.150780 m 0.0000 77 | 3/8
6 h-m-p 0.0003 0.0561 24.6066 ----------.. | 3/8
7 h-m-p 0.0000 0.0001 252.1319 ++ 588.519664 m 0.0001 107 | 4/8
8 h-m-p 0.0006 0.0743 18.9612 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 206.1179 ++ 588.386902 m 0.0000 138 | 5/8
10 h-m-p 0.0002 0.1108 12.9167 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 145.6624 ++ 587.297590 m 0.0001 168 | 6/8
12 h-m-p 0.2890 8.0000 0.0000 +++ 587.297590 m 8.0000 180 | 6/8
13 h-m-p 0.1522 8.0000 0.0001 +++ 587.297590 m 8.0000 194 | 6/8
14 h-m-p 0.0160 8.0000 1.2901 +++++ 587.297554 m 8.0000 210 | 6/8
15 h-m-p 0.0855 0.4275 24.8636 --------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 587.297554 m 8.0000 247 | 6/8
17 h-m-p 0.0340 8.0000 0.0009 ---C 587.297554 0 0.0001 263 | 6/8
18 h-m-p 0.0160 8.0000 0.0018 ----------C 587.297554 0 0.0000 286 | 6/8
19 h-m-p 0.0160 8.0000 0.0000 +++++ 587.297554 m 8.0000 302 | 6/8
20 h-m-p 0.0094 4.6845 0.7928 -----------Y 587.297554 0 0.0000 326 | 6/8
21 h-m-p 0.0160 8.0000 0.0000 ----C 587.297554 0 0.0000 343 | 6/8
22 h-m-p 0.0160 8.0000 0.0000 ----------Y 587.297554 0 0.0000 366
Out..
lnL = -587.297554
367 lfun, 367 eigenQcodon, 2202 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.058386 0.065874 0.087831 0.038598 0.032798 0.074906 10.335336 0.758450 0.230828
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 2.502913
np = 9
lnL0 = -637.861266
Iterating by ming2
Initial: fx= 637.861266
x= 0.05839 0.06587 0.08783 0.03860 0.03280 0.07491 10.33534 0.75845 0.23083
1 h-m-p 0.0000 0.0002 333.5258 +++ 610.855840 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0003 131.8378 ++ 606.552381 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0000 280666.8903 ++ 595.054743 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0001 795.9391 ++ 591.497742 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0000 987.3025 ++ 591.407937 m 0.0000 63 | 5/9
6 h-m-p 0.0003 0.0579 6.5727 ----------.. | 5/9
7 h-m-p 0.0000 0.0001 204.2499 ++ 589.053356 m 0.0001 95 | 6/9
8 h-m-p 0.0023 0.1946 3.5051 ------------.. | 6/9
9 h-m-p 0.0000 0.0001 145.4997 ++ 587.297622 m 0.0001 129 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 587.297622 m 8.0000 141 | 6/9
11 h-m-p 0.0160 8.0000 0.0012 +++++ 587.297622 m 8.0000 158 | 6/9
12 h-m-p 0.0160 8.0000 0.6815 +++++ 587.297591 m 8.0000 176 | 6/9
13 h-m-p 0.5917 2.9586 1.7462 ++ 587.297584 m 2.9586 191 | 7/9
14 h-m-p 1.6000 8.0000 0.4236 ++ 587.297584 m 8.0000 203 | 7/9
15 h-m-p 1.6000 8.0000 0.8151 ++ 587.297584 m 8.0000 217 | 7/9
16 h-m-p 0.1857 0.9285 11.7630 ----------C 587.297584 0 0.0000 241 | 7/9
17 h-m-p 1.6000 8.0000 0.0000 Y 587.297584 0 1.6000 253 | 7/9
18 h-m-p 0.0160 8.0000 0.0000 --Y 587.297584 0 0.0003 269
Out..
