--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 25 22:08:35 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/1/7B2-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1707.51 -1717.27
2 -1707.53 -1716.27
--------------------------------------
TOTAL -1707.52 -1716.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.250284 0.001812 0.175794 0.334749 0.245365 1264.40 1266.40 1.000
r(A<->C){all} 0.050589 0.000590 0.007641 0.096738 0.047964 685.11 773.46 1.000
r(A<->G){all} 0.134176 0.001526 0.063370 0.214946 0.129489 750.82 762.41 1.000
r(A<->T){all} 0.098342 0.001641 0.028027 0.178055 0.093666 502.26 704.97 1.000
r(C<->G){all} 0.056909 0.000472 0.016484 0.101004 0.054295 1067.93 1090.11 1.000
r(C<->T){all} 0.549150 0.003753 0.434502 0.672232 0.548398 749.37 834.14 1.000
r(G<->T){all} 0.110833 0.001213 0.047554 0.181260 0.108426 831.97 839.64 1.000
pi(A){all} 0.218899 0.000200 0.193835 0.250215 0.218719 921.45 1067.86 1.000
pi(C){all} 0.289509 0.000230 0.258141 0.316866 0.289559 1188.79 1241.56 1.000
pi(G){all} 0.296254 0.000233 0.267775 0.328260 0.296253 1256.51 1285.55 1.000
pi(T){all} 0.195338 0.000174 0.169284 0.220775 0.195149 995.68 1069.76 1.000
alpha{1,2} 0.078933 0.003422 0.000121 0.187542 0.069087 1229.64 1365.32 1.000
alpha{3} 1.766941 0.549644 0.560301 3.230937 1.631806 1186.32 1218.60 1.000
pinvar{all} 0.381516 0.014608 0.139158 0.603162 0.394980 1125.19 1145.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1600.422646
Model 2: PositiveSelection -1600.422646
Model 0: one-ratio -1607.861631
Model 3: discrete -1599.82488
Model 7: beta -1599.968856
Model 8: beta&w>1 -1599.968863
Model 0 vs 1 14.877970000000005
Model 2 vs 1 0.0
Model 8 vs 7 1.4000000192027073E-5
>C1
MLFRSQSVYMMVAMLVVALSGYQVQSYSAKDILADVLMTDLLNRMDKDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVMPDPRLDDAVI
NPFLQGDRLPIAAKKGNLLFH
>C2
MLFRSQIVHMMVAMLVVASSGYQVQSYSSKDIFADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH
>C3
MLFRSQSVHMMVAMLVAASSCYQVQSYSSKDIFADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH
>C4
MLFCSQNVYMMVAMLVVALSGYQVQSYGSKDILADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSGAASHPSL
RDHEFLQHSSLWGHQFISGGMGEGPNRYPTIAKNDAGLPAYCNPPNPCPE
GYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSADTG
SEKGDLNSAVEQYILQMGQENSLNNVNSLVKKGGYPVMPDPRLDDAVMNP
FLQGDRLPIAAKKGNLLFHoo
>C5
MLFRSQSVHMMVAMLVVASSGYQVQSYGSKDILADVLLTDLLNRMDNDMQ
VGYYDVGNEAAADSKDNVDLVSRSEYARLCEGGSDCILQSGSGAASHPSL
RDHEFVQHSSLWGHQFISGGMGEGPNRYPAIVKNDAGLPAYCNPPNPCPE
GYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSADTG
AEKGDLHSAVEQYILQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVLNP
FLQGDRLPIAAKKGNLLFHoo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=273
C1 MLFRSQSVYMMVAMLVVALSGYQVQSYSAKDILADVLMTDLLNRMDKDMQ
C2 MLFRSQIVHMMVAMLVVASSGYQVQSYSSKDIFADALLTDLLNRMDNDMQ
C3 MLFRSQSVHMMVAMLVAASSCYQVQSYSSKDIFADALLTDLLNRMDNDMQ
C4 MLFCSQNVYMMVAMLVVALSGYQVQSYGSKDILADALLTDLLNRMDNDMQ
C5 MLFRSQSVHMMVAMLVVASSGYQVQSYGSKDILADVLLTDLLNRMDNDMQ
*** ** *:*******.* * ******.:***:**.*:********:***
C1 VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
C2 VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
C3 VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
C4 VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSG--SGAASHP
C5 VGYYDVGNEAAADSKDNVDLVSRSEYARLCEGGSDCILQSG--SGAASHP
************.*****************:********** *******
C1 SLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
C2 SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
C3 SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
C4 SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIAKNDAGLPAYCNPPNPC
C5 SLRDHEFVQHSSLWGHQFISGGMGEGPNRYPAIVKNDAGLPAYCNPPNPC
****.**:***********************:*.****************
C1 PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
C2 PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
C3 PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
C4 PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
C5 PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
**************************************************
C1 VGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVMPDPRLDDAVI
C2 VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
C3 VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
C4 TGSEKGDLNSAVEQYILQMGQENSLNNVNSLVKKGGYPVMPDPRLDDAVM
C5 TGAEKGDLHSAVEQYILQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVL
.*.:****:*******:**************.**.**************:
C1 NPFLQGDRLPIAAKKGNLLFH--
C2 NPFLQGDRLPIAAKKGNLLFH--
C3 NPFLQGDRLPIAAKKGNLLFH--
C4 NPFLQGDRLPIAAKKGNLLFHoo
C5 NPFLQGDRLPIAAKKGNLLFHoo
*********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
s S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5504]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5504]--->[5504]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/1/7B2-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.282 Mb, Max= 30.572 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MLFRSQSVYMMVAMLVVALSGYQVQSYSAKDILADVLMTDLLNRMDKDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVMPDPRLDDAVI
NPFLQGDRLPIAAKKGNLLFH--
>C2
MLFRSQIVHMMVAMLVVASSGYQVQSYSSKDIFADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH--
>C3
MLFRSQSVHMMVAMLVAASSCYQVQSYSSKDIFADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH--
>C4
MLFCSQNVYMMVAMLVVALSGYQVQSYGSKDILADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSG--SGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIAKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
TGSEKGDLNSAVEQYILQMGQENSLNNVNSLVKKGGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFHoo
>C5
MLFRSQSVHMMVAMLVVASSGYQVQSYGSKDILADVLLTDLLNRMDNDMQ
VGYYDVGNEAAADSKDNVDLVSRSEYARLCEGGSDCILQSG--SGAASHP
SLRDHEFVQHSSLWGHQFISGGMGEGPNRYPAIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
TGAEKGDLHSAVEQYILQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVL
NPFLQGDRLPIAAKKGNLLFHoo
FORMAT of file /tmp/tmp5856793777052895930aln Not Supported[FATAL:T-COFFEE]
>C1
MLFRSQSVYMMVAMLVVALSGYQVQSYSAKDILADVLMTDLLNRMDKDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVMPDPRLDDAVI
NPFLQGDRLPIAAKKGNLLFH--
>C2
MLFRSQIVHMMVAMLVVASSGYQVQSYSSKDIFADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH--
>C3
MLFRSQSVHMMVAMLVAASSCYQVQSYSSKDIFADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH--
>C4
MLFCSQNVYMMVAMLVVALSGYQVQSYGSKDILADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSG--SGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIAKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
TGSEKGDLNSAVEQYILQMGQENSLNNVNSLVKKGGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFHoo
>C5
MLFRSQSVHMMVAMLVVASSGYQVQSYGSKDILADVLLTDLLNRMDNDMQ
VGYYDVGNEAAADSKDNVDLVSRSEYARLCEGGSDCILQSG--SGAASHP
SLRDHEFVQHSSLWGHQFISGGMGEGPNRYPAIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
TGAEKGDLHSAVEQYILQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVL
NPFLQGDRLPIAAKKGNLLFHoo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:273 S:99 BS:273