lnL = -587.297584
270 lfun, 810 eigenQcodon, 3240 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.044435 0.109161 0.076288 0.027741 0.033091 0.055866 11.005898 1.283422 0.322327 0.429161 4.432395
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 1.233685
np = 11
lnL0 = -631.217825
Iterating by ming2
Initial: fx= 631.217825
x= 0.04444 0.10916 0.07629 0.02774 0.03309 0.05587 11.00590 1.28342 0.32233 0.42916 4.43239
1 h-m-p 0.0000 0.0002 277.5560 +++ 611.682229 m 0.0002 17 | 1/11
2 h-m-p 0.0013 0.0094 48.4041 ++ 591.578229 m 0.0094 31 | 2/11
3 h-m-p 0.0000 0.0002 34.2338 ++ 591.371853 m 0.0002 45 | 3/11
4 h-m-p 0.0000 0.0002 132.9292 ++ 587.606178 m 0.0002 59 | 4/11
5 h-m-p 0.0000 0.0002 7.4953 ++ 587.598211 m 0.0002 73 | 5/11
6 h-m-p 0.0000 0.0000 109.2653 ++ 587.486842 m 0.0000 87 | 6/11
7 h-m-p 0.0160 8.0000 0.3952 -------------.. | 6/11
8 h-m-p 0.0000 0.0000 145.1447 ++ 587.297584 m 0.0000 131 | 7/11
9 h-m-p 0.0160 8.0000 0.0000 C 587.297584 0 0.0040 145 | 6/11
10 h-m-p -0.0000 -0.0000 0.0126
h-m-p: -3.61420030e-14 -1.80710015e-13 1.26320718e-02 587.297584
.. | 6/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 587.297584 m 8.0000 182 | 6/11
12 h-m-p 0.0029 1.4431 0.9956 +++++ 587.297564 m 1.4431 204 | 7/11
13 h-m-p 1.6000 8.0000 0.3210 ++ 587.297557 m 8.0000 223 | 7/11
14 h-m-p 1.6000 8.0000 0.8420 ++ 587.297553 m 8.0000 241 | 7/11
15 h-m-p 1.6000 8.0000 3.9237 ++ 587.297546 m 8.0000 259 | 7/11
16 h-m-p 1.0299 5.1493 12.1320 ++ 587.297542 m 5.1493 273 | 7/11
17 h-m-p -0.0000 -0.0000 10.7320
h-m-p: -0.00000000e+00 -0.00000000e+00 1.07320356e+01 587.297542
.. | 7/11
18 h-m-p 0.0160 8.0000 0.0000 ---C 587.297542 0 0.0001 301 | 7/11
19 h-m-p 0.0160 8.0000 0.0000 C 587.297542 0 0.0160 319
Out..
lnL = -587.297542
320 lfun, 1280 eigenQcodon, 5760 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -587.294862 S = -587.294228 -0.000242
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:03
did 20 / 49 patterns 0:03
did 30 / 49 patterns 0:03
did 40 / 49 patterns 0:03
did 49 / 49 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076904 0.068561 0.027364 0.036712 0.087938 0.029851 10.725721 0.956916 1.423295
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 2.468830
np = 9
lnL0 = -633.945070
Iterating by ming2
Initial: fx= 633.945070
x= 0.07690 0.06856 0.02736 0.03671 0.08794 0.02985 10.72572 0.95692 1.42329
1 h-m-p 0.0000 0.0002 340.1995 +++ 611.094659 m 0.0002 15 | 1/9
2 h-m-p 0.0048 0.0787 12.6970 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 318.5554 ++ 609.323736 m 0.0000 49 | 2/9
4 h-m-p 0.0007 0.1551 7.0768 -----------.. | 2/9
5 h-m-p 0.0000 0.0000 284.6404 ++ 605.409021 m 0.0000 82 | 3/9
6 h-m-p 0.0020 0.1936 5.7778 ------------.. | 3/9
7 h-m-p 0.0000 0.0002 246.7926 +++ 591.471539 m 0.0002 117 | 4/9
8 h-m-p 0.0152 0.7113 2.9974 -------------.. | 4/9
9 h-m-p 0.0000 0.0001 205.9023 ++ 588.968522 m 0.0001 152 | 5/9
10 h-m-p 0.0029 0.7846 2.9798 ------------.. | 5/9
11 h-m-p 0.0000 0.0001 146.0284 ++ 587.297616 m 0.0001 186 | 6/9
12 h-m-p 0.4810 8.0000 0.0000 +++ 587.297616 m 8.0000 199 | 6/9
13 h-m-p 0.2523 8.0000 0.0001 +++ 587.297616 m 8.0000 215 | 6/9
14 h-m-p 0.0007 0.3591 4.3962 --------Y 587.297616 0 0.0000 238 | 6/9
15 h-m-p 0.0659 8.0000 0.0000 N 587.297616 0 0.0659 250 | 6/9
16 h-m-p 0.7515 8.0000 0.0000 --N 587.297616 0 0.0117 267
Out..
lnL = -587.297616
268 lfun, 2948 eigenQcodon, 16080 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065337 0.099070 0.101298 0.057694 0.057574 0.013881 10.725721 0.900000 0.809963 1.519608 3.713946
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.861323
np = 11
lnL0 = -636.748096
Iterating by ming2
Initial: fx= 636.748096
x= 0.06534 0.09907 0.10130 0.05769 0.05757 0.01388 10.72572 0.90000 0.80996 1.51961 3.71395
1 h-m-p 0.0000 0.0001 275.2922 ++ 627.423288 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0002 807.1784 ++ 600.183389 m 0.0002 30 | 2/11
3 h-m-p 0.0000 0.0000 95.0356 ++ 600.106153 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0027 30.3440 ++++ 598.846937 m 0.0027 60 | 4/11
5 h-m-p 0.0002 0.0008 208.5130 ++ 587.842400 m 0.0008 74 | 5/11
6 h-m-p 0.0042 0.0208 20.0404 ++ 587.814356 m 0.0208 88 | 5/11
7 h-m-p 0.6078 3.0392 0.3835 ----------------.. | 5/11
8 h-m-p 0.0000 0.0000 146.8371 ++ 587.297621 m 0.0000 136 | 6/11
9 h-m-p 0.1615 2.5477 0.0000 ++ 587.297621 m 2.5477 150 | 6/11
10 h-m-p 0.0000 0.0000 0.0046
h-m-p: 0.00000000e+00 0.00000000e+00 4.60897890e-03 587.297621
.. | 6/11
11 h-m-p 0.0160 8.0000 0.0003 +++++ 587.297620 m 8.0000 188 | 6/11
12 h-m-p 0.0236 8.0000 0.1185 +++++ 587.297554 m 8.0000 210 | 6/11
13 h-m-p 0.2624 1.3120 0.0407 ++ 587.297554 m 1.3120 229 | 7/11
14 h-m-p 1.6000 8.0000 0.0030 ++ 587.297554 m 8.0000 248 | 7/11
15 h-m-p 0.0098 1.2609 2.4749 -------------.. | 7/11
16 h-m-p 0.0160 8.0000 0.0000 ------------- | 7/11
17 h-m-p 0.0160 8.0000 0.0000 Y 587.297554 0 0.0160 320
Out..