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 95.20 C1 C2 95.20
TOP 1 0 95.20 C2 C1 95.20
BOT 0 2 94.83 C1 C3 94.83
TOP 2 0 94.83 C3 C1 94.83
BOT 0 3 94.05 C1 C4 94.05
TOP 3 0 94.05 C4 C1 94.05
BOT 0 4 93.31 C1 C5 93.31
TOP 4 0 93.31 C5 C1 93.31
BOT 1 2 98.89 C2 C3 98.89
TOP 2 1 98.89 C3 C2 98.89
BOT 1 3 95.91 C2 C4 95.91
TOP 3 1 95.91 C4 C2 95.91
BOT 1 4 95.54 C2 C5 95.54
TOP 4 1 95.54 C5 C2 95.54
BOT 2 3 95.17 C3 C4 95.17
TOP 3 2 95.17 C4 C3 95.17
BOT 2 4 95.17 C3 C5 95.17
TOP 4 2 95.17 C5 C3 95.17
BOT 3 4 94.83 C4 C5 94.83
TOP 4 3 94.83 C5 C4 94.83
AVG 0 C1 * 94.35
AVG 1 C2 * 96.39
AVG 2 C3 * 96.02
AVG 3 C4 * 94.99
AVG 4 C5 * 94.71
TOT TOT * 95.29
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTTGTTCCGTTCGCAAAGTGTGTACATGATGGTGGCGATGCTCGTGGT
C2 ATGTTGTTCCGTTCGCAAATTGTGCACATGATGGTGGCGATGCTCGTGGT
C3 ATGTTGTTCCGTTCGCAAAGTGTGCACATGATGGTGGCGATGCTCGTGGC
C4 ATGTTGTTCTGTTCGCAAAATGTGTACATGATGGTTGCGATGCTTGTGGT
C5 ATGTTGTTCCGTTCGCAAAGTGTGCACATGATGGTTGCGATGCTGGTGGT
********* ********* **** ********** ******** ****
C1 CGCCTTGAGTGGCTACCAGGTGCAGTCCTATAGCGCCAAGGATATTCTTG
C2 CGCCTCGAGTGGCTACCAGGTGCAGTCCTATAGCTCCAAGGATATTTTTG
C3 CGCCTCGAGCTGCTACCAGGTGCAGTCCTATAGCTCCAAGGATATTTTTG
C4 CGCCTTAAGTGGCTACCAGGTTCAGTCCTATGGCTCCAAGGATATTTTGG
C5 GGCCTCAAGTGGCTACCAGGTGCAGTCCTATGGCTCCAAGGATATTTTGG
**** .** ********** *********.** *********** * *
C1 CCGATGTCTTGATGACGGATCTGCTGAATCGCATGGACAAAGACATGCAG
C2 CCGATGCCTTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG
C3 CCGATGCCTTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG
C4 CCGATGCCCTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG
C5 CCGATGTCCTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG
****** * **.************* **************.*********
C1 GTGGGCTATTACGACGTGGGCAACGAGGCAGCCGCTGGCTCCAAGGACAA
C2 GTGGGCTACTACGACGTGGGCAACGAGGCAGCCGCTGGCTCCAAGGACAA
C3 GTGGGCTACTACGACGTGGGCAACGAAGCAGCCGCTGGCTCCAAGGACAA
C4 GTAGGCTACTACGATGTTGGCAACGAGGCAGCTGCTGGCTCCAAGGACAA
C5 GTGGGCTACTACGACGTGGGCAACGAGGCAGCTGCTGACTCCAAGGACAA
**.***** ***** ** ********.***** ****.************
C1 CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA
C2 CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA
C3 CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA
C4 TGTGGACCTGGTCTCCCGATCGGAATACGCGAGGCTGTGTGATGGGGGAA
C5 TGTGGACCTGGTCTCCCGATCGGAGTACGCGAGGCTGTGTGAGGGGGGAA
*****************.*****.***************** ** ****
C1 GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCATCCT
C2 GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCACCCT
C3 GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCACCCT
C4 GCGACTGCATCTTGCAATCGGGA------TCGGGAGCAGCCTCCCATCCT
C5 GCGACTGCATCTTGCAATCGGGA------TCGGGAGCAGCCTCCCATCCT
*********** **********. ********:******** ***
C1 TCGCTGCGGGATGACGAGTTTCTGCAGCACAGTTCGCTGTGGGGTCACCA
C2 TCGCTGCGGGACCACGAGTTCCTGCAGCACAGCTCGCTGTGGGGTCACCA
C3 TCGCTGCGGGACCACGAGTTCCTGCAGCACAGCTCGCTGTGGGGTCACCA
C4 TCGTTGAGGGACCACGAGTTCCTGCAGCACAGCTCCCTGTGGGGTCACCA
C5 TCGTTGAGGGACCACGAGTTCGTGCAGCACAGCTCGCTGTGGGGTCACCA
*** **.**** ******* ********** ** **************
C1 GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACAGGTATCCCACTATAG
C2 GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACCGGTATCCCACCATAG
C3 GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACCGGTATCCCACCATAG
C4 GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAATAGGTATCCTACCATAG
C5 GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAATAGGTATCCTGCCATAG
********************************* .******* .* ****
C1 TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC
C2 TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC
C3 TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC
C4 CGAAGAATGACGCCGGTCTGCCTGCATACTGCAACCCTCCAAACCCTTGC
C5 TGAAGAACGACGCCGGTCTGCCAGCCTACTGCAACCCTCCTAATCCATGC
****** ******** *****:**.**************:** ** ***
C1 CCTGAGGGCTACGACATGGAGACGCAAGGCGGCAGCTGCATTGTCGACTT
C2 CCCGAGGGCTACGACATGGAGACCCAAGGCGGCAGCTGCATTGTGGACTT
C3 CCCGAGGGCTACGACATGGAGACCCAAGGCGGCAGCTGCATTGTGGACTT
C4 CCCGAGGGCTATGACATGGAGACCCAAGGTGGCAGCTGCATCGTGGACTT
C5 CCCGAGGGCTATGACATGGAGACCCAAGGTGGCAGCTGCATCGTAGACTT
** ******** *********** ***** *********** ** *****
C1 CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGTA
C2 CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGCA
C3 CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGCA
C4 CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCTGCACAGGACTGCA
C5 CGAAAACACGGCCATCTTTAGCCGGGAGTTCCAGGCCGCACAGGACTGCA
****************** ***************** **:******** *
C1 CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCTGAT
C2 CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT
C3 CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT
C4 CCTGCGATAACGAACATATGTTCGACTGCTCGGAACAAGATAGTGCCGAT
C5 CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT
******* *****.***********************.******** ***
C1 GTGGGCGGCGACAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT
C2 GTCGGTGCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT
C3 GTCGGTGCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT
C4 ACCGGCTCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCCT
C5 ACCGGCGCCGAGAAGGGTGACCTGCACTCCGCCGTGGAGCAGTACATCCT
. ** *** ************.***********************.*
C1 GCAGATGGGCCAGGAGAACAGCCTGAACAACGTTAACAGCCTGGCTAAGA
C2 GCAGATGGGCCAGGAGAACAGCCTGAACAACGTTAACAGCCTGGTTAAAA
C3 GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTCAAAA
C4 GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTTAAGA
C5 GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTGAAGA
********************************* ********** **.*
C1 AGGCCGGATATCCTGTGATGCCCGATCCTCGGCTGGACGACGCGGTCATA
C2 AGGCCGGATACCCTGTGATGCCCGATCCTCGCCTGGACGACGCGGTCATG
C3 AGGCCGGATACCCTGTGATGCCCGATCCTCGCCTGGACGACGCGGTCATG
C4 AGGGCGGGTACCCAGTGATGCCCGATCCTCGTCTGGATGACGCGGTTATG
C5 AGGCCGGATATCCAGTGATGCCCGATCCTCGCCTGGATGACGCGGTTTTG
*** ***.** **:***************** ***** ******** :*.
C1 AACCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA
C2 AATCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA
C3 AATCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA
C4 AACCCGTTTCTCCAGGGCGATCGCTTGCCCATAGCCGCCAAAAAGGGCAA
C5 AACCCGTTCCTCCAGGGCGATCGCTTGCCTATAGCCGCCAAGAAGGGCAA
** ***** *********** ******** ***********.********
C1 CCTTTTATTCCAC------
C2 CCTTCTATTCCAC------
C3 CCTTCTATTCCAC------
C4 CCTTCTATTCCAC------
C5 CCTTCTATTCCAC------
**** ********
>C1
ATGTTGTTCCGTTCGCAAAGTGTGTACATGATGGTGGCGATGCTCGTGGT
CGCCTTGAGTGGCTACCAGGTGCAGTCCTATAGCGCCAAGGATATTCTTG
CCGATGTCTTGATGACGGATCTGCTGAATCGCATGGACAAAGACATGCAG
GTGGGCTATTACGACGTGGGCAACGAGGCAGCCGCTGGCTCCAAGGACAA
CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA
GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCATCCT
TCGCTGCGGGATGACGAGTTTCTGCAGCACAGTTCGCTGTGGGGTCACCA
GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACAGGTATCCCACTATAG
TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC
CCTGAGGGCTACGACATGGAGACGCAAGGCGGCAGCTGCATTGTCGACTT
CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGTA
CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCTGAT
GTGGGCGGCGACAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT
GCAGATGGGCCAGGAGAACAGCCTGAACAACGTTAACAGCCTGGCTAAGA
AGGCCGGATATCCTGTGATGCCCGATCCTCGGCTGGACGACGCGGTCATA
AACCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA
CCTTTTATTCCAC------
>C2
ATGTTGTTCCGTTCGCAAATTGTGCACATGATGGTGGCGATGCTCGTGGT
CGCCTCGAGTGGCTACCAGGTGCAGTCCTATAGCTCCAAGGATATTTTTG
CCGATGCCTTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG
GTGGGCTACTACGACGTGGGCAACGAGGCAGCCGCTGGCTCCAAGGACAA
CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA
GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCACCCT
TCGCTGCGGGACCACGAGTTCCTGCAGCACAGCTCGCTGTGGGGTCACCA
GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACCGGTATCCCACCATAG
TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC
CCCGAGGGCTACGACATGGAGACCCAAGGCGGCAGCTGCATTGTGGACTT
CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGCA
CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT
GTCGGTGCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT
GCAGATGGGCCAGGAGAACAGCCTGAACAACGTTAACAGCCTGGTTAAAA
AGGCCGGATACCCTGTGATGCCCGATCCTCGCCTGGACGACGCGGTCATG
AATCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA
CCTTCTATTCCAC------
>C3
ATGTTGTTCCGTTCGCAAAGTGTGCACATGATGGTGGCGATGCTCGTGGC
CGCCTCGAGCTGCTACCAGGTGCAGTCCTATAGCTCCAAGGATATTTTTG
CCGATGCCTTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG
GTGGGCTACTACGACGTGGGCAACGAAGCAGCCGCTGGCTCCAAGGACAA
CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA
GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCACCCT
TCGCTGCGGGACCACGAGTTCCTGCAGCACAGCTCGCTGTGGGGTCACCA
GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACCGGTATCCCACCATAG
TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC
CCCGAGGGCTACGACATGGAGACCCAAGGCGGCAGCTGCATTGTGGACTT
CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGCA
CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT
GTCGGTGCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT
GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTCAAAA
AGGCCGGATACCCTGTGATGCCCGATCCTCGCCTGGACGACGCGGTCATG
AATCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA
CCTTCTATTCCAC------
>C4
ATGTTGTTCTGTTCGCAAAATGTGTACATGATGGTTGCGATGCTTGTGGT
CGCCTTAAGTGGCTACCAGGTTCAGTCCTATGGCTCCAAGGATATTTTGG
CCGATGCCCTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG
GTAGGCTACTACGATGTTGGCAACGAGGCAGCTGCTGGCTCCAAGGACAA
TGTGGACCTGGTCTCCCGATCGGAATACGCGAGGCTGTGTGATGGGGGAA
GCGACTGCATCTTGCAATCGGGA------TCGGGAGCAGCCTCCCATCCT
TCGTTGAGGGACCACGAGTTCCTGCAGCACAGCTCCCTGTGGGGTCACCA
GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAATAGGTATCCTACCATAG
CGAAGAATGACGCCGGTCTGCCTGCATACTGCAACCCTCCAAACCCTTGC
CCCGAGGGCTATGACATGGAGACCCAAGGTGGCAGCTGCATCGTGGACTT
CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCTGCACAGGACTGCA
CCTGCGATAACGAACATATGTTCGACTGCTCGGAACAAGATAGTGCCGAT
ACCGGCTCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCCT
GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTTAAGA
AGGGCGGGTACCCAGTGATGCCCGATCCTCGTCTGGATGACGCGGTTATG
AACCCGTTTCTCCAGGGCGATCGCTTGCCCATAGCCGCCAAAAAGGGCAA
CCTTCTATTCCAC------
>C5
ATGTTGTTCCGTTCGCAAAGTGTGCACATGATGGTTGCGATGCTGGTGGT
GGCCTCAAGTGGCTACCAGGTGCAGTCCTATGGCTCCAAGGATATTTTGG
CCGATGTCCTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG
GTGGGCTACTACGACGTGGGCAACGAGGCAGCTGCTGACTCCAAGGACAA
TGTGGACCTGGTCTCCCGATCGGAGTACGCGAGGCTGTGTGAGGGGGGAA
GCGACTGCATCTTGCAATCGGGA------TCGGGAGCAGCCTCCCATCCT
TCGTTGAGGGACCACGAGTTCGTGCAGCACAGCTCGCTGTGGGGTCACCA
GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAATAGGTATCCTGCCATAG
TGAAGAACGACGCCGGTCTGCCAGCCTACTGCAACCCTCCTAATCCATGC
CCCGAGGGCTATGACATGGAGACCCAAGGTGGCAGCTGCATCGTAGACTT
CGAAAACACGGCCATCTTTAGCCGGGAGTTCCAGGCCGCACAGGACTGCA
CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT
ACCGGCGCCGAGAAGGGTGACCTGCACTCCGCCGTGGAGCAGTACATCCT
GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTGAAGA
AGGCCGGATATCCAGTGATGCCCGATCCTCGCCTGGATGACGCGGTTTTG
AACCCGTTCCTCCAGGGCGATCGCTTGCCTATAGCCGCCAAGAAGGGCAA
CCTTCTATTCCAC------
>C1
MLFRSQSVYMMVAMLVVALSGYQVQSYSAKDILADVLMTDLLNRMDKDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVMPDPRLDDAVI
NPFLQGDRLPIAAKKGNLLFH
>C2
MLFRSQIVHMMVAMLVVASSGYQVQSYSSKDIFADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH
>C3
MLFRSQSVHMMVAMLVAASSCYQVQSYSSKDIFADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH
>C4
MLFCSQNVYMMVAMLVVALSGYQVQSYGSKDILADALLTDLLNRMDNDMQ
VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGooSGAASHP
SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIAKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
TGSEKGDLNSAVEQYILQMGQENSLNNVNSLVKKGGYPVMPDPRLDDAVM
NPFLQGDRLPIAAKKGNLLFH
>C5
MLFRSQSVHMMVAMLVVASSGYQVQSYGSKDILADVLLTDLLNRMDNDMQ
VGYYDVGNEAAADSKDNVDLVSRSEYARLCEGGSDCILQSGooSGAASHP
SLRDHEFVQHSSLWGHQFISGGMGEGPNRYPAIVKNDAGLPAYCNPPNPC
PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
TGAEKGDLHSAVEQYILQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVL
NPFLQGDRLPIAAKKGNLLFH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 819 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1480111471
Setting output file names to "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 743656109
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8194431641
Seed = 1805916499
Swapseed = 1480111471
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 27 unique site patterns
Division 2 has 16 unique site patterns