lnL = -587.297554
321 lfun, 3852 eigenQcodon, 21186 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -587.297169 S = -587.294529 -0.001156
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:13
did 20 / 49 patterns 0:13
did 30 / 49 patterns 0:13
did 40 / 49 patterns 0:13
did 49 / 49 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=179
NC_011896_1_WP_010908378_1_1594_MLBR_RS07580 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NC_002677_1_NP_302057_1_929_ML1508 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270 ----------------MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470 ----------------MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS
**********************************
NC_011896_1_WP_010908378_1_1594_MLBR_RS07580 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
NC_002677_1_NP_302057_1_929_ML1508 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470 NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG
**************************************************
NC_011896_1_WP_010908378_1_1594_MLBR_RS07580 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
NC_002677_1_NP_302057_1_929_ML1508 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470 TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL
**************************************************
NC_011896_1_WP_010908378_1_1594_MLBR_RS07580 PILHVYGLPPGIR----------------
NC_002677_1_NP_302057_1_929_ML1508 PILHVYGLPPGIR----------------
NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025 PILHVYGLPPGIR----------------
NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790 PILHVYGLPPGIR----------------
NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270 PILHVYGLPPGIRoooooooooooooooo
NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470 PILHVYGLPPGIRoooooooooooooooo
*************
>NC_011896_1_WP_010908378_1_1594_MLBR_RS07580 ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG----------- ------------------------------------- >NC_002677_1_NP_302057_1_929_ML1508 ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG----------- ------------------------------------- >NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025 ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG----------- ------------------------------------- >NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790 ATGCGTTTCGGGGCCAGCTTGTTACGTGTGCGACGTAGGCTTTATGGCAT GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG----------- ------------------------------------- >NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270 ------------------------------------------------AT GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG----------- ------------------------------------- >NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470 ------------------------------------------------AT GGGAAGCCAAGTCTTCGACGACAAGCTGCTGGCTGTGATCAGTGGGAACT CCATCGGGGTGCTGGCCACTATCAAACGTGACGGGCGTCCCCAATTGTCG AACGTGCAGTATCACTTCGATCCGCGTGACTTAGCAGTTCGGGTCTCGAT CACCGAGCCAGGGGTTAAGACTCGTAACCTGCGCCGGGACCCACGTGCTT CGATCCTGGTCGATGTCGACGACGGATGGTCATATGCCGTCGCTGAGGGC ACAGCGGAGCTGACGCCACCCGCGGCCGCACCCGATGATGACACCGTCGA GGCGTTGATTGTTTTATATCGAAACATCGTCGGTGAGCATCTGGACTGGG ACGAATATCGACAGGCGATGGTGACCGATCGACGGGTGTTGCTGACGTTG CCGATCTTACACGTGTATGGTTTGCCTCCAGGAATACGG----------- -------------------------------------
>NC_011896_1_WP_010908378_1_1594_MLBR_RS07580 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL PILHVYGLPPGIR >NC_002677_1_NP_302057_1_929_ML1508 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL PILHVYGLPPGIR >NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL PILHVYGLPPGIR >NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790 MRFGASLLRVRRRLYGMGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL PILHVYGLPPGIR >NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270 ----------------MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL PILHVYGLPPGIR >NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470 ----------------MGSQVFDDKLLAVISGNSIGVLATIKRDGRPQLS NVQYHFDPRDLAVRVSITEPGVKTRNLRRDPRASILVDVDDGWSYAVAEG TAELTPPAAAPDDDTVEALIVLYRNIVGEHLDWDEYRQAMVTDRRVLLTL PILHVYGLPPGIR
#NEXUS
[ID: 5211743013]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908378_1_1594_MLBR_RS07580
NC_002677_1_NP_302057_1_929_ML1508
NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025
NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790
NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270
NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908378_1_1594_MLBR_RS07580,
2 NC_002677_1_NP_302057_1_929_ML1508,
3 NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025,
4 NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790,
5 NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270,
6 NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06764515,2:0.06878007,3:0.06767863,4:0.06864567,5:0.07079256,6:0.06684756);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06764515,2:0.06878007,3:0.06767863,4:0.06864567,5:0.07079256,6:0.06684756);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -672.14 -675.56
2 -672.14 -676.34
--------------------------------------
TOTAL -672.14 -676.02
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1508/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898207 0.094608 0.364984 1.511781 0.872993 1355.40 1428.20 1.001
r(A<->C){all} 0.171384 0.020606 0.000014 0.450323 0.134509 132.79 214.70 1.002
r(A<->G){all} 0.168370 0.020503 0.000008 0.456746 0.135009 165.64 199.56 1.001
r(A<->T){all} 0.165826 0.020934 0.000052 0.462839 0.123981 280.66 307.58 1.000
r(C<->G){all} 0.169307 0.019676 0.000145 0.449158 0.135962 211.98 237.11 1.001
r(C<->T){all} 0.165661 0.018938 0.000088 0.438375 0.133011 168.40 231.42 1.002
r(G<->T){all} 0.159453 0.018659 0.000038 0.440636 0.126055 252.74 297.26 1.000
pi(A){all} 0.197118 0.000314 0.163442 0.232302 0.196943 1229.62 1339.83 1.000
pi(C){all} 0.261371 0.000394 0.224044 0.300942 0.260711 1136.35 1259.49 1.002
pi(G){all} 0.314222 0.000447 0.270770 0.352456 0.314377 1349.40 1379.44 1.001
pi(T){all} 0.227288 0.000350 0.189814 0.261492 0.226805 1286.19 1322.02 1.000
alpha{1,2} 0.403997 0.211337 0.000142 1.346516 0.236889 1150.88 1177.17 1.000
alpha{3} 0.448293 0.225653 0.000370 1.460072 0.291368 1072.07 1160.24 1.000
pinvar{all} 0.996669 0.000016 0.989086 0.999998 0.998000 1187.64 1210.00 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/7res/ML1508/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 147
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 5 5 5 5 5 5 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 3 3 3 3 3 3 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 5 5 5 5 5 5
CTC 0 0 0 0 0 0 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 1 1 1 1 1 1
CTA 0 0 0 0 0 0 | CCA 4 4 4 4 4 4 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3
CTG 8 8 8 8 8 8 | CCG 2 2 2 2 2 2 | CAG 2 2 2 2 2 2 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 7 7 7 7 7 7 | ACC 3 3 3 3 3 3 | AAC 4 4 4 4 4 4 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 5 5 5 5 5 5 | Gly GGT 2 2 2 2 2 2
GTC 7 7 7 7 7 7 | GCC 3 3 3 3 3 3 | GAC 10 10 10 10 10 10 | GGC 1 1 1 1 1 1
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 1 1 1 1 1 1 | GGA 3 3 3 3 3 3
GTG 6 6 6 6 6 6 | GCG 4 4 4 4 4 4 | GAG 5 5 5 5 5 5 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908378_1_1594_MLBR_RS07580