Division 3 has 43 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2054.192528 -- -25.624409
Chain 2 -- -2054.192528 -- -25.624409
Chain 3 -- -2110.159419 -- -25.624409
Chain 4 -- -2141.319861 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2142.368580 -- -25.624409
Chain 2 -- -2110.141042 -- -25.624409
Chain 3 -- -2133.187699 -- -25.624409
Chain 4 -- -2110.141042 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2054.193] (-2054.193) (-2110.159) (-2141.320) * [-2142.369] (-2110.141) (-2133.188) (-2110.141)
500 -- (-1756.742) (-1755.198) (-1740.200) [-1743.346] * (-1753.316) (-1760.098) [-1750.405] (-1733.423) -- 0:00:00
1000 -- (-1747.499) (-1736.001) [-1737.236] (-1733.535) * [-1745.197] (-1742.032) (-1748.281) (-1733.642) -- 0:00:00
1500 -- (-1743.614) (-1737.361) [-1724.342] (-1730.362) * (-1727.983) (-1723.229) (-1741.427) [-1725.505] -- 0:00:00
2000 -- (-1757.082) (-1733.228) [-1723.536] (-1727.835) * (-1727.554) [-1718.415] (-1743.799) (-1723.156) -- 0:00:00
2500 -- (-1741.754) (-1718.360) (-1721.708) [-1720.527] * (-1728.284) (-1721.230) (-1735.572) [-1713.361] -- 0:00:00
3000 -- (-1725.110) (-1718.538) [-1716.281] (-1713.769) * (-1724.295) (-1714.309) (-1730.826) [-1713.080] -- 0:05:32
3500 -- (-1718.081) (-1719.506) [-1714.941] (-1714.160) * [-1720.216] (-1708.125) (-1730.894) (-1713.396) -- 0:04:44
4000 -- [-1714.543] (-1712.321) (-1715.845) (-1714.220) * (-1715.032) [-1711.040] (-1725.118) (-1712.259) -- 0:04:09
4500 -- (-1714.121) [-1720.524] (-1720.638) (-1713.629) * (-1722.548) (-1707.146) (-1722.265) [-1718.135] -- 0:03:41
5000 -- [-1720.304] (-1712.589) (-1713.439) (-1713.684) * (-1718.635) [-1707.551] (-1713.451) (-1715.233) -- 0:03:19
Average standard deviation of split frequencies: 0.117851
5500 -- (-1721.746) (-1709.292) [-1718.025] (-1717.165) * [-1709.662] (-1708.494) (-1714.002) (-1712.909) -- 0:03:00
6000 -- (-1714.303) (-1707.746) (-1711.541) [-1714.294] * (-1709.162) (-1708.845) [-1709.300] (-1713.031) -- 0:02:45
6500 -- (-1714.762) (-1707.459) [-1710.457] (-1717.084) * (-1707.687) (-1708.225) [-1712.458] (-1719.203) -- 0:02:32
7000 -- (-1707.376) [-1708.139] (-1708.543) (-1715.666) * [-1711.985] (-1715.163) (-1719.179) (-1711.140) -- 0:02:21
7500 -- [-1712.640] (-1712.353) (-1713.184) (-1717.699) * (-1706.247) [-1712.493] (-1717.267) (-1715.699) -- 0:02:12
8000 -- [-1714.742] (-1710.798) (-1706.661) (-1716.922) * (-1712.419) (-1714.924) [-1713.906] (-1715.385) -- 0:02:04
8500 -- (-1717.968) [-1707.309] (-1705.648) (-1716.141) * (-1711.468) [-1705.695] (-1719.104) (-1709.615) -- 0:03:53
9000 -- [-1709.885] (-1711.740) (-1706.066) (-1726.487) * (-1720.280) [-1707.463] (-1717.965) (-1713.776) -- 0:03:40
9500 -- [-1712.051] (-1712.709) (-1711.291) (-1713.785) * (-1714.197) (-1710.138) [-1709.450] (-1714.708) -- 0:03:28
10000 -- [-1706.405] (-1709.489) (-1711.656) (-1710.123) * [-1708.626] (-1710.003) (-1712.079) (-1709.536) -- 0:03:18
Average standard deviation of split frequencies: 0.066291
10500 -- (-1712.525) (-1713.881) [-1708.347] (-1714.661) * [-1706.197] (-1715.883) (-1713.317) (-1713.207) -- 0:03:08
11000 -- [-1709.820] (-1709.533) (-1710.647) (-1719.958) * (-1716.702) (-1710.725) (-1713.000) [-1712.217] -- 0:02:59
11500 -- (-1713.225) [-1712.408] (-1711.047) (-1714.779) * (-1721.570) (-1710.710) (-1718.085) [-1710.713] -- 0:02:51
12000 -- [-1713.581] (-1712.470) (-1710.753) (-1721.272) * [-1711.862] (-1709.957) (-1708.577) (-1712.313) -- 0:02:44
12500 -- [-1715.897] (-1713.472) (-1707.914) (-1712.181) * (-1710.779) (-1710.988) [-1714.774] (-1711.854) -- 0:02:38
13000 -- [-1716.244] (-1712.735) (-1710.107) (-1711.944) * (-1712.569) [-1706.997] (-1714.162) (-1709.641) -- 0:02:31
13500 -- (-1714.444) (-1707.823) (-1713.783) [-1712.670] * [-1712.120] (-1705.934) (-1713.283) (-1716.231) -- 0:03:39
14000 -- (-1710.576) (-1709.909) (-1711.926) [-1720.877] * [-1709.615] (-1709.519) (-1716.419) (-1710.498) -- 0:03:31
14500 -- (-1712.769) (-1712.473) (-1707.130) [-1720.084] * [-1710.639] (-1708.882) (-1718.890) (-1710.376) -- 0:03:23
15000 -- (-1713.096) (-1708.452) [-1707.110] (-1722.533) * (-1711.545) (-1709.857) [-1706.644] (-1717.069) -- 0:03:17
Average standard deviation of split frequencies: 0.029463
15500 -- [-1712.402] (-1714.702) (-1713.779) (-1718.796) * (-1709.718) (-1710.489) (-1711.514) [-1708.870] -- 0:03:10
16000 -- (-1706.534) (-1713.052) [-1703.659] (-1718.725) * (-1714.375) [-1711.243] (-1714.394) (-1718.058) -- 0:03:04
16500 -- (-1705.366) (-1712.240) (-1712.164) [-1710.076] * (-1707.587) [-1709.488] (-1710.608) (-1707.649) -- 0:02:58
17000 -- (-1711.458) (-1709.723) [-1713.176] (-1709.341) * (-1708.888) (-1716.153) (-1714.594) [-1708.791] -- 0:02:53
17500 -- (-1717.595) [-1711.226] (-1710.277) (-1710.075) * (-1710.985) (-1719.381) (-1713.641) [-1710.880] -- 0:02:48
18000 -- [-1714.102] (-1709.549) (-1715.897) (-1711.374) * [-1714.647] (-1705.903) (-1710.623) (-1713.943) -- 0:02:43
18500 -- (-1710.275) (-1713.733) (-1710.073) [-1711.126] * (-1710.187) (-1710.780) [-1707.166] (-1712.419) -- 0:02:39
19000 -- (-1705.886) (-1714.512) [-1707.999] (-1713.413) * (-1712.110) [-1714.286] (-1710.087) (-1710.790) -- 0:03:26
19500 -- (-1708.212) (-1709.471) [-1709.524] (-1711.234) * [-1708.208] (-1714.762) (-1708.318) (-1708.924) -- 0:03:21
20000 -- (-1709.108) [-1706.439] (-1705.713) (-1707.587) * [-1706.809] (-1713.924) (-1711.127) (-1717.943) -- 0:03:16
Average standard deviation of split frequencies: 0.038016
20500 -- (-1711.200) (-1706.388) [-1707.367] (-1715.371) * (-1710.003) [-1710.179] (-1709.400) (-1711.747) -- 0:03:11
21000 -- (-1710.235) (-1705.008) [-1710.052] (-1709.184) * (-1712.625) [-1710.789] (-1715.207) (-1714.641) -- 0:03:06
21500 -- [-1706.480] (-1708.377) (-1705.595) (-1709.892) * (-1709.663) (-1710.448) [-1709.839] (-1723.006) -- 0:03:02
22000 -- (-1712.311) (-1709.866) [-1709.964] (-1713.723) * (-1710.252) (-1709.773) (-1706.592) [-1715.076] -- 0:02:57
22500 -- (-1708.761) (-1711.432) [-1714.855] (-1712.695) * (-1713.078) (-1710.206) (-1712.617) [-1709.979] -- 0:02:53
23000 -- (-1708.481) [-1707.659] (-1721.820) (-1718.003) * [-1709.406] (-1715.168) (-1716.405) (-1707.781) -- 0:02:49
23500 -- (-1706.522) (-1709.356) [-1708.603] (-1713.099) * (-1709.013) (-1713.319) [-1710.229] (-1706.756) -- 0:02:46
24000 -- [-1706.762] (-1706.414) (-1709.794) (-1710.696) * (-1714.100) (-1716.441) [-1708.191] (-1717.923) -- 0:02:42
24500 -- (-1706.863) [-1708.288] (-1711.142) (-1712.388) * [-1713.346] (-1715.312) (-1711.382) (-1708.087) -- 0:03:19
25000 -- [-1709.598] (-1711.009) (-1712.340) (-1711.028) * [-1712.394] (-1710.036) (-1711.065) (-1710.980) -- 0:03:15
Average standard deviation of split frequencies: 0.018131
25500 -- [-1709.604] (-1712.917) (-1710.378) (-1713.101) * (-1710.148) [-1712.201] (-1718.478) (-1712.776) -- 0:03:11
26000 -- (-1708.239) [-1716.074] (-1716.570) (-1713.644) * (-1710.556) (-1711.276) [-1716.686] (-1711.579) -- 0:03:07
26500 -- (-1705.395) (-1715.251) (-1711.492) [-1709.656] * (-1712.418) (-1711.412) [-1717.137] (-1707.725) -- 0:03:03
27000 -- (-1711.774) (-1718.978) (-1708.557) [-1706.837] * (-1713.463) (-1709.938) [-1706.410] (-1711.329) -- 0:03:00
27500 -- (-1708.675) (-1714.392) [-1716.369] (-1713.132) * (-1716.245) (-1714.282) (-1706.928) [-1712.747] -- 0:02:56
28000 -- (-1709.804) (-1722.776) (-1710.140) [-1713.189] * [-1713.176] (-1710.530) (-1713.195) (-1710.559) -- 0:02:53
28500 -- (-1712.565) (-1718.312) [-1706.799] (-1711.138) * [-1711.569] (-1711.745) (-1714.651) (-1705.353) -- 0:02:50
29000 -- [-1712.210] (-1708.043) (-1708.685) (-1708.678) * (-1715.456) [-1705.097] (-1716.693) (-1713.082) -- 0:02:47
29500 -- (-1714.476) (-1706.424) [-1711.773] (-1710.109) * (-1716.490) (-1708.278) (-1710.998) [-1709.736] -- 0:03:17
30000 -- (-1713.054) (-1711.741) (-1714.747) [-1712.332] * (-1711.896) (-1708.758) [-1705.749] (-1708.265) -- 0:03:14
Average standard deviation of split frequencies: 0.051240
30500 -- [-1713.289] (-1720.238) (-1711.799) (-1714.058) * (-1710.688) (-1712.343) [-1714.402] (-1717.496) -- 0:03:10
31000 -- (-1711.231) [-1713.096] (-1732.727) (-1713.618) * [-1707.268] (-1707.938) (-1718.299) (-1713.296) -- 0:03:07
31500 -- (-1707.863) (-1709.830) (-1716.601) [-1711.618] * (-1713.644) [-1706.468] (-1714.518) (-1712.281) -- 0:03:04
32000 -- (-1711.681) (-1719.329) (-1711.844) [-1706.776] * (-1717.998) (-1712.494) [-1710.133] (-1715.414) -- 0:03:01
32500 -- (-1717.092) (-1718.807) (-1707.520) [-1710.269] * (-1716.833) [-1705.339] (-1706.435) (-1719.169) -- 0:02:58
33000 -- [-1709.819] (-1717.484) (-1712.529) (-1707.765) * (-1713.811) (-1707.577) (-1709.518) [-1713.964] -- 0:02:55
33500 -- (-1714.875) [-1708.878] (-1713.643) (-1711.471) * (-1718.566) (-1709.993) [-1707.312] (-1721.069) -- 0:02:53
34000 -- (-1719.461) [-1710.039] (-1716.359) (-1709.542) * (-1720.046) (-1707.990) [-1710.670] (-1718.828) -- 0:02:50
34500 -- [-1706.995] (-1708.945) (-1708.947) (-1717.234) * (-1717.253) [-1709.081] (-1708.556) (-1716.678) -- 0:02:47
35000 -- (-1708.680) (-1711.261) (-1715.607) [-1708.823] * (-1711.626) (-1712.931) [-1708.364] (-1715.360) -- 0:03:13
Average standard deviation of split frequencies: 0.052378
35500 -- [-1709.624] (-1711.963) (-1711.234) (-1713.315) * (-1715.992) (-1707.956) [-1709.251] (-1716.962) -- 0:03:10
36000 -- (-1711.323) (-1710.078) [-1711.283] (-1707.486) * (-1716.387) (-1711.762) [-1711.804] (-1718.917) -- 0:03:07
36500 -- (-1710.137) (-1712.181) (-1712.930) [-1706.274] * (-1712.853) [-1707.037] (-1717.268) (-1717.440) -- 0:03:04
37000 -- (-1718.868) (-1712.169) [-1713.360] (-1709.361) * (-1708.406) [-1707.205] (-1715.767) (-1717.264) -- 0:03:02
37500 -- [-1708.507] (-1709.301) (-1715.709) (-1708.560) * (-1706.057) (-1711.224) [-1711.295] (-1708.892) -- 0:02:59
38000 -- (-1708.167) [-1709.412] (-1713.338) (-1707.458) * (-1707.372) (-1708.496) [-1711.667] (-1709.024) -- 0:02:57
38500 -- (-1714.115) (-1710.260) (-1707.003) [-1707.110] * (-1709.794) (-1711.440) (-1707.774) [-1709.283] -- 0:02:54
39000 -- [-1712.624] (-1712.764) (-1705.839) (-1709.572) * (-1711.611) (-1713.731) (-1710.482) [-1709.342] -- 0:02:52
39500 -- [-1711.354] (-1710.936) (-1715.334) (-1712.499) * [-1709.201] (-1713.832) (-1715.053) (-1711.027) -- 0:02:50
40000 -- [-1711.410] (-1708.496) (-1715.606) (-1714.494) * (-1714.204) (-1718.476) [-1706.507] (-1714.723) -- 0:02:48
Average standard deviation of split frequencies: 0.038640
40500 -- (-1714.698) (-1707.902) (-1712.466) [-1706.550] * (-1710.017) [-1715.304] (-1709.722) (-1708.429) -- 0:03:09
41000 -- [-1713.386] (-1715.536) (-1718.048) (-1715.319) * (-1718.058) [-1709.228] (-1706.157) (-1711.129) -- 0:03:07
41500 -- (-1712.253) [-1713.546] (-1712.388) (-1713.666) * (-1719.458) [-1709.610] (-1709.154) (-1717.350) -- 0:03:04
42000 -- (-1709.302) (-1711.951) [-1711.447] (-1711.113) * (-1715.412) (-1705.804) (-1706.951) [-1712.943] -- 0:03:02
42500 -- [-1709.347] (-1714.436) (-1709.807) (-1715.051) * (-1712.425) (-1711.478) (-1711.281) [-1710.849] -- 0:03:00
43000 -- (-1709.646) (-1711.484) [-1712.267] (-1721.677) * (-1711.414) [-1709.477] (-1712.390) (-1711.128) -- 0:02:58
43500 -- (-1713.242) (-1712.335) [-1713.437] (-1713.979) * (-1713.786) (-1705.285) [-1714.207] (-1710.489) -- 0:02:55
44000 -- [-1712.668] (-1711.160) (-1717.628) (-1713.380) * (-1716.130) (-1711.684) (-1710.875) [-1714.930] -- 0:02:53
44500 -- (-1710.371) [-1710.397] (-1715.772) (-1709.974) * [-1710.043] (-1712.467) (-1710.497) (-1710.373) -- 0:02:51
45000 -- (-1712.851) (-1713.561) [-1708.624] (-1714.549) * (-1717.163) [-1711.867] (-1707.119) (-1714.421) -- 0:02:49
Average standard deviation of split frequencies: 0.058072
45500 -- (-1711.109) [-1709.554] (-1712.171) (-1710.728) * (-1708.604) [-1707.238] (-1715.100) (-1712.557) -- 0:02:47
46000 -- (-1711.790) (-1715.511) [-1710.329] (-1705.280) * (-1711.354) (-1706.044) (-1708.448) [-1718.509] -- 0:03:06
46500 -- (-1711.686) (-1712.199) (-1711.100) [-1708.576] * (-1715.840) [-1706.720] (-1708.259) (-1717.510) -- 0:03:04
47000 -- (-1708.772) (-1710.381) [-1706.806] (-1710.730) * (-1713.993) [-1711.845] (-1716.523) (-1716.053) -- 0:03:02
47500 -- (-1705.977) (-1707.366) [-1703.481] (-1711.408) * (-1712.609) (-1705.802) (-1711.229) [-1711.084] -- 0:03:00
48000 -- (-1711.890) (-1715.503) (-1718.283) [-1710.387] * (-1705.555) (-1711.822) [-1716.554] (-1712.444) -- 0:02:58
48500 -- (-1708.658) [-1712.169] (-1714.948) (-1714.130) * (-1715.468) [-1708.951] (-1709.545) (-1711.636) -- 0:02:56
49000 -- (-1712.638) (-1706.764) [-1709.706] (-1705.045) * (-1714.911) (-1706.227) [-1708.160] (-1707.263) -- 0:02:54
49500 -- (-1710.418) (-1718.072) (-1709.464) [-1708.190] * [-1709.256] (-1723.627) (-1713.986) (-1709.759) -- 0:02:52
50000 -- (-1717.395) (-1707.826) (-1713.512) [-1709.238] * (-1711.467) [-1708.401] (-1709.855) (-1710.840) -- 0:02:51
Average standard deviation of split frequencies: 0.052723
50500 -- (-1714.652) [-1711.241] (-1714.260) (-1712.038) * (-1710.410) (-1711.650) (-1719.965) [-1711.961] -- 0:02:49
51000 -- [-1706.246] (-1710.762) (-1708.535) (-1712.574) * [-1709.600] (-1713.755) (-1711.679) (-1716.360) -- 0:03:06
51500 -- (-1709.974) [-1713.193] (-1709.567) (-1712.852) * (-1713.458) (-1709.963) (-1708.702) [-1711.474] -- 0:03:04
52000 -- (-1710.986) (-1713.789) (-1710.964) [-1710.688] * (-1713.744) [-1711.974] (-1711.507) (-1712.855) -- 0:03:02
52500 -- (-1712.119) [-1710.781] (-1706.765) (-1707.426) * [-1710.177] (-1713.497) (-1709.138) (-1710.949) -- 0:03:00
53000 -- [-1712.233] (-1706.680) (-1712.618) (-1707.169) * [-1705.065] (-1710.310) (-1708.382) (-1712.208) -- 0:02:58
53500 -- (-1713.546) [-1708.038] (-1709.795) (-1715.899) * (-1711.932) (-1711.051) (-1716.103) [-1708.799] -- 0:02:56
54000 -- (-1712.384) (-1709.693) [-1711.863] (-1715.048) * [-1710.706] (-1714.565) (-1711.302) (-1709.198) -- 0:02:55
54500 -- (-1709.028) (-1709.616) [-1716.886] (-1715.838) * (-1714.445) [-1719.559] (-1716.827) (-1715.278) -- 0:02:53
55000 -- (-1712.465) (-1709.113) [-1707.892] (-1731.942) * (-1708.889) [-1710.128] (-1714.288) (-1709.566) -- 0:02:51
Average standard deviation of split frequencies: 0.042090
55500 -- (-1708.824) (-1709.972) (-1712.091) [-1710.621] * (-1709.965) (-1712.456) [-1720.447] (-1709.888) -- 0:02:50
56000 -- (-1706.211) (-1710.836) (-1718.072) [-1713.291] * (-1715.441) [-1717.039] (-1717.978) (-1711.733) -- 0:02:48
56500 -- (-1715.394) [-1708.045] (-1715.179) (-1709.453) * (-1714.013) (-1713.543) (-1711.712) [-1712.575] -- 0:03:03
57000 -- (-1709.297) [-1714.543] (-1716.245) (-1714.635) * [-1712.298] (-1711.148) (-1709.983) (-1715.624) -- 0:03:01
57500 -- [-1712.625] (-1713.206) (-1712.280) (-1708.766) * [-1719.639] (-1710.515) (-1718.550) (-1714.378) -- 0:03:00
58000 -- (-1712.791) (-1716.355) (-1717.523) [-1716.358] * (-1720.692) (-1714.108) [-1710.559] (-1719.727) -- 0:02:58
58500 -- (-1710.874) [-1716.578] (-1715.824) (-1710.269) * (-1711.545) [-1708.838] (-1715.585) (-1717.499) -- 0:02:57
59000 -- [-1703.601] (-1715.235) (-1709.580) (-1709.876) * (-1714.759) (-1709.799) (-1706.679) [-1709.481] -- 0:02:55
59500 -- (-1713.055) [-1716.996] (-1709.360) (-1709.230) * (-1711.950) (-1717.887) [-1709.418] (-1710.065) -- 0:02:53
60000 -- (-1713.660) [-1711.357] (-1707.761) (-1714.453) * (-1707.798) [-1711.114] (-1709.294) (-1715.386) -- 0:02:52
Average standard deviation of split frequencies: 0.041442
60500 -- (-1713.644) (-1713.559) [-1710.296] (-1715.835) * (-1710.514) [-1712.165] (-1707.907) (-1711.614) -- 0:02:50
61000 -- (-1716.743) [-1709.357] (-1706.205) (-1714.475) * (-1706.465) (-1713.762) (-1708.287) [-1711.051] -- 0:02:49
61500 -- (-1711.778) [-1706.702] (-1709.203) (-1714.877) * [-1705.837] (-1720.874) (-1716.244) (-1708.429) -- 0:02:47
62000 -- (-1716.248) [-1713.664] (-1708.190) (-1721.617) * (-1711.239) (-1714.265) (-1707.061) [-1715.773] -- 0:03:01
62500 -- (-1714.539) (-1707.375) [-1713.070] (-1715.281) * (-1706.415) [-1716.060] (-1707.928) (-1708.988) -- 0:03:00
63000 -- (-1715.353) [-1708.627] (-1706.922) (-1714.432) * (-1706.567) [-1712.243] (-1707.432) (-1714.843) -- 0:02:58
63500 -- (-1708.852) (-1710.699) [-1714.665] (-1711.954) * (-1709.305) (-1718.569) [-1716.011] (-1717.561) -- 0:02:56
64000 -- (-1711.900) (-1703.284) [-1712.893] (-1707.638) * [-1710.134] (-1710.552) (-1709.833) (-1711.979) -- 0:02:55
64500 -- (-1709.677) (-1713.720) (-1713.130) [-1712.468] * [-1715.113] (-1706.769) (-1714.040) (-1712.699) -- 0:02:54
65000 -- [-1704.958] (-1709.804) (-1710.169) (-1705.518) * (-1712.311) [-1709.268] (-1713.399) (-1715.529) -- 0:02:52
Average standard deviation of split frequencies: 0.042855
65500 -- (-1715.784) (-1714.193) (-1708.580) [-1710.209] * (-1710.372) (-1710.241) (-1718.109) [-1716.046] -- 0:02:51
66000 -- (-1718.116) (-1707.994) [-1710.958] (-1712.981) * (-1710.477) (-1709.390) [-1708.627] (-1711.427) -- 0:02:49
66500 -- (-1714.146) [-1720.912] (-1708.088) (-1716.910) * (-1713.412) (-1707.835) [-1708.618] (-1713.757) -- 0:02:48
67000 -- (-1707.667) (-1708.369) (-1715.829) [-1711.301] * (-1711.260) (-1709.959) [-1717.826] (-1713.689) -- 0:03:01
67500 -- [-1707.629] (-1705.888) (-1720.352) (-1704.943) * [-1711.374] (-1708.459) (-1712.326) (-1713.051) -- 0:02:59
68000 -- [-1715.728] (-1713.034) (-1714.666) (-1711.564) * (-1712.231) [-1706.301] (-1710.742) (-1708.369) -- 0:02:58
68500 -- (-1707.745) (-1719.029) [-1721.967] (-1709.264) * (-1716.036) (-1715.796) (-1712.947) [-1708.008] -- 0:02:56
69000 -- (-1713.503) [-1710.125] (-1717.443) (-1710.101) * (-1715.398) (-1709.063) [-1710.850] (-1716.643) -- 0:02:55
69500 -- (-1714.578) (-1708.279) [-1713.146] (-1714.364) * (-1711.688) (-1711.115) [-1709.037] (-1707.897) -- 0:02:54
70000 -- (-1723.397) (-1707.806) [-1712.823] (-1711.649) * [-1710.503] (-1709.730) (-1713.861) (-1712.026) -- 0:02:52
Average standard deviation of split frequencies: 0.026683
70500 -- (-1712.417) (-1711.796) (-1712.314) [-1709.405] * [-1716.218] (-1711.040) (-1714.317) (-1708.439) -- 0:02:51
71000 -- (-1715.529) (-1708.431) [-1716.942] (-1706.126) * (-1718.120) [-1707.328] (-1712.296) (-1715.086) -- 0:02:50
71500 -- (-1711.190) (-1708.472) (-1715.944) [-1709.689] * (-1714.216) (-1706.542) [-1709.051] (-1709.798) -- 0:02:48
72000 -- (-1710.845) [-1711.769] (-1712.075) (-1710.189) * (-1712.051) [-1714.169] (-1709.050) (-1715.214) -- 0:03:00
72500 -- (-1713.072) (-1713.272) [-1707.419] (-1706.673) * [-1710.730] (-1715.659) (-1714.524) (-1711.935) -- 0:02:59
73000 -- (-1711.224) [-1709.380] (-1708.163) (-1710.350) * (-1709.575) (-1707.984) (-1718.480) [-1712.709] -- 0:02:57
73500 -- (-1709.842) (-1707.618) [-1716.474] (-1711.543) * (-1710.405) (-1717.244) [-1713.416] (-1719.950) -- 0:02:56
74000 -- (-1713.769) [-1708.198] (-1709.176) (-1706.617) * [-1712.672] (-1708.857) (-1714.708) (-1717.599) -- 0:02:55
74500 -- (-1715.804) (-1714.107) [-1705.772] (-1713.392) * (-1716.273) [-1711.215] (-1712.885) (-1715.412) -- 0:02:53
75000 -- (-1713.387) (-1707.800) [-1705.735] (-1718.007) * (-1714.880) [-1706.889] (-1710.268) (-1718.591) -- 0:02:52
Average standard deviation of split frequencies: 0.020676
75500 -- (-1719.715) [-1709.722] (-1706.877) (-1711.313) * (-1718.786) (-1706.591) [-1711.624] (-1717.926) -- 0:02:51
76000 -- (-1712.939) (-1710.877) (-1716.162) [-1714.152] * (-1715.736) [-1706.474] (-1718.759) (-1709.582) -- 0:02:50
76500 -- (-1713.206) (-1710.230) [-1708.469] (-1713.784) * [-1712.643] (-1714.786) (-1714.345) (-1708.587) -- 0:02:49
77000 -- (-1711.615) (-1708.780) [-1712.058] (-1713.772) * (-1712.500) (-1708.641) [-1718.616] (-1709.039) -- 0:02:47
77500 -- [-1717.326] (-1714.588) (-1709.106) (-1714.899) * (-1716.567) [-1710.389] (-1718.102) (-1715.859) -- 0:02:58
78000 -- (-1723.131) [-1710.990] (-1714.634) (-1712.525) * (-1707.821) [-1712.907] (-1718.849) (-1711.503) -- 0:02:57
78500 -- (-1715.276) [-1709.276] (-1717.689) (-1709.100) * (-1707.900) (-1714.943) [-1717.104] (-1713.834) -- 0:02:56
79000 -- (-1713.363) (-1717.530) [-1707.755] (-1714.554) * (-1714.511) [-1716.111] (-1719.419) (-1720.575) -- 0:02:54
79500 -- (-1713.647) (-1708.622) [-1714.421] (-1712.949) * (-1722.986) (-1719.309) [-1711.452] (-1716.429) -- 0:02:53
80000 -- [-1710.431] (-1716.968) (-1711.202) (-1711.359) * (-1708.326) [-1716.624] (-1709.264) (-1708.649) -- 0:02:52
Average standard deviation of split frequencies: 0.025323
80500 -- (-1715.616) (-1710.944) [-1711.508] (-1716.169) * (-1711.419) [-1711.732] (-1709.059) (-1707.888) -- 0:02:51
81000 -- (-1708.400) (-1713.953) [-1706.586] (-1707.820) * (-1709.168) [-1713.111] (-1717.508) (-1706.976) -- 0:02:50
81500 -- (-1709.244) (-1711.142) [-1713.772] (-1708.252) * (-1710.740) (-1710.744) [-1707.412] (-1710.173) -- 0:02:49
82000 -- (-1709.919) [-1713.684] (-1710.849) (-1712.859) * (-1708.769) (-1710.361) (-1708.013) [-1706.937] -- 0:02:47
82500 -- (-1710.183) (-1713.375) (-1713.520) [-1709.984] * (-1709.741) [-1709.761] (-1710.528) (-1710.405) -- 0:02:46
83000 -- [-1709.570] (-1717.986) (-1714.835) (-1711.447) * (-1707.420) (-1714.255) [-1704.886] (-1711.419) -- 0:02:56
83500 -- (-1711.891) [-1713.311] (-1715.271) (-1710.689) * [-1711.617] (-1716.625) (-1709.720) (-1706.517) -- 0:02:55
84000 -- (-1709.344) (-1711.584) [-1712.140] (-1710.923) * (-1714.497) [-1711.633] (-1714.503) (-1709.683) -- 0:02:54
84500 -- (-1714.910) (-1714.246) (-1715.585) [-1707.285] * (-1712.903) (-1708.343) [-1706.690] (-1713.132) -- 0:02:53
85000 -- (-1711.177) (-1713.904) (-1714.470) [-1708.363] * [-1718.915] (-1712.996) (-1704.629) (-1713.775) -- 0:02:52
Average standard deviation of split frequencies: 0.034716
85500 -- (-1716.100) (-1710.013) [-1715.942] (-1718.475) * (-1722.749) (-1710.276) [-1706.703] (-1712.054) -- 0:02:51
86000 -- (-1707.308) (-1708.105) [-1708.889] (-1715.121) * (-1712.018) (-1709.369) [-1711.227] (-1709.563) -- 0:02:50
86500 -- [-1708.226] (-1717.911) (-1716.668) (-1709.658) * (-1714.543) [-1707.957] (-1710.640) (-1715.092) -- 0:02:48
87000 -- (-1711.055) [-1709.298] (-1723.403) (-1712.232) * [-1715.716] (-1715.716) (-1713.594) (-1710.368) -- 0:02:58
87500 -- [-1710.091] (-1711.430) (-1720.456) (-1708.641) * [-1716.335] (-1709.643) (-1718.385) (-1712.332) -- 0:02:57
88000 -- (-1714.948) [-1708.517] (-1708.820) (-1711.340) * (-1716.139) (-1717.536) [-1711.667] (-1715.446) -- 0:02:56
88500 -- (-1711.336) (-1718.722) (-1717.025) [-1708.917] * (-1709.486) (-1720.957) [-1709.131] (-1712.381) -- 0:02:55
89000 -- [-1712.397] (-1714.870) (-1719.401) (-1714.484) * (-1708.955) (-1712.760) (-1709.343) [-1710.304] -- 0:02:54
89500 -- [-1709.335] (-1706.257) (-1713.221) (-1719.674) * (-1710.207) (-1709.537) (-1710.061) [-1707.724] -- 0:02:52
90000 -- (-1728.573) (-1712.697) [-1715.792] (-1709.222) * [-1715.252] (-1715.473) (-1710.787) (-1708.270) -- 0:02:51
Average standard deviation of split frequencies: 0.050260
90500 -- (-1719.984) (-1712.496) [-1709.403] (-1708.585) * [-1712.022] (-1712.577) (-1711.721) (-1713.156) -- 0:02:50
91000 -- (-1716.179) (-1710.254) [-1709.083] (-1711.267) * (-1711.643) (-1715.858) (-1707.546) [-1713.110] -- 0:02:49
91500 -- (-1712.557) [-1711.498] (-1715.802) (-1711.148) * (-1709.448) (-1713.921) [-1709.887] (-1708.442) -- 0:02:48
92000 -- (-1709.525) (-1709.486) [-1714.260] (-1709.286) * (-1709.915) (-1713.471) [-1707.363] (-1711.071) -- 0:02:57
92500 -- [-1707.389] (-1706.363) (-1710.051) (-1713.159) * (-1715.823) (-1712.575) (-1710.773) [-1712.124] -- 0:02:56
93000 -- (-1708.222) (-1710.212) [-1709.917] (-1709.528) * [-1709.477] (-1710.349) (-1715.257) (-1714.386) -- 0:02:55
93500 -- [-1710.768] (-1712.867) (-1710.185) (-1718.059) * (-1719.042) (-1715.972) [-1711.415] (-1708.177) -- 0:02:54
94000 -- [-1709.498] (-1719.755) (-1710.934) (-1716.884) * (-1713.312) (-1712.208) [-1712.605] (-1707.266) -- 0:02:53
94500 -- (-1711.291) [-1712.758] (-1707.456) (-1713.527) * (-1713.286) (-1715.625) [-1714.818] (-1707.607) -- 0:02:52
95000 -- (-1708.009) [-1711.640] (-1708.671) (-1712.485) * (-1717.420) (-1712.572) (-1709.451) [-1711.177] -- 0:02:51
Average standard deviation of split frequencies: 0.055652
95500 -- [-1711.484] (-1711.171) (-1714.125) (-1709.915) * [-1711.324] (-1708.545) (-1713.158) (-1709.735) -- 0:02:50
96000 -- (-1716.347) (-1713.302) [-1708.300] (-1704.952) * (-1717.351) [-1710.291] (-1710.857) (-1715.339) -- 0:02:49
96500 -- [-1710.337] (-1707.632) (-1712.822) (-1710.410) * (-1706.500) [-1710.386] (-1708.778) (-1709.447) -- 0:02:48
97000 -- (-1709.374) (-1713.889) [-1711.029] (-1714.907) * (-1709.925) [-1706.408] (-1704.054) (-1708.030) -- 0:02:56
97500 -- (-1710.755) (-1713.198) [-1710.170] (-1713.058) * (-1713.988) [-1718.607] (-1711.217) (-1709.463) -- 0:02:55
98000 -- (-1708.705) [-1714.131] (-1713.408) (-1710.824) * [-1709.336] (-1710.579) (-1711.094) (-1706.938) -- 0:02:54
98500 -- (-1706.809) (-1712.898) (-1716.499) [-1704.601] * (-1707.826) [-1711.010] (-1712.690) (-1715.088) -- 0:02:53