position 1: T:0.14966 C:0.25850 A:0.19048 G:0.40136
position 2: T:0.30612 C:0.23810 A:0.27211 G:0.18367
position 3: T:0.19728 C:0.30612 A:0.14966 G:0.34694
Average T:0.21769 C:0.26757 A:0.20408 G:0.31066
#2: NC_002677_1_NP_302057_1_929_ML1508
position 1: T:0.14966 C:0.25850 A:0.19048 G:0.40136
position 2: T:0.30612 C:0.23810 A:0.27211 G:0.18367
position 3: T:0.19728 C:0.30612 A:0.14966 G:0.34694
Average T:0.21769 C:0.26757 A:0.20408 G:0.31066
#3: NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025
position 1: T:0.14966 C:0.25850 A:0.19048 G:0.40136
position 2: T:0.30612 C:0.23810 A:0.27211 G:0.18367
position 3: T:0.19728 C:0.30612 A:0.14966 G:0.34694
Average T:0.21769 C:0.26757 A:0.20408 G:0.31066
#4: NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790
position 1: T:0.14966 C:0.25850 A:0.19048 G:0.40136
position 2: T:0.30612 C:0.23810 A:0.27211 G:0.18367
position 3: T:0.19728 C:0.30612 A:0.14966 G:0.34694
Average T:0.21769 C:0.26757 A:0.20408 G:0.31066
#5: NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270
position 1: T:0.14966 C:0.25850 A:0.19048 G:0.40136
position 2: T:0.30612 C:0.23810 A:0.27211 G:0.18367
position 3: T:0.19728 C:0.30612 A:0.14966 G:0.34694
Average T:0.21769 C:0.26757 A:0.20408 G:0.31066
#6: NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470
position 1: T:0.14966 C:0.25850 A:0.19048 G:0.40136
position 2: T:0.30612 C:0.23810 A:0.27211 G:0.18367
position 3: T:0.19728 C:0.30612 A:0.14966 G:0.34694
Average T:0.21769 C:0.26757 A:0.20408 G:0.31066
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 30 | Cys C TGT 0
TTC 12 | TCC 6 | TAC 0 | TGC 0
Leu L TTA 18 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 18 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 30
CTC 0 | CCC 18 | CAC 12 | CGC 6
CTA 0 | CCA 24 | Gln Q CAA 12 | CGA 18
CTG 48 | CCG 12 | CAG 12 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 6
ATC 42 | ACC 18 | AAC 24 | AGC 6
ATA 6 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 30 | Gly G GGT 12
GTC 42 | GCC 18 | GAC 60 | GGC 6
GTA 0 | GCA 12 | Glu E GAA 6 | GGA 18
GTG 36 | GCG 24 | GAG 30 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14966 C:0.25850 A:0.19048 G:0.40136
position 2: T:0.30612 C:0.23810 A:0.27211 G:0.18367
position 3: T:0.19728 C:0.30612 A:0.14966 G:0.34694
Average T:0.21769 C:0.26757 A:0.20408 G:0.31066
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -587.297554 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 10.335336 3.713946
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908378_1_1594_MLBR_RS07580: 0.000004, NC_002677_1_NP_302057_1_929_ML1508: 0.000004, NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025: 0.000004, NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790: 0.000004, NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270: 0.000004, NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 10.33534
omega (dN/dS) = 3.71395
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 301.8 139.2 3.7139 0.0000 0.0000 0.0 0.0
7..2 0.000 301.8 139.2 3.7139 0.0000 0.0000 0.0 0.0
7..3 0.000 301.8 139.2 3.7139 0.0000 0.0000 0.0 0.0
7..4 0.000 301.8 139.2 3.7139 0.0000 0.0000 0.0 0.0
7..5 0.000 301.8 139.2 3.7139 0.0000 0.0000 0.0 0.0
7..6 0.000 301.8 139.2 3.7139 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -587.297584 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 11.005898 0.630514 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908378_1_1594_MLBR_RS07580: 0.000004, NC_002677_1_NP_302057_1_929_ML1508: 0.000004, NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025: 0.000004, NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790: 0.000004, NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270: 0.000004, NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 11.00590
MLEs of dN/dS (w) for site classes (K=2)
p: 0.63051 0.36949
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 301.3 139.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 301.3 139.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 301.3 139.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 301.3 139.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 301.3 139.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 301.3 139.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -587.297542 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 10.725721 0.000000 0.627743 1.000000 32.838998
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908378_1_1594_MLBR_RS07580: 0.000004, NC_002677_1_NP_302057_1_929_ML1508: 0.000004, NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025: 0.000004, NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790: 0.000004, NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270: 0.000004, NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 10.72572
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.62774 0.37226
w: 1.00000 1.00000 32.83900
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 301.5 139.5 12.8523 0.0000 0.0000 0.0 0.0
7..2 0.000 301.5 139.5 12.8523 0.0000 0.0000 0.0 0.0
7..3 0.000 301.5 139.5 12.8523 0.0000 0.0000 0.0 0.0
7..4 0.000 301.5 139.5 12.8523 0.0000 0.0000 0.0 0.0
7..5 0.000 301.5 139.5 12.8523 0.0000 0.0000 0.0 0.0
7..6 0.000 301.5 139.5 12.8523 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908378_1_1594_MLBR_RS07580)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908378_1_1594_MLBR_RS07580)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -587.297616 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 10.725721 0.957129 1.423624
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908378_1_1594_MLBR_RS07580: 0.000004, NC_002677_1_NP_302057_1_929_ML1508: 0.000004, NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025: 0.000004, NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790: 0.000004, NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270: 0.000004, NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 10.72572
Parameters in M7 (beta):
p = 0.95713 q = 1.42362
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.03077 0.09845 0.17077 0.24735 0.32853 0.41509 0.50838 0.61082 0.72742 0.87362
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 301.5 139.5 0.4011 0.0000 0.0000 0.0 0.0
7..2 0.000 301.5 139.5 0.4011 0.0000 0.0000 0.0 0.0
7..3 0.000 301.5 139.5 0.4011 0.0000 0.0000 0.0 0.0
7..4 0.000 301.5 139.5 0.4011 0.0000 0.0000 0.0 0.0
7..5 0.000 301.5 139.5 0.4011 0.0000 0.0000 0.0 0.0
7..6 0.000 301.5 139.5 0.4011 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -587.297554 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 10.723310 0.000010 0.875110 1.483302 3.713744
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908378_1_1594_MLBR_RS07580: 0.000004, NC_002677_1_NP_302057_1_929_ML1508: 0.000004, NZ_LVXE01000037_1_WP_010908378_1_1643_A3216_RS10025: 0.000004, NZ_LYPH01000042_1_WP_010908378_1_1631_A8144_RS07790: 0.000004, NZ_CP029543_1_WP_041323864_1_1624_DIJ64_RS08270: 0.000004, NZ_AP014567_1_WP_041323864_1_1664_JK2ML_RS08470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 10.72331
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.87511 q = 1.48330
(p1 = 0.99999) w = 3.71374
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.02175 0.07748 0.14136 0.21188 0.28899 0.37339 0.46654 0.57126 0.69357 0.85248 3.71374