99000 -- [-1707.620] (-1710.323) (-1709.135) (-1707.136) * [-1704.162] (-1709.015) (-1714.607) (-1710.776) -- 0:02:52
99500 -- (-1713.648) (-1714.150) (-1707.702) [-1709.114] * [-1715.157] (-1712.291) (-1720.464) (-1721.695) -- 0:02:51
100000 -- (-1710.700) (-1711.953) [-1711.404] (-1710.042) * [-1715.694] (-1707.582) (-1715.266) (-1713.970) -- 0:02:51
Average standard deviation of split frequencies: 0.051511
100500 -- (-1710.952) (-1719.396) (-1710.638) [-1708.832] * (-1713.184) [-1714.433] (-1711.229) (-1713.762) -- 0:02:50
101000 -- (-1705.799) (-1708.747) (-1711.343) [-1707.375] * (-1719.052) [-1713.048] (-1705.985) (-1710.290) -- 0:02:49
101500 -- (-1722.040) [-1706.780] (-1705.448) (-1710.377) * [-1711.569] (-1710.762) (-1707.205) (-1713.545) -- 0:02:48
102000 -- (-1716.258) [-1706.176] (-1708.449) (-1711.189) * [-1711.016] (-1710.138) (-1704.472) (-1719.065) -- 0:02:47
102500 -- (-1716.563) (-1709.389) (-1709.062) [-1708.693] * [-1709.173] (-1711.617) (-1706.097) (-1709.533) -- 0:02:55
103000 -- (-1711.154) (-1710.721) [-1705.858] (-1709.452) * (-1711.522) (-1714.184) [-1708.169] (-1710.353) -- 0:02:54
103500 -- (-1714.076) (-1712.037) [-1711.414] (-1710.824) * (-1710.122) (-1709.517) (-1712.951) [-1707.799] -- 0:02:53
104000 -- (-1708.842) (-1714.009) [-1713.193] (-1711.421) * (-1707.769) (-1711.706) (-1711.658) [-1714.751] -- 0:02:52
104500 -- (-1711.337) (-1712.777) [-1708.753] (-1709.369) * [-1714.354] (-1709.206) (-1717.553) (-1708.598) -- 0:02:51
105000 -- (-1705.168) (-1717.354) (-1707.960) [-1710.325] * (-1711.107) [-1712.738] (-1715.076) (-1709.491) -- 0:02:50
Average standard deviation of split frequencies: 0.048919
105500 -- (-1716.761) (-1711.433) [-1710.479] (-1715.714) * [-1707.489] (-1711.485) (-1712.117) (-1704.962) -- 0:02:49
106000 -- (-1707.639) (-1710.429) [-1710.709] (-1713.573) * [-1710.524] (-1712.691) (-1711.657) (-1705.969) -- 0:02:48
106500 -- (-1707.647) (-1711.824) [-1711.106] (-1710.936) * [-1713.078] (-1712.399) (-1707.350) (-1712.428) -- 0:02:47
107000 -- (-1711.857) (-1716.112) [-1709.808] (-1717.270) * (-1712.432) (-1713.773) [-1706.657] (-1708.804) -- 0:02:46
107500 -- (-1709.523) [-1717.292] (-1710.698) (-1706.971) * (-1716.165) (-1712.874) [-1708.117] (-1708.227) -- 0:02:54
108000 -- (-1717.025) [-1710.214] (-1713.716) (-1712.794) * (-1709.455) (-1714.168) (-1708.837) [-1705.458] -- 0:02:53
108500 -- (-1711.872) (-1706.203) (-1715.660) [-1712.083] * (-1714.147) (-1707.500) (-1711.710) [-1718.939] -- 0:02:52
109000 -- (-1716.112) (-1707.634) [-1704.729] (-1711.801) * (-1718.734) (-1711.023) (-1712.941) [-1711.653] -- 0:02:51
109500 -- (-1709.584) (-1711.180) (-1710.685) [-1714.131] * (-1708.949) (-1719.596) (-1714.103) [-1714.534] -- 0:02:50
110000 -- [-1711.221] (-1708.414) (-1711.832) (-1717.524) * [-1712.818] (-1708.037) (-1717.757) (-1706.833) -- 0:02:49
Average standard deviation of split frequencies: 0.036917
110500 -- [-1712.291] (-1710.341) (-1712.773) (-1712.314) * (-1718.750) (-1709.337) [-1712.837] (-1709.717) -- 0:02:49
111000 -- (-1713.308) (-1710.867) [-1709.965] (-1711.897) * (-1707.065) (-1709.824) (-1716.646) [-1705.188] -- 0:02:48
111500 -- [-1709.409] (-1716.542) (-1710.803) (-1709.076) * (-1712.853) [-1710.708] (-1715.094) (-1707.564) -- 0:02:47
112000 -- [-1708.062] (-1713.320) (-1714.140) (-1710.780) * (-1710.852) [-1708.551] (-1714.542) (-1720.510) -- 0:02:54
112500 -- (-1708.820) (-1714.770) [-1709.772] (-1710.276) * (-1711.742) (-1707.049) [-1709.100] (-1714.692) -- 0:02:53
113000 -- [-1707.279] (-1709.649) (-1710.120) (-1717.285) * (-1710.094) [-1709.708] (-1711.917) (-1712.776) -- 0:02:52
113500 -- [-1709.103] (-1707.828) (-1707.058) (-1708.091) * [-1711.820] (-1708.901) (-1709.718) (-1714.505) -- 0:02:51
114000 -- (-1712.117) [-1707.033] (-1709.329) (-1711.149) * [-1705.448] (-1710.056) (-1713.287) (-1707.222) -- 0:02:50
114500 -- (-1708.912) (-1710.139) (-1710.520) [-1706.651] * (-1712.693) [-1708.396] (-1713.425) (-1712.753) -- 0:02:50
115000 -- [-1707.764] (-1715.120) (-1709.497) (-1715.958) * [-1708.510] (-1709.628) (-1708.191) (-1708.685) -- 0:02:49
Average standard deviation of split frequencies: 0.037929
115500 -- (-1708.909) (-1711.654) (-1713.052) [-1708.031] * (-1711.939) (-1709.257) [-1710.495] (-1709.435) -- 0:02:48
116000 -- (-1708.857) (-1714.477) (-1707.474) [-1706.531] * (-1712.612) (-1708.195) [-1710.693] (-1709.992) -- 0:02:47
116500 -- (-1711.205) (-1714.528) [-1710.028] (-1711.096) * (-1708.351) (-1715.351) (-1713.197) [-1711.121] -- 0:02:54
117000 -- (-1709.229) (-1714.685) [-1711.183] (-1709.800) * (-1710.532) (-1714.156) (-1711.433) [-1708.923] -- 0:02:53
117500 -- (-1711.263) (-1712.829) [-1707.357] (-1712.310) * [-1707.393] (-1712.959) (-1712.269) (-1711.908) -- 0:02:52
118000 -- [-1710.562] (-1712.304) (-1707.401) (-1712.790) * (-1715.492) (-1710.580) [-1708.754] (-1718.447) -- 0:02:51
118500 -- [-1711.120] (-1711.938) (-1708.053) (-1715.553) * (-1709.656) (-1708.062) [-1710.236] (-1716.535) -- 0:02:51
119000 -- (-1713.423) [-1706.650] (-1704.179) (-1708.723) * (-1715.142) (-1710.053) (-1713.928) [-1711.247] -- 0:02:50
119500 -- [-1710.459] (-1716.711) (-1712.153) (-1709.769) * (-1716.395) (-1713.509) (-1719.652) [-1712.665] -- 0:02:49
120000 -- (-1709.484) (-1712.351) [-1713.543] (-1708.635) * (-1712.513) (-1713.779) [-1707.193] (-1711.817) -- 0:02:48
Average standard deviation of split frequencies: 0.040369
120500 -- (-1709.531) (-1710.216) (-1708.206) [-1721.217] * (-1715.251) (-1714.313) (-1714.832) [-1711.173] -- 0:02:47
121000 -- (-1706.577) [-1708.631] (-1710.355) (-1712.847) * (-1718.416) [-1710.794] (-1721.813) (-1713.446) -- 0:02:47
121500 -- [-1710.095] (-1713.162) (-1710.984) (-1709.107) * (-1713.633) [-1711.945] (-1712.542) (-1712.150) -- 0:02:46
122000 -- (-1714.139) (-1709.861) [-1707.987] (-1710.405) * [-1709.898] (-1706.263) (-1717.644) (-1717.804) -- 0:02:52
122500 -- (-1711.067) (-1720.769) (-1716.603) [-1709.062] * (-1714.883) [-1707.962] (-1721.037) (-1712.942) -- 0:02:51
123000 -- (-1709.954) (-1712.228) (-1714.767) [-1715.070] * [-1711.944] (-1709.784) (-1705.706) (-1707.999) -- 0:02:51
123500 -- (-1716.090) (-1712.821) (-1708.944) [-1709.682] * (-1709.773) [-1705.429] (-1710.868) (-1711.138) -- 0:02:50
124000 -- (-1716.158) (-1713.015) (-1706.994) [-1708.150] * (-1715.065) (-1711.794) (-1709.778) [-1711.234] -- 0:02:49
124500 -- (-1713.205) [-1708.552] (-1707.105) (-1712.016) * [-1710.378] (-1711.178) (-1712.616) (-1708.887) -- 0:02:48
125000 -- (-1710.087) (-1713.686) (-1712.951) [-1712.150] * [-1705.476] (-1715.008) (-1710.840) (-1713.410) -- 0:02:48
Average standard deviation of split frequencies: 0.038660
125500 -- (-1713.057) (-1712.652) [-1707.943] (-1707.526) * [-1706.296] (-1708.483) (-1717.637) (-1711.551) -- 0:02:47
126000 -- (-1713.103) [-1711.996] (-1708.998) (-1712.290) * [-1710.486] (-1710.596) (-1715.268) (-1719.167) -- 0:02:46
126500 -- (-1710.880) [-1713.286] (-1711.937) (-1714.515) * (-1711.974) [-1710.123] (-1715.725) (-1709.001) -- 0:02:45
127000 -- (-1714.947) (-1727.077) [-1714.249] (-1716.951) * (-1706.186) (-1714.740) (-1711.380) [-1708.279] -- 0:02:51
127500 -- (-1718.420) [-1711.185] (-1713.382) (-1714.606) * (-1715.642) (-1710.464) [-1711.060] (-1705.138) -- 0:02:51
128000 -- [-1712.923] (-1711.921) (-1712.320) (-1714.123) * (-1710.961) (-1712.356) (-1712.594) [-1705.426] -- 0:02:50
128500 -- (-1711.609) [-1719.357] (-1709.821) (-1712.163) * (-1714.281) (-1714.915) [-1714.444] (-1710.988) -- 0:02:49
129000 -- (-1709.755) (-1714.770) [-1709.950] (-1715.734) * (-1713.321) (-1706.783) [-1721.542] (-1714.180) -- 0:02:48
129500 -- (-1710.118) (-1716.979) [-1711.352] (-1710.618) * [-1707.239] (-1712.222) (-1711.186) (-1711.561) -- 0:02:48
130000 -- (-1712.742) (-1713.487) (-1709.750) [-1710.146] * (-1708.396) (-1711.823) (-1716.038) [-1713.774] -- 0:02:47
Average standard deviation of split frequencies: 0.038482
130500 -- (-1709.630) (-1714.054) (-1719.428) [-1712.204] * (-1708.400) [-1706.490] (-1709.476) (-1713.125) -- 0:02:46
131000 -- [-1709.016] (-1717.525) (-1715.176) (-1707.034) * (-1724.211) [-1711.734] (-1709.794) (-1710.803) -- 0:02:45
131500 -- [-1711.626] (-1723.498) (-1710.751) (-1708.831) * (-1715.745) [-1706.366] (-1707.496) (-1707.984) -- 0:02:45
132000 -- (-1716.129) (-1722.629) (-1709.408) [-1716.934] * [-1709.936] (-1708.787) (-1721.487) (-1713.164) -- 0:02:50
132500 -- (-1714.437) [-1725.733] (-1712.432) (-1711.699) * (-1713.135) (-1711.505) (-1711.429) [-1711.031] -- 0:02:50
133000 -- (-1710.901) (-1711.142) (-1707.295) [-1711.804] * (-1726.192) [-1710.863] (-1717.624) (-1709.475) -- 0:02:49
133500 -- (-1711.304) (-1712.462) [-1708.304] (-1711.406) * (-1718.944) (-1713.693) [-1711.850] (-1709.718) -- 0:02:48
134000 -- (-1709.064) (-1708.975) [-1704.810] (-1717.580) * (-1715.402) (-1708.191) (-1708.132) [-1711.355] -- 0:02:48
134500 -- [-1706.428] (-1713.868) (-1708.904) (-1717.747) * (-1711.479) [-1706.751] (-1714.530) (-1707.514) -- 0:02:47
135000 -- (-1712.605) (-1711.847) (-1709.382) [-1710.652] * (-1714.030) [-1708.487] (-1707.417) (-1706.824) -- 0:02:46
Average standard deviation of split frequencies: 0.040439
135500 -- [-1710.583] (-1711.627) (-1714.872) (-1709.864) * (-1710.347) (-1712.154) [-1707.594] (-1712.680) -- 0:02:45
136000 -- [-1708.903] (-1719.193) (-1708.122) (-1705.841) * (-1715.293) (-1709.107) [-1710.943] (-1709.127) -- 0:02:45
136500 -- (-1709.752) (-1717.266) (-1707.474) [-1712.071] * (-1712.087) (-1717.012) [-1709.651] (-1709.401) -- 0:02:50
137000 -- [-1708.640] (-1712.913) (-1712.835) (-1711.554) * [-1708.324] (-1711.948) (-1707.972) (-1708.237) -- 0:02:50
137500 -- (-1706.613) (-1714.957) (-1710.163) [-1712.625] * (-1708.908) [-1708.605] (-1712.735) (-1709.010) -- 0:02:49
138000 -- (-1708.529) (-1709.775) [-1710.735] (-1708.143) * (-1707.689) (-1711.540) [-1709.906] (-1710.025) -- 0:02:48
138500 -- (-1717.085) (-1717.446) [-1709.038] (-1711.123) * (-1710.395) [-1713.912] (-1710.547) (-1717.441) -- 0:02:47
139000 -- [-1708.925] (-1712.000) (-1709.187) (-1708.457) * (-1713.161) (-1709.763) [-1708.178] (-1709.922) -- 0:02:47
139500 -- [-1711.449] (-1709.376) (-1707.507) (-1709.271) * (-1708.825) [-1711.149] (-1709.939) (-1712.362) -- 0:02:46
140000 -- [-1711.766] (-1711.458) (-1711.142) (-1712.316) * (-1712.159) (-1714.905) [-1709.858] (-1716.663) -- 0:02:45
Average standard deviation of split frequencies: 0.035746
140500 -- (-1716.528) (-1709.627) [-1709.358] (-1716.512) * [-1712.221] (-1710.970) (-1713.887) (-1706.976) -- 0:02:45
141000 -- [-1708.421] (-1712.038) (-1711.276) (-1715.230) * [-1715.287] (-1710.956) (-1714.754) (-1708.553) -- 0:02:44
141500 -- (-1710.509) [-1714.376] (-1711.823) (-1712.083) * (-1706.829) (-1714.740) (-1709.039) [-1713.083] -- 0:02:43
142000 -- (-1712.082) (-1711.604) (-1717.799) [-1713.440] * (-1710.370) (-1716.254) (-1706.042) [-1712.713] -- 0:02:49
142500 -- (-1715.146) [-1712.608] (-1708.937) (-1707.486) * (-1712.249) [-1707.103] (-1707.863) (-1711.459) -- 0:02:48
143000 -- (-1713.074) [-1709.762] (-1714.101) (-1706.697) * (-1711.700) [-1705.432] (-1713.446) (-1715.133) -- 0:02:47
143500 -- (-1717.310) [-1711.927] (-1713.045) (-1711.797) * (-1711.450) (-1714.822) (-1712.931) [-1709.522] -- 0:02:47
144000 -- [-1709.661] (-1711.309) (-1712.809) (-1710.938) * (-1713.307) (-1711.642) [-1714.707] (-1718.148) -- 0:02:46
144500 -- [-1705.206] (-1713.318) (-1714.112) (-1709.838) * (-1716.924) (-1707.579) (-1709.953) [-1720.359] -- 0:02:45
145000 -- (-1705.400) [-1711.843] (-1709.206) (-1708.235) * [-1709.153] (-1712.861) (-1715.123) (-1716.601) -- 0:02:45
Average standard deviation of split frequencies: 0.040898
145500 -- (-1710.000) (-1709.539) (-1712.827) [-1712.037] * [-1710.277] (-1710.900) (-1714.234) (-1710.132) -- 0:02:44
146000 -- (-1709.847) (-1711.755) [-1712.312] (-1714.825) * (-1719.771) (-1717.431) [-1714.153] (-1711.383) -- 0:02:43
146500 -- (-1711.494) (-1712.253) [-1707.465] (-1715.207) * [-1710.737] (-1713.679) (-1720.952) (-1715.871) -- 0:02:43
147000 -- (-1714.275) [-1707.621] (-1711.586) (-1714.208) * (-1715.258) [-1712.442] (-1718.730) (-1709.981) -- 0:02:48
147500 -- (-1710.653) [-1708.374] (-1712.398) (-1714.437) * (-1711.080) (-1711.923) [-1707.430] (-1712.247) -- 0:02:47
148000 -- [-1708.645] (-1718.279) (-1711.817) (-1715.939) * (-1709.736) (-1710.403) [-1710.997] (-1710.317) -- 0:02:46