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 301.5 139.5 3.7137 0.0000 0.0000 0.0 0.0
7..2 0.000 301.5 139.5 3.7137 0.0000 0.0000 0.0 0.0
7..3 0.000 301.5 139.5 3.7137 0.0000 0.0000 0.0 0.0
7..4 0.000 301.5 139.5 3.7137 0.0000 0.0000 0.0 0.0
7..5 0.000 301.5 139.5 3.7137 0.0000 0.0000 0.0 0.0
7..6 0.000 301.5 139.5 3.7137 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908378_1_1594_MLBR_RS07580)
Pr(w>1) post mean +- SE for w
1 M 1.000** 3.714
2 G 1.000** 3.714
3 S 1.000** 3.714
4 Q 1.000** 3.714
5 V 1.000** 3.714
6 F 1.000** 3.714
7 D 1.000** 3.714
8 D 1.000** 3.714
9 K 1.000** 3.714
10 L 1.000** 3.714
11 L 1.000** 3.714
12 A 1.000** 3.714
13 V 1.000** 3.714
14 I 1.000** 3.714
15 S 1.000** 3.714
16 G 1.000** 3.714
17 N 1.000** 3.714
18 S 1.000** 3.714
19 I 1.000** 3.714
20 G 1.000** 3.714
21 V 1.000** 3.714
22 L 1.000** 3.714
23 A 1.000** 3.714
24 T 1.000** 3.714
25 I 1.000** 3.714
26 K 1.000** 3.714
27 R 1.000** 3.714
28 D 1.000** 3.714
29 G 1.000** 3.714
30 R 1.000** 3.714
31 P 1.000** 3.714
32 Q 1.000** 3.714
33 L 1.000** 3.714
34 S 1.000** 3.714
35 N 1.000** 3.714
36 V 1.000** 3.714
37 Q 1.000** 3.714
38 Y 1.000** 3.714
39 H 1.000** 3.714
40 F 1.000** 3.714
41 D 1.000** 3.714
42 P 1.000** 3.714
43 R 1.000** 3.714
44 D 1.000** 3.714
45 L 1.000** 3.714
46 A 1.000** 3.714
47 V 1.000** 3.714
48 R 1.000** 3.714
49 V 1.000** 3.714
50 S 1.000** 3.714
51 I 1.000** 3.714
52 T 1.000** 3.714
53 E 1.000** 3.714
54 P 1.000** 3.714
55 G 1.000** 3.714
56 V 1.000** 3.714
57 K 1.000** 3.714
58 T 1.000** 3.714
59 R 1.000** 3.714
60 N 1.000** 3.714
61 L 1.000** 3.714
62 R 1.000** 3.714
63 R 1.000** 3.714
64 D 1.000** 3.714
65 P 1.000** 3.714
66 R 1.000** 3.714
67 A 1.000** 3.714
68 S 1.000** 3.714
69 I 1.000** 3.714
70 L 1.000** 3.714
71 V 1.000** 3.714
72 D 1.000** 3.714
73 V 1.000** 3.714
74 D 1.000** 3.714
75 D 1.000** 3.714
76 G 1.000** 3.714
77 W 1.000** 3.714
78 S 1.000** 3.714
79 Y 1.000** 3.714
80 A 1.000** 3.714
81 V 1.000** 3.714
82 A 1.000** 3.714
83 E 1.000** 3.714
84 G 1.000** 3.714
85 T 1.000** 3.714
86 A 1.000** 3.714
87 E 1.000** 3.714
88 L 1.000** 3.714
89 T 1.000** 3.714
90 P 1.000** 3.714
91 P 1.000** 3.714
92 A 1.000** 3.714
93 A 1.000** 3.714
94 A 1.000** 3.714
95 P 1.000** 3.714
96 D 1.000** 3.714
97 D 1.000** 3.714
98 D 1.000** 3.714
99 T 1.000** 3.714
100 V 1.000** 3.714
101 E 1.000** 3.714
102 A 1.000** 3.714
103 L 1.000** 3.714
104 I 1.000** 3.714
105 V 1.000** 3.714
106 L 1.000** 3.714
107 Y 1.000** 3.714
108 R 1.000** 3.714
109 N 1.000** 3.714
110 I 1.000** 3.714
111 V 1.000** 3.714
112 G 1.000** 3.714
113 E 1.000** 3.714
114 H 1.000** 3.714
115 L 1.000** 3.714
116 D 1.000** 3.714
117 W 1.000** 3.714
118 D 1.000** 3.714
119 E 1.000** 3.714
120 Y 1.000** 3.714
121 R 1.000** 3.714
122 Q 1.000** 3.714
123 A 1.000** 3.714
124 M 1.000** 3.714
125 V 1.000** 3.714
126 T 1.000** 3.714
127 D 1.000** 3.714
128 R 1.000** 3.714
129 R 1.000** 3.714
130 V 1.000** 3.714
131 L 1.000** 3.714
132 L 1.000** 3.714
133 T 1.000** 3.714
134 L 1.000** 3.714
135 P 1.000** 3.714
136 I 1.000** 3.714
137 L 1.000** 3.714
138 H 1.000** 3.714
139 V 1.000** 3.714
140 Y 1.000** 3.714
141 G 1.000** 3.714
142 L 1.000** 3.714
143 P 1.000** 3.714
144 P 1.000** 3.714
145 G 1.000** 3.714
146 I 1.000** 3.714
147 R 1.000** 3.714
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908378_1_1594_MLBR_RS07580)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -587.297584 Model 2: PositiveSelection -587.297542 Model 0: one-ratio -587.297554 Model 7: beta -587.297616 Model 8: beta&w>1 -587.297554 Model 0 vs 1 6.000000007588824E-5 Model 2 vs 1 8.400000001529406E-5 Model 8 vs 7 1.2399999991430377E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