148500 -- (-1705.918) (-1715.244) (-1708.361) [-1711.425] * (-1707.726) (-1716.116) (-1713.224) [-1708.644] -- 0:02:46
149000 -- (-1713.040) (-1711.301) (-1710.345) [-1711.993] * (-1713.624) (-1714.901) (-1704.674) [-1709.915] -- 0:02:45
149500 -- (-1717.678) (-1715.401) [-1708.560] (-1709.444) * (-1711.648) (-1713.975) (-1713.919) [-1708.571] -- 0:02:44
150000 -- (-1713.221) [-1705.676] (-1709.311) (-1711.042) * (-1708.310) [-1713.149] (-1708.053) (-1708.431) -- 0:02:44
Average standard deviation of split frequencies: 0.037545
150500 -- (-1712.919) [-1712.471] (-1720.785) (-1706.940) * (-1715.999) (-1716.590) [-1711.049] (-1705.243) -- 0:02:43
151000 -- [-1707.249] (-1715.638) (-1709.702) (-1709.005) * (-1713.811) (-1710.253) (-1720.535) [-1706.071] -- 0:02:43
151500 -- (-1707.537) (-1711.883) (-1716.875) [-1708.581] * (-1716.816) (-1707.696) [-1711.876] (-1720.725) -- 0:02:42
152000 -- [-1708.507] (-1715.711) (-1711.963) (-1710.776) * (-1719.718) (-1712.818) (-1717.278) [-1715.062] -- 0:02:41
152500 -- (-1712.421) (-1716.661) [-1706.935] (-1707.640) * (-1716.517) (-1711.793) (-1715.740) [-1716.355] -- 0:02:46
153000 -- (-1710.736) (-1715.751) (-1711.951) [-1711.871] * (-1714.059) [-1716.362] (-1707.228) (-1712.732) -- 0:02:46
153500 -- [-1708.956] (-1715.205) (-1707.974) (-1714.356) * [-1710.179] (-1706.246) (-1719.430) (-1720.454) -- 0:02:45
154000 -- (-1716.203) [-1713.307] (-1711.764) (-1711.444) * (-1716.530) (-1715.674) (-1711.352) [-1714.169] -- 0:02:44
154500 -- [-1711.775] (-1715.272) (-1711.828) (-1711.402) * (-1711.326) (-1714.862) [-1711.849] (-1714.665) -- 0:02:44
155000 -- (-1708.819) (-1719.725) (-1714.789) [-1711.513] * (-1710.904) [-1709.856] (-1712.676) (-1713.389) -- 0:02:43
Average standard deviation of split frequencies: 0.029211
155500 -- (-1712.249) (-1708.372) (-1707.973) [-1712.753] * (-1714.453) (-1711.513) (-1715.384) [-1707.960] -- 0:02:42
156000 -- (-1716.283) (-1707.974) [-1707.901] (-1713.983) * (-1710.420) (-1710.334) (-1712.046) [-1711.312] -- 0:02:42
156500 -- [-1707.732] (-1710.741) (-1708.126) (-1710.034) * (-1715.200) (-1723.926) (-1711.490) [-1710.547] -- 0:02:41
157000 -- (-1713.452) (-1708.647) [-1710.404] (-1709.943) * (-1718.414) [-1711.315] (-1714.560) (-1714.629) -- 0:02:41
157500 -- (-1715.801) (-1707.375) (-1709.919) [-1713.021] * [-1706.242] (-1705.473) (-1716.355) (-1710.282) -- 0:02:40
158000 -- (-1710.115) (-1707.541) (-1712.675) [-1709.646] * (-1708.144) [-1711.133] (-1712.378) (-1714.121) -- 0:02:45
158500 -- [-1707.847] (-1711.407) (-1710.615) (-1713.406) * (-1707.187) (-1715.217) (-1713.344) [-1714.344] -- 0:02:44
159000 -- [-1708.149] (-1720.697) (-1712.488) (-1710.867) * [-1711.803] (-1714.365) (-1708.572) (-1711.955) -- 0:02:43
159500 -- (-1709.950) (-1712.560) (-1710.766) [-1715.519] * (-1709.220) (-1712.290) (-1707.197) [-1706.598] -- 0:02:43
160000 -- (-1709.040) (-1709.790) [-1706.686] (-1722.569) * (-1709.027) (-1707.299) [-1710.674] (-1713.469) -- 0:02:42
Average standard deviation of split frequencies: 0.026406
160500 -- [-1712.039] (-1719.610) (-1711.420) (-1710.353) * (-1712.679) [-1706.989] (-1708.187) (-1712.621) -- 0:02:42
161000 -- (-1713.995) (-1722.211) [-1710.104] (-1712.768) * [-1710.628] (-1711.418) (-1717.785) (-1715.367) -- 0:02:41
161500 -- (-1716.677) [-1708.252] (-1708.714) (-1709.759) * [-1710.595] (-1711.199) (-1715.810) (-1715.377) -- 0:02:40
162000 -- [-1714.674] (-1714.644) (-1709.275) (-1714.363) * (-1707.458) [-1707.722] (-1710.831) (-1711.509) -- 0:02:40
162500 -- [-1717.223] (-1713.440) (-1712.614) (-1711.169) * (-1712.805) (-1711.511) [-1708.581] (-1710.124) -- 0:02:39
163000 -- (-1711.255) (-1715.111) (-1715.669) [-1712.296] * (-1707.978) (-1714.553) (-1707.009) [-1707.555] -- 0:02:44
163500 -- (-1716.645) [-1713.363] (-1715.470) (-1714.448) * (-1706.899) (-1712.685) [-1709.737] (-1711.498) -- 0:02:43
164000 -- [-1711.844] (-1710.753) (-1708.604) (-1708.910) * (-1706.961) (-1713.253) (-1713.506) [-1706.708] -- 0:02:43
164500 -- (-1714.111) (-1713.334) [-1710.436] (-1725.744) * (-1712.113) (-1712.785) [-1714.814] (-1707.315) -- 0:02:42
165000 -- (-1714.337) (-1714.704) (-1708.953) [-1711.557] * (-1707.034) (-1708.724) (-1715.655) [-1711.844] -- 0:02:41
Average standard deviation of split frequencies: 0.029344
165500 -- [-1708.189] (-1716.867) (-1711.571) (-1712.804) * (-1707.568) [-1715.433] (-1714.939) (-1715.868) -- 0:02:41
166000 -- (-1711.144) (-1714.432) [-1711.622] (-1711.803) * (-1711.905) (-1713.782) [-1706.596] (-1708.591) -- 0:02:40
166500 -- (-1710.048) [-1713.461] (-1713.320) (-1715.355) * [-1710.940] (-1708.514) (-1711.847) (-1712.286) -- 0:02:40
167000 -- (-1708.189) (-1709.139) [-1708.068] (-1708.585) * (-1716.125) (-1712.832) (-1707.629) [-1707.064] -- 0:02:39
167500 -- [-1715.546] (-1717.923) (-1708.273) (-1710.562) * (-1714.628) (-1712.558) (-1713.706) [-1710.534] -- 0:02:39
168000 -- (-1713.937) [-1711.524] (-1712.404) (-1713.044) * (-1712.439) (-1708.729) [-1714.333] (-1711.092) -- 0:02:38
168500 -- [-1709.569] (-1711.300) (-1714.372) (-1704.872) * (-1716.193) [-1714.531] (-1711.132) (-1716.235) -- 0:02:42
169000 -- [-1708.046] (-1717.086) (-1713.250) (-1711.324) * (-1712.751) [-1709.637] (-1714.313) (-1714.440) -- 0:02:42
169500 -- (-1720.738) (-1711.621) (-1712.223) [-1708.048] * (-1713.856) (-1710.678) [-1708.402] (-1713.421) -- 0:02:41
170000 -- (-1722.265) (-1709.463) (-1713.246) [-1707.337] * (-1709.580) (-1711.715) [-1709.924] (-1713.213) -- 0:02:41
Average standard deviation of split frequencies: 0.034066
170500 -- [-1712.030] (-1713.718) (-1723.793) (-1710.207) * (-1713.298) (-1710.854) [-1709.063] (-1716.233) -- 0:02:40
171000 -- [-1711.772] (-1708.628) (-1712.885) (-1709.094) * (-1709.549) (-1713.493) (-1716.089) [-1711.015] -- 0:02:39
171500 -- [-1710.868] (-1708.456) (-1725.169) (-1711.430) * (-1711.154) [-1711.194] (-1715.194) (-1717.239) -- 0:02:39
172000 -- (-1713.248) (-1708.199) (-1718.941) [-1713.683] * (-1710.032) (-1712.531) (-1715.483) [-1718.455] -- 0:02:38
172500 -- [-1713.710] (-1707.657) (-1708.564) (-1704.645) * (-1712.934) (-1708.824) (-1708.326) [-1716.549] -- 0:02:38
173000 -- (-1713.095) [-1709.473] (-1714.977) (-1713.397) * (-1713.911) (-1709.334) [-1708.555] (-1722.280) -- 0:02:37
173500 -- (-1707.763) (-1710.771) (-1713.393) [-1711.185] * [-1708.307] (-1706.988) (-1708.684) (-1715.656) -- 0:02:37
174000 -- [-1705.625] (-1706.412) (-1711.438) (-1709.393) * (-1709.285) [-1708.363] (-1709.791) (-1710.858) -- 0:02:41
174500 -- (-1708.070) (-1714.040) [-1707.641] (-1707.789) * (-1711.388) [-1709.302] (-1715.813) (-1719.366) -- 0:02:40
175000 -- (-1712.220) [-1710.391] (-1709.533) (-1712.815) * [-1705.842] (-1708.428) (-1721.273) (-1716.541) -- 0:02:40
Average standard deviation of split frequencies: 0.029463
175500 -- [-1710.104] (-1711.190) (-1705.017) (-1708.238) * (-1712.537) (-1713.630) [-1713.940] (-1716.238) -- 0:02:39
176000 -- (-1709.819) [-1713.293] (-1715.748) (-1712.437) * [-1712.062] (-1708.963) (-1709.759) (-1710.630) -- 0:02:39
176500 -- (-1708.082) [-1707.073] (-1704.871) (-1707.079) * (-1717.723) [-1707.106] (-1709.908) (-1710.568) -- 0:02:38
177000 -- (-1709.181) (-1706.387) (-1711.155) [-1713.697] * (-1714.853) (-1712.825) [-1705.774] (-1711.671) -- 0:02:38
177500 -- [-1709.590] (-1712.964) (-1715.297) (-1708.028) * (-1711.175) (-1708.103) (-1711.502) [-1713.400] -- 0:02:37
178000 -- (-1711.925) [-1712.808] (-1711.721) (-1708.817) * [-1713.175] (-1708.679) (-1719.534) (-1714.502) -- 0:02:37
178500 -- (-1716.171) (-1710.304) [-1708.593] (-1712.300) * (-1714.034) (-1708.633) (-1711.329) [-1708.414] -- 0:02:36
179000 -- (-1720.459) [-1716.490] (-1719.288) (-1711.664) * (-1712.879) [-1711.673] (-1714.074) (-1710.527) -- 0:02:40
179500 -- (-1713.147) (-1712.807) (-1710.522) [-1708.098] * [-1704.599] (-1711.574) (-1714.691) (-1709.406) -- 0:02:39
180000 -- [-1712.744] (-1711.921) (-1712.952) (-1712.988) * [-1708.215] (-1709.787) (-1716.188) (-1712.836) -- 0:02:39
Average standard deviation of split frequencies: 0.021744
180500 -- (-1715.275) (-1713.899) (-1712.031) [-1715.170] * [-1707.918] (-1712.760) (-1711.189) (-1717.873) -- 0:02:38
181000 -- (-1710.270) [-1721.656] (-1719.648) (-1717.217) * (-1709.319) [-1716.101] (-1712.946) (-1713.835) -- 0:02:38
181500 -- [-1708.870] (-1709.886) (-1711.818) (-1720.373) * (-1714.163) (-1712.643) [-1709.983] (-1712.733) -- 0:02:37
182000 -- (-1712.556) [-1706.258] (-1713.677) (-1715.214) * [-1706.119] (-1719.667) (-1709.055) (-1707.105) -- 0:02:37
182500 -- [-1707.959] (-1706.614) (-1711.136) (-1719.152) * (-1709.333) (-1715.215) [-1709.504] (-1708.511) -- 0:02:36
183000 -- (-1712.206) (-1705.330) [-1710.146] (-1723.317) * [-1713.187] (-1711.731) (-1706.904) (-1707.815) -- 0:02:36
183500 -- [-1705.047] (-1713.108) (-1709.201) (-1718.497) * [-1708.877] (-1711.220) (-1706.240) (-1714.498) -- 0:02:35
184000 -- (-1714.908) (-1711.431) [-1709.015] (-1711.411) * [-1710.052] (-1712.437) (-1706.540) (-1707.771) -- 0:02:35
184500 -- (-1708.209) (-1710.654) [-1710.614] (-1713.753) * (-1713.490) [-1712.268] (-1708.677) (-1722.623) -- 0:02:39
185000 -- (-1711.276) (-1714.037) (-1712.919) [-1711.261] * (-1712.094) [-1706.974] (-1719.730) (-1708.488) -- 0:02:38
Average standard deviation of split frequencies: 0.021120
185500 -- (-1719.451) (-1709.812) [-1706.679] (-1711.763) * (-1707.979) (-1704.910) (-1712.157) [-1705.700] -- 0:02:38
186000 -- (-1710.566) (-1710.995) [-1710.948] (-1715.232) * (-1709.770) [-1709.332] (-1711.388) (-1711.402) -- 0:02:37
186500 -- (-1712.793) (-1711.430) (-1710.446) [-1711.006] * (-1712.742) (-1710.601) [-1709.892] (-1715.177) -- 0:02:37
187000 -- (-1711.830) (-1712.200) [-1710.147] (-1718.569) * (-1711.830) (-1714.485) (-1714.598) [-1710.559] -- 0:02:36
187500 -- (-1709.764) (-1710.383) [-1715.309] (-1712.535) * (-1706.612) (-1712.332) (-1714.420) [-1711.990] -- 0:02:36
188000 -- [-1706.842] (-1710.581) (-1719.792) (-1715.910) * (-1717.610) (-1707.454) [-1718.577] (-1717.420) -- 0:02:35
188500 -- [-1711.520] (-1710.320) (-1715.071) (-1714.423) * (-1714.126) [-1708.591] (-1717.923) (-1709.637) -- 0:02:34
189000 -- [-1709.312] (-1715.247) (-1711.712) (-1717.771) * (-1712.730) [-1709.068] (-1713.101) (-1714.233) -- 0:02:34
189500 -- (-1710.735) (-1713.761) (-1715.582) [-1713.718] * (-1712.098) [-1712.471] (-1716.943) (-1709.658) -- 0:02:38
190000 -- [-1709.722] (-1712.861) (-1714.095) (-1713.528) * (-1709.853) [-1711.497] (-1711.614) (-1708.920) -- 0:02:37
Average standard deviation of split frequencies: 0.023076
190500 -- (-1717.602) (-1710.562) [-1707.411] (-1713.840) * (-1714.924) (-1718.237) (-1709.827) [-1708.017] -- 0:02:37
191000 -- [-1718.798] (-1713.781) (-1713.522) (-1716.441) * (-1707.206) (-1713.036) (-1708.904) [-1705.339] -- 0:02:36
191500 -- (-1710.598) (-1713.175) [-1705.864] (-1712.237) * (-1708.110) [-1709.875] (-1712.122) (-1707.531) -- 0:02:36
192000 -- (-1706.285) (-1716.939) (-1711.569) [-1713.685] * (-1713.040) (-1714.267) [-1705.044] (-1709.088) -- 0:02:35
192500 -- (-1709.413) (-1710.386) (-1707.955) [-1714.027] * (-1715.298) (-1714.966) (-1717.679) [-1705.404] -- 0:02:35
193000 -- (-1713.283) [-1708.661] (-1710.667) (-1710.813) * (-1709.782) (-1708.777) (-1713.999) [-1712.023] -- 0:02:34
193500 -- [-1708.066] (-1714.839) (-1708.749) (-1708.821) * (-1711.766) (-1714.870) [-1707.871] (-1712.286) -- 0:02:34
194000 -- (-1711.109) [-1710.165] (-1708.694) (-1715.444) * [-1711.711] (-1715.323) (-1710.331) (-1711.964) -- 0:02:33
194500 -- (-1709.288) (-1712.047) (-1708.211) [-1710.033] * [-1711.056] (-1710.748) (-1715.498) (-1718.424) -- 0:02:33
195000 -- [-1712.798] (-1716.285) (-1705.739) (-1708.732) * (-1713.316) [-1708.956] (-1708.413) (-1711.243) -- 0:02:36
Average standard deviation of split frequencies: 0.021646
195500 -- (-1715.407) (-1714.068) [-1712.486] (-1711.978) * (-1713.462) (-1709.729) (-1716.176) [-1711.435] -- 0:02:36
196000 -- (-1711.669) [-1709.410] (-1710.053) (-1708.851) * [-1712.384] (-1714.535) (-1718.389) (-1710.197) -- 0:02:35
196500 -- (-1711.773) (-1710.243) [-1709.106] (-1707.631) * (-1710.591) [-1707.715] (-1716.457) (-1709.173) -- 0:02:35
197000 -- (-1709.295) (-1711.577) (-1709.703) [-1710.002] * (-1712.511) (-1705.871) (-1722.469) [-1714.716] -- 0:02:34
197500 -- (-1708.808) (-1711.346) [-1711.406] (-1707.724) * (-1710.803) (-1716.224) [-1706.022] (-1713.880) -- 0:02:34
198000 -- (-1704.644) (-1714.627) (-1714.664) [-1710.910] * [-1711.290] (-1707.634) (-1706.540) (-1712.157) -- 0:02:33
198500 -- (-1707.232) (-1716.491) [-1707.379] (-1710.323) * (-1705.182) [-1706.808] (-1706.175) (-1710.883) -- 0:02:33
199000 -- [-1710.156] (-1714.493) (-1714.612) (-1707.878) * [-1713.472] (-1712.734) (-1706.648) (-1708.941) -- 0:02:32
199500 -- (-1707.496) (-1708.807) (-1708.614) [-1710.307] * [-1706.969] (-1711.110) (-1715.517) (-1716.988) -- 0:02:32
200000 -- (-1705.952) (-1714.623) [-1709.895] (-1719.826) * (-1709.778) (-1712.993) (-1713.133) [-1713.798] -- 0:02:36
Average standard deviation of split frequencies: 0.020360
200500 -- (-1713.285) (-1712.848) [-1709.105] (-1717.689) * (-1711.299) [-1712.755] (-1720.377) (-1718.518) -- 0:02:35
201000 -- (-1715.038) (-1714.317) (-1707.479) [-1713.349] * [-1707.816] (-1711.144) (-1712.139) (-1720.592) -- 0:02:35
201500 -- (-1712.085) (-1714.226) [-1706.779] (-1710.353) * (-1709.851) (-1709.076) [-1717.551] (-1708.270) -- 0:02:34
202000 -- (-1709.784) (-1711.642) (-1720.783) [-1707.804] * (-1712.784) (-1712.734) (-1716.419) [-1710.571] -- 0:02:34
202500 -- [-1707.522] (-1708.808) (-1715.904) (-1712.993) * (-1713.941) [-1712.473] (-1713.891) (-1713.181) -- 0:02:33
203000 -- (-1708.477) (-1708.944) (-1716.905) [-1708.631] * (-1712.698) [-1711.886] (-1716.625) (-1708.789) -- 0:02:33
203500 -- [-1708.083] (-1711.541) (-1712.530) (-1710.981) * (-1718.700) [-1721.312] (-1719.578) (-1709.034) -- 0:02:32
204000 -- (-1707.595) (-1709.778) [-1711.823] (-1714.251) * (-1718.679) (-1713.694) (-1709.846) [-1709.109] -- 0:02:32
204500 -- (-1712.190) (-1709.437) (-1715.160) [-1705.588] * (-1706.624) (-1712.747) [-1707.552] (-1708.312) -- 0:02:31
205000 -- [-1712.160] (-1707.658) (-1715.599) (-1715.064) * (-1711.853) (-1709.399) (-1716.400) [-1709.511] -- 0:02:31
Average standard deviation of split frequencies: 0.024409
205500 -- (-1710.791) (-1710.151) [-1710.682] (-1713.575) * [-1717.068] (-1710.354) (-1710.581) (-1706.975) -- 0:02:34
206000 -- [-1718.009] (-1707.305) (-1710.568) (-1715.276) * [-1713.534] (-1712.128) (-1719.199) (-1714.938) -- 0:02:34
206500 -- (-1709.120) (-1713.521) (-1712.679) [-1709.198] * [-1704.855] (-1709.738) (-1716.219) (-1706.343) -- 0:02:33
207000 -- (-1713.192) (-1712.622) [-1709.690] (-1715.761) * (-1708.817) [-1721.688] (-1710.445) (-1713.247) -- 0:02:33
207500 -- [-1708.457] (-1709.686) (-1713.827) (-1714.790) * (-1718.495) (-1709.628) [-1706.619] (-1713.352) -- 0:02:32
208000 -- [-1706.102] (-1711.945) (-1711.755) (-1712.311) * [-1712.108] (-1708.186) (-1713.162) (-1710.092) -- 0:02:32
208500 -- [-1704.956] (-1706.871) (-1713.059) (-1717.455) * [-1713.567] (-1707.978) (-1716.351) (-1712.541) -- 0:02:31
209000 -- (-1712.917) (-1706.742) [-1709.205] (-1724.556) * [-1719.690] (-1709.243) (-1712.605) (-1709.680) -- 0:02:31
209500 -- (-1710.491) (-1707.595) [-1709.333] (-1714.982) * (-1714.707) (-1707.475) (-1714.290) [-1710.418] -- 0:02:30
210000 -- (-1708.937) (-1711.713) (-1715.231) [-1712.631] * (-1709.200) (-1714.345) [-1713.138] (-1708.212) -- 0:02:30
Average standard deviation of split frequencies: 0.023123
210500 -- (-1715.578) (-1711.942) (-1709.680) [-1708.383] * (-1713.677) [-1711.084] (-1715.158) (-1716.988) -- 0:02:30
211000 -- [-1705.193] (-1713.455) (-1711.952) (-1708.675) * (-1712.753) (-1715.985) (-1711.517) [-1713.134] -- 0:02:33
211500 -- (-1710.288) [-1709.752] (-1716.855) (-1705.695) * (-1710.650) [-1709.285] (-1712.926) (-1717.041) -- 0:02:32
212000 -- (-1711.869) (-1709.910) [-1707.855] (-1707.475) * [-1711.199] (-1716.992) (-1709.466) (-1719.236) -- 0:02:32
212500 -- [-1711.327] (-1706.412) (-1708.532) (-1711.825) * (-1710.921) (-1710.771) (-1709.432) [-1711.624] -- 0:02:31
213000 -- (-1711.062) (-1714.274) [-1716.217] (-1711.109) * (-1715.000) [-1708.796] (-1707.972) (-1716.667) -- 0:02:31
213500 -- (-1717.952) (-1711.785) [-1712.448] (-1711.869) * (-1711.047) (-1717.155) (-1717.538) [-1708.041] -- 0:02:31
214000 -- (-1708.144) (-1711.597) (-1713.115) [-1707.394] * (-1710.842) (-1718.446) [-1720.929] (-1711.347) -- 0:02:30
214500 -- (-1710.822) (-1705.962) [-1709.747] (-1707.566) * [-1711.495] (-1710.964) (-1711.439) (-1712.319) -- 0:02:30
215000 -- [-1708.619] (-1709.138) (-1714.741) (-1711.071) * (-1705.886) [-1709.655] (-1714.051) (-1705.452) -- 0:02:29
Average standard deviation of split frequencies: 0.020369
215500 -- [-1707.397] (-1713.309) (-1711.060) (-1711.051) * [-1713.110] (-1709.824) (-1714.332) (-1706.686) -- 0:02:29
216000 -- (-1713.880) (-1711.353) (-1709.488) [-1707.497] * (-1710.073) (-1713.260) (-1719.785) [-1712.407] -- 0:02:32
216500 -- (-1711.535) [-1706.551] (-1715.220) (-1711.309) * [-1711.440] (-1718.174) (-1715.184) (-1708.884) -- 0:02:31
217000 -- (-1713.136) (-1709.626) (-1712.296) [-1719.021] * [-1710.808] (-1715.662) (-1722.387) (-1709.205) -- 0:02:31
217500 -- (-1709.504) (-1709.527) (-1713.616) [-1711.566] * [-1709.186] (-1718.695) (-1718.530) (-1707.222) -- 0:02:31
218000 -- (-1708.038) (-1707.452) (-1711.988) [-1707.013] * [-1710.968] (-1713.997) (-1720.307) (-1711.807) -- 0:02:30
218500 -- (-1709.694) (-1712.134) (-1708.451) [-1712.342] * (-1710.298) (-1715.794) (-1715.265) [-1717.935] -- 0:02:30
219000 -- [-1713.036] (-1717.367) (-1712.325) (-1715.690) * (-1708.678) (-1713.454) (-1718.789) [-1712.176] -- 0:02:29
219500 -- [-1705.727] (-1705.628) (-1708.946) (-1710.858) * (-1706.349) [-1710.010] (-1721.752) (-1709.885) -- 0:02:29
220000 -- [-1708.462] (-1708.728) (-1713.393) (-1711.475) * (-1709.614) [-1711.378] (-1713.107) (-1707.943) -- 0:02:28
Average standard deviation of split frequencies: 0.016378
220500 -- (-1709.148) (-1716.854) [-1710.628] (-1709.550) * (-1714.516) [-1711.084] (-1709.695) (-1712.433) -- 0:02:28
221000 -- (-1707.394) (-1708.737) [-1708.246] (-1708.353) * [-1708.797] (-1709.387) (-1718.377) (-1711.290) -- 0:02:28
221500 -- [-1708.700] (-1709.193) (-1713.918) (-1710.405) * (-1717.939) (-1711.742) (-1710.425) [-1706.224] -- 0:02:31
222000 -- [-1709.075] (-1714.471) (-1710.270) (-1711.955) * (-1708.872) (-1717.970) (-1704.908) [-1711.361] -- 0:02:30
222500 -- (-1711.101) [-1708.996] (-1708.050) (-1713.364) * (-1710.138) (-1709.886) (-1706.260) [-1709.631] -- 0:02:30
223000 -- [-1706.107] (-1717.322) (-1706.979) (-1714.099) * (-1705.779) (-1711.839) [-1706.794] (-1712.529) -- 0:02:29
223500 -- (-1713.585) (-1709.997) [-1712.856] (-1709.221) * (-1717.903) (-1709.801) [-1711.551] (-1709.786) -- 0:02:29
224000 -- (-1717.977) [-1708.002] (-1714.207) (-1707.315) * (-1712.167) (-1707.640) (-1711.458) [-1709.973] -- 0:02:28
224500 -- (-1713.590) (-1711.261) (-1710.085) [-1705.807] * (-1714.222) [-1706.257] (-1716.718) (-1707.016) -- 0:02:28
225000 -- (-1712.687) [-1703.820] (-1713.096) (-1704.877) * (-1713.868) (-1707.428) (-1713.016) [-1708.658] -- 0:02:28
Average standard deviation of split frequencies: 0.021554
225500 -- (-1710.809) (-1708.143) (-1707.888) [-1714.399] * [-1708.640] (-1714.482) (-1712.019) (-1708.406) -- 0:02:27
226000 -- [-1707.537] (-1708.571) (-1707.474) (-1707.681) * (-1714.453) [-1713.907] (-1713.413) (-1714.121) -- 0:02:27
226500 -- (-1706.532) (-1706.612) [-1707.544] (-1706.471) * [-1711.026] (-1717.853) (-1711.831) (-1708.295) -- 0:02:30
227000 -- (-1712.620) (-1708.296) [-1706.201] (-1713.725) * (-1708.421) (-1712.249) [-1710.000] (-1707.743) -- 0:02:29
227500 -- (-1708.271) [-1704.419] (-1714.079) (-1717.603) * (-1707.256) (-1707.838) (-1710.654) [-1707.555] -- 0:02:29
228000 -- [-1712.260] (-1705.623) (-1714.716) (-1714.164) * (-1708.516) [-1705.680] (-1710.838) (-1716.256) -- 0:02:28
228500 -- [-1714.269] (-1708.722) (-1708.837) (-1708.469) * (-1711.937) (-1706.945) [-1706.639] (-1718.323) -- 0:02:28
229000 -- (-1712.034) (-1708.814) (-1708.950) [-1712.488] * [-1706.500] (-1711.098) (-1709.134) (-1720.155) -- 0:02:28
229500 -- (-1712.592) [-1713.907] (-1715.269) (-1711.891) * (-1711.929) (-1709.967) [-1708.617] (-1718.433) -- 0:02:27
230000 -- (-1713.514) (-1713.262) (-1709.764) [-1708.937] * [-1706.023] (-1716.715) (-1712.077) (-1712.354) -- 0:02:27
Average standard deviation of split frequencies: 0.023161
230500 -- (-1716.225) (-1715.879) [-1712.793] (-1709.966) * (-1712.901) (-1710.810) (-1709.063) [-1706.391] -- 0:02:26
231000 -- (-1713.048) (-1711.804) (-1712.680) [-1707.741] * [-1705.234] (-1711.956) (-1708.221) (-1707.783) -- 0:02:26
231500 -- [-1712.370] (-1706.032) (-1711.900) (-1714.821) * (-1706.588) (-1706.142) [-1711.216] (-1713.207) -- 0:02:26
232000 -- (-1708.798) [-1708.955] (-1708.020) (-1710.286) * [-1709.420] (-1718.162) (-1714.837) (-1717.352) -- 0:02:28
232500 -- [-1708.485] (-1708.757) (-1710.365) (-1704.757) * (-1712.003) (-1714.794) (-1716.202) [-1716.678] -- 0:02:28
233000 -- [-1714.074] (-1712.208) (-1710.774) (-1708.018) * (-1708.347) (-1713.723) (-1711.076) [-1713.123] -- 0:02:28
233500 -- (-1715.131) (-1717.596) [-1710.519] (-1712.207) * (-1712.490) (-1714.982) (-1713.948) [-1713.441] -- 0:02:27
234000 -- [-1714.035] (-1724.132) (-1713.703) (-1712.520) * (-1710.235) [-1712.224] (-1711.095) (-1713.055) -- 0:02:27
234500 -- (-1714.417) (-1712.858) (-1711.515) [-1715.790] * (-1712.300) (-1713.667) [-1712.280] (-1714.274) -- 0:02:26
235000 -- (-1711.312) [-1714.518] (-1709.474) (-1712.832) * (-1714.624) (-1709.424) [-1708.269] (-1720.069) -- 0:02:26
Average standard deviation of split frequencies: 0.025301
235500 -- [-1713.566] (-1716.187) (-1711.258) (-1716.774) * (-1708.624) (-1705.646) (-1715.619) [-1707.794] -- 0:02:26
236000 -- (-1710.137) (-1714.583) [-1711.008] (-1713.384) * (-1706.489) (-1711.011) (-1713.928) [-1704.765] -- 0:02:25
236500 -- [-1707.377] (-1713.118) (-1709.627) (-1721.185) * (-1708.677) [-1711.352] (-1712.441) (-1707.378) -- 0:02:25
237000 -- (-1716.432) (-1709.330) [-1710.779] (-1711.327) * (-1709.461) [-1709.230] (-1715.217) (-1709.103) -- 0:02:24
237500 -- [-1719.750] (-1711.181) (-1711.397) (-1712.609) * [-1707.304] (-1708.862) (-1709.140) (-1714.212) -- 0:02:27
238000 -- (-1713.638) (-1707.210) [-1709.407] (-1714.138) * (-1711.686) [-1706.140] (-1706.879) (-1715.067) -- 0:02:27
238500 -- (-1715.987) (-1711.626) (-1712.982) [-1712.279] * [-1711.034] (-1717.049) (-1705.966) (-1715.387) -- 0:02:26
239000 -- [-1712.524] (-1717.244) (-1713.176) (-1714.211) * (-1713.070) [-1707.395] (-1711.096) (-1716.843) -- 0:02:26
239500 -- (-1712.909) [-1711.847] (-1714.546) (-1709.539) * (-1716.597) [-1709.546] (-1707.879) (-1709.256) -- 0:02:26
240000 -- [-1710.719] (-1714.005) (-1712.617) (-1714.293) * (-1713.695) (-1711.507) [-1704.361] (-1717.038) -- 0:02:25
Average standard deviation of split frequencies: 0.023505
240500 -- [-1709.496] (-1712.735) (-1715.760) (-1718.082) * [-1707.422] (-1712.203) (-1710.368) (-1715.307) -- 0:02:25
241000 -- (-1712.438) [-1715.133] (-1713.810) (-1713.293) * (-1716.861) (-1713.577) (-1709.689) [-1708.530] -- 0:02:24
241500 -- (-1706.766) (-1711.837) (-1715.062) [-1714.038] * (-1708.527) (-1706.594) [-1709.219] (-1709.241) -- 0:02:24
242000 -- [-1709.456] (-1715.410) (-1711.563) (-1716.504) * (-1707.808) (-1717.039) [-1707.297] (-1716.276) -- 0:02:24
242500 -- (-1706.752) (-1712.310) (-1716.761) [-1705.400] * (-1709.733) (-1722.793) (-1716.288) [-1710.092] -- 0:02:26
243000 -- (-1712.970) (-1721.639) (-1715.626) [-1706.930] * (-1712.481) (-1715.235) [-1714.119] (-1709.842) -- 0:02:26
243500 -- [-1711.344] (-1721.217) (-1717.252) (-1712.912) * [-1710.624] (-1721.477) (-1713.792) (-1715.715) -- 0:02:26
244000 -- (-1708.173) [-1707.988] (-1718.881) (-1711.244) * (-1708.524) (-1714.683) (-1718.253) [-1705.903] -- 0:02:25
244500 -- [-1712.762] (-1716.202) (-1716.645) (-1711.668) * (-1712.620) (-1719.359) [-1713.048] (-1708.955) -- 0:02:25
245000 -- [-1707.988] (-1712.064) (-1714.437) (-1714.931) * [-1713.401] (-1713.232) (-1711.322) (-1724.492) -- 0:02:24
Average standard deviation of split frequencies: 0.026189
245500 -- (-1712.401) (-1712.437) [-1711.798] (-1715.509) * [-1708.967] (-1714.905) (-1708.767) (-1719.399) -- 0:02:24
246000 -- (-1715.179) (-1715.769) (-1713.077) [-1706.986] * (-1710.795) [-1712.639] (-1708.439) (-1716.647) -- 0:02:24
246500 -- (-1718.175) (-1711.401) (-1708.502) [-1709.008] * [-1714.222] (-1713.974) (-1709.661) (-1722.689) -- 0:02:23
247000 -- (-1720.887) (-1710.918) (-1716.837) [-1711.410] * (-1708.428) (-1719.114) [-1708.785] (-1708.421) -- 0:02:23
247500 -- (-1716.967) [-1708.672] (-1707.836) (-1710.934) * (-1711.750) (-1721.808) (-1706.545) [-1706.925] -- 0:02:22
248000 -- (-1711.923) (-1714.190) [-1709.477] (-1714.948) * (-1707.978) (-1708.971) [-1705.225] (-1706.916) -- 0:02:25
248500 -- (-1720.975) [-1714.707] (-1711.807) (-1706.399) * (-1714.975) (-1710.954) [-1712.185] (-1710.004) -- 0:02:25
249000 -- (-1714.023) (-1710.615) (-1714.192) [-1707.601] * (-1714.114) (-1708.039) (-1705.735) [-1705.957] -- 0:02:24
249500 -- [-1709.998] (-1707.253) (-1708.296) (-1710.035) * (-1714.707) [-1711.778] (-1706.269) (-1706.966) -- 0:02:24
250000 -- (-1714.728) [-1708.716] (-1709.705) (-1707.077) * (-1712.331) (-1714.895) (-1712.597) [-1714.550] -- 0:02:24
Average standard deviation of split frequencies: 0.026955
250500 -- (-1711.182) (-1710.921) [-1711.324] (-1713.025) * (-1713.871) (-1714.110) (-1709.165) [-1708.330] -- 0:02:23
251000 -- (-1712.619) (-1708.309) [-1709.461] (-1715.964) * [-1707.717] (-1714.701) (-1708.941) (-1707.890) -- 0:02:23
251500 -- (-1716.331) [-1711.022] (-1709.416) (-1715.599) * (-1710.192) (-1717.770) [-1710.124] (-1713.057) -- 0:02:22
252000 -- (-1713.260) (-1713.155) (-1712.035) [-1707.066] * [-1710.386] (-1710.696) (-1716.286) (-1706.424) -- 0:02:22
252500 -- (-1709.491) (-1705.553) [-1715.763] (-1716.604) * (-1708.534) [-1711.423] (-1713.064) (-1709.552) -- 0:02:22
253000 -- (-1709.566) (-1705.915) [-1718.155] (-1715.453) * (-1712.893) [-1712.361] (-1713.096) (-1712.497) -- 0:02:24
253500 -- (-1713.439) (-1710.646) [-1714.420] (-1717.354) * (-1709.375) [-1712.089] (-1709.135) (-1705.012) -- 0:02:24
254000 -- [-1710.971] (-1711.244) (-1713.419) (-1714.256) * (-1720.250) (-1712.299) [-1716.562] (-1709.838) -- 0:02:23
254500 -- (-1713.090) (-1711.156) (-1713.281) [-1716.901] * (-1709.579) (-1704.945) [-1709.118] (-1711.294) -- 0:02:23
255000 -- (-1716.797) [-1706.766] (-1715.555) (-1707.945) * [-1713.356] (-1707.936) (-1718.662) (-1719.723) -- 0:02:23
Average standard deviation of split frequencies: 0.024552
255500 -- (-1709.785) (-1711.558) (-1715.599) [-1709.351] * (-1708.296) [-1711.265] (-1719.591) (-1715.939) -- 0:02:22
256000 -- (-1709.916) (-1709.233) (-1713.039) [-1705.927] * (-1710.088) [-1711.044] (-1715.855) (-1705.450) -- 0:02:22
256500 -- (-1714.110) (-1712.140) [-1712.993] (-1710.294) * [-1709.410] (-1709.978) (-1709.457) (-1708.995) -- 0:02:22
257000 -- (-1711.226) [-1711.235] (-1709.433) (-1710.815) * (-1716.696) (-1715.289) (-1712.195) [-1711.034] -- 0:02:21
257500 -- (-1715.052) (-1711.026) [-1708.379] (-1713.395) * [-1709.633] (-1709.656) (-1715.345) (-1717.203) -- 0:02:21
258000 -- (-1714.393) (-1710.337) [-1709.986] (-1713.878) * (-1714.452) [-1710.607] (-1713.709) (-1709.066) -- 0:02:20
258500 -- (-1716.424) (-1709.341) (-1716.361) [-1715.462] * (-1704.954) (-1712.269) (-1707.554) [-1709.877] -- 0:02:23
259000 -- [-1709.416] (-1708.383) (-1711.121) (-1712.784) * (-1712.643) (-1718.126) (-1706.624) [-1707.523] -- 0:02:23
259500 -- [-1709.166] (-1709.909) (-1713.944) (-1708.418) * (-1717.084) (-1712.140) [-1713.553] (-1711.470) -- 0:02:22
260000 -- (-1716.825) (-1710.723) (-1711.194) [-1711.153] * [-1708.270] (-1708.968) (-1713.937) (-1704.687) -- 0:02:22
Average standard deviation of split frequencies: 0.023510
260500 -- (-1711.776) (-1707.941) [-1706.720] (-1707.907) * (-1706.847) (-1707.905) (-1710.544) [-1709.389] -- 0:02:21
261000 -- (-1710.641) (-1710.049) (-1713.097) [-1709.929] * (-1708.655) (-1710.268) [-1711.191] (-1710.090) -- 0:02:21
261500 -- [-1706.378] (-1712.246) (-1708.240) (-1713.032) * (-1708.038) (-1707.546) (-1707.478) [-1710.923] -- 0:02:21
262000 -- [-1711.101] (-1708.812) (-1710.313) (-1713.471) * (-1712.096) (-1709.843) [-1710.104] (-1711.477) -- 0:02:20
262500 -- (-1709.679) (-1710.013) (-1711.408) [-1713.895] * [-1712.543] (-1717.121) (-1709.375) (-1713.161) -- 0:02:20
263000 -- [-1707.692] (-1710.736) (-1712.996) (-1714.018) * (-1707.977) (-1713.928) [-1708.092] (-1713.724) -- 0:02:20
263500 -- [-1715.981] (-1713.268) (-1712.251) (-1713.063) * (-1709.634) (-1710.620) [-1712.426] (-1709.785) -- 0:02:19
264000 -- (-1709.271) [-1708.704] (-1724.203) (-1709.641) * (-1710.874) (-1714.039) (-1708.744) [-1712.911] -- 0:02:22
264500 -- [-1706.306] (-1712.019) (-1718.246) (-1710.844) * (-1718.623) (-1713.059) [-1714.189] (-1712.292) -- 0:02:21
265000 -- [-1709.653] (-1707.851) (-1710.872) (-1712.991) * (-1714.091) [-1709.262] (-1718.006) (-1708.986) -- 0:02:21
Average standard deviation of split frequencies: 0.019494
265500 -- (-1715.185) (-1710.132) (-1707.033) [-1714.134] * [-1706.035] (-1708.574) (-1717.105) (-1710.488) -- 0:02:21
266000 -- (-1709.467) (-1707.666) (-1711.351) [-1710.941] * [-1708.641] (-1707.597) (-1709.936) (-1711.757) -- 0:02:20
266500 -- (-1712.620) (-1706.876) [-1714.427] (-1711.343) * (-1713.515) (-1713.718) [-1710.108] (-1714.744) -- 0:02:20
267000 -- (-1708.083) (-1716.671) (-1711.587) [-1706.490] * (-1710.979) [-1709.140] (-1704.725) (-1714.622) -- 0:02:20
267500 -- (-1712.303) (-1710.219) (-1712.212) [-1706.481] * (-1711.487) (-1712.049) (-1711.263) [-1709.717] -- 0:02:19
268000 -- (-1707.692) [-1712.453] (-1706.525) (-1715.777) * (-1713.448) [-1707.211] (-1712.430) (-1707.864) -- 0:02:19
268500 -- [-1709.485] (-1715.459) (-1709.854) (-1710.543) * (-1711.319) [-1706.808] (-1710.984) (-1710.755) -- 0:02:18
269000 -- (-1709.687) [-1707.433] (-1711.431) (-1721.490) * (-1709.667) (-1716.799) [-1704.690] (-1709.021) -- 0:02:18
269500 -- (-1707.724) [-1715.102] (-1711.269) (-1706.550) * (-1714.724) (-1712.564) [-1710.635] (-1706.590) -- 0:02:20
270000 -- (-1713.793) (-1708.413) (-1708.777) [-1705.196] * (-1715.789) (-1707.959) [-1705.257] (-1710.800) -- 0:02:20
Average standard deviation of split frequencies: 0.020319
270500 -- (-1708.627) (-1709.912) [-1712.428] (-1708.044) * (-1709.018) (-1706.929) [-1709.136] (-1708.500) -- 0:02:20
271000 -- (-1711.068) (-1716.030) [-1713.050] (-1710.318) * [-1710.314] (-1707.478) (-1710.262) (-1717.292) -- 0:02:19
271500 -- [-1706.766] (-1708.012) (-1714.221) (-1706.472) * (-1711.254) (-1714.393) [-1707.154] (-1706.341) -- 0:02:19
272000 -- (-1708.818) (-1713.564) (-1708.600) [-1707.205] * (-1706.572) (-1708.676) (-1713.519) [-1712.087] -- 0:02:19
272500 -- [-1711.439] (-1715.616) (-1709.129) (-1713.945) * (-1717.729) (-1713.487) (-1708.035) [-1717.442] -- 0:02:18
273000 -- (-1714.142) (-1714.645) [-1711.599] (-1707.272) * (-1719.573) (-1711.734) [-1711.458] (-1714.198) -- 0:02:18
273500 -- (-1714.313) (-1716.656) (-1709.452) [-1707.623] * [-1709.395] (-1709.295) (-1703.970) (-1712.713) -- 0:02:18
274000 -- (-1708.746) (-1714.954) (-1713.952) [-1708.700] * (-1720.192) [-1706.189] (-1705.643) (-1710.877) -- 0:02:17
274500 -- (-1710.627) (-1715.934) [-1707.971] (-1710.787) * [-1708.060] (-1706.054) (-1706.516) (-1715.728) -- 0:02:20
275000 -- (-1708.943) (-1713.889) (-1705.830) [-1709.369] * (-1715.790) (-1707.125) (-1716.037) [-1707.934] -- 0:02:19
Average standard deviation of split frequencies: 0.021065
275500 -- (-1711.037) (-1712.593) [-1708.228] (-1714.943) * (-1713.511) (-1706.187) (-1713.632) [-1710.018] -- 0:02:19
276000 -- [-1710.235] (-1720.696) (-1710.385) (-1713.789) * (-1711.631) (-1711.005) (-1706.833) [-1709.334] -- 0:02:19
276500 -- (-1715.062) (-1712.493) (-1707.874) [-1707.213] * [-1709.306] (-1714.654) (-1708.992) (-1717.257) -- 0:02:18
277000 -- (-1712.459) (-1711.813) (-1709.104) [-1707.515] * [-1710.394] (-1710.956) (-1709.197) (-1718.237) -- 0:02:18
277500 -- (-1711.917) (-1713.193) (-1713.081) [-1710.154] * (-1715.398) (-1711.162) [-1709.666] (-1710.775) -- 0:02:17
278000 -- (-1712.872) (-1707.236) [-1716.866] (-1712.744) * [-1707.210] (-1715.593) (-1711.117) (-1717.128) -- 0:02:17
278500 -- [-1707.571] (-1705.972) (-1712.079) (-1709.802) * (-1722.178) (-1705.497) (-1707.226) [-1714.358] -- 0:02:17
279000 -- [-1715.310] (-1709.735) (-1714.514) (-1703.773) * (-1716.128) (-1711.293) (-1715.037) [-1707.222] -- 0:02:16
279500 -- (-1706.597) [-1712.640] (-1715.768) (-1713.773) * (-1709.731) [-1707.655] (-1709.814) (-1707.516) -- 0:02:16
280000 -- (-1710.609) (-1713.967) (-1722.772) [-1710.341] * [-1708.580] (-1708.690) (-1721.150) (-1708.337) -- 0:02:18
Average standard deviation of split frequencies: 0.020155
280500 -- [-1712.171] (-1711.478) (-1716.020) (-1718.080) * (-1713.914) [-1713.925] (-1713.567) (-1708.827) -- 0:02:18
281000 -- (-1711.800) [-1707.192] (-1714.696) (-1709.069) * (-1718.635) (-1711.766) (-1712.003) [-1710.300] -- 0:02:18
281500 -- (-1714.659) (-1711.556) (-1713.293) [-1710.152] * [-1711.231] (-1713.146) (-1714.433) (-1714.065) -- 0:02:17
282000 -- (-1710.483) (-1708.629) (-1717.919) [-1714.485] * (-1708.779) (-1713.400) [-1713.363] (-1711.398) -- 0:02:17
282500 -- (-1709.816) (-1710.556) [-1712.505] (-1709.303) * [-1709.083] (-1710.008) (-1716.224) (-1709.746) -- 0:02:17
283000 -- (-1717.807) (-1710.628) [-1708.020] (-1711.745) * (-1711.924) [-1717.031] (-1713.041) (-1711.673) -- 0:02:16
283500 -- (-1713.255) (-1715.032) [-1707.992] (-1710.786) * (-1709.364) [-1712.454] (-1708.583) (-1707.831) -- 0:02:16
284000 -- (-1715.504) (-1714.879) (-1716.393) [-1713.877] * [-1714.138] (-1718.566) (-1710.146) (-1712.578) -- 0:02:16
284500 -- (-1725.700) [-1711.965] (-1710.786) (-1720.837) * (-1710.440) (-1712.156) (-1715.135) [-1712.152] -- 0:02:15
285000 -- (-1723.666) (-1718.774) (-1713.972) [-1716.405] * [-1708.651] (-1715.595) (-1709.710) (-1712.947) -- 0:02:15
Average standard deviation of split frequencies: 0.020878
285500 -- (-1721.208) [-1714.096] (-1711.152) (-1713.741) * (-1716.308) (-1718.755) (-1703.168) [-1705.572] -- 0:02:17
286000 -- [-1717.447] (-1726.077) (-1710.804) (-1718.921) * (-1711.887) (-1715.946) [-1711.283] (-1716.955) -- 0:02:17
286500 -- (-1714.730) (-1723.979) [-1711.448] (-1713.368) * (-1708.107) [-1715.634] (-1707.393) (-1714.927) -- 0:02:16
287000 -- (-1720.409) [-1711.643] (-1721.898) (-1718.408) * (-1711.685) (-1718.101) [-1714.021] (-1713.168) -- 0:02:16
287500 -- (-1716.678) [-1711.524] (-1708.745) (-1713.794) * (-1710.655) (-1713.090) (-1706.250) [-1709.850] -- 0:02:16
288000 -- (-1711.720) (-1715.013) [-1708.285] (-1715.400) * (-1714.673) (-1710.200) [-1708.991] (-1708.786) -- 0:02:15
288500 -- (-1709.686) (-1714.770) [-1705.501] (-1720.017) * (-1710.709) [-1709.973] (-1709.930) (-1710.971) -- 0:02:15
289000 -- (-1714.101) (-1709.365) [-1709.725] (-1715.418) * (-1712.754) (-1712.648) [-1708.778] (-1706.618) -- 0:02:15
289500 -- (-1713.835) (-1712.959) (-1712.086) [-1721.916] * (-1710.787) (-1714.586) (-1711.923) [-1712.577] -- 0:02:14
290000 -- [-1706.699] (-1715.388) (-1712.483) (-1714.424) * [-1710.782] (-1712.300) (-1707.371) (-1709.005) -- 0:02:14
Average standard deviation of split frequencies: 0.018380
290500 -- (-1717.252) (-1711.692) (-1712.945) [-1707.313] * [-1713.230] (-1711.935) (-1712.486) (-1710.267) -- 0:02:16
291000 -- (-1708.016) [-1715.915] (-1712.572) (-1707.014) * [-1710.268] (-1723.749) (-1714.175) (-1712.270) -- 0:02:16
291500 -- [-1708.086] (-1716.902) (-1712.977) (-1713.942) * (-1718.325) (-1711.640) [-1710.991] (-1712.179) -- 0:02:16
292000 -- (-1716.020) (-1713.172) (-1706.305) [-1708.626] * (-1713.222) (-1710.874) [-1712.939] (-1718.775) -- 0:02:15
292500 -- (-1709.774) [-1711.212] (-1709.277) (-1705.746) * [-1707.130] (-1710.274) (-1707.088) (-1710.589) -- 0:02:15
293000 -- [-1709.846] (-1710.167) (-1705.531) (-1709.642) * (-1713.609) [-1707.788] (-1711.935) (-1709.573) -- 0:02:15
293500 -- (-1709.805) (-1711.080) [-1708.286] (-1707.387) * (-1706.948) [-1717.673] (-1717.479) (-1712.168) -- 0:02:14
294000 -- (-1711.842) [-1709.346] (-1705.829) (-1705.632) * [-1707.246] (-1711.840) (-1714.510) (-1714.363) -- 0:02:14
294500 -- [-1718.289] (-1715.395) (-1707.053) (-1712.924) * (-1713.009) (-1710.627) [-1708.011] (-1715.858) -- 0:02:14
295000 -- (-1711.895) (-1709.538) (-1708.612) [-1710.561] * (-1718.944) [-1706.699] (-1709.947) (-1713.913) -- 0:02:13
Average standard deviation of split frequencies: 0.021234
295500 -- [-1706.603] (-1714.026) (-1713.391) (-1715.765) * (-1712.828) (-1715.768) [-1712.419] (-1718.720) -- 0:02:13
296000 -- (-1711.098) (-1713.308) (-1711.886) [-1717.752] * [-1714.754] (-1712.636) (-1709.209) (-1717.979) -- 0:02:15
296500 -- (-1705.753) [-1714.404] (-1712.647) (-1709.201) * (-1713.314) (-1716.122) [-1707.418] (-1708.394) -- 0:02:15
297000 -- (-1716.040) (-1706.920) [-1709.167] (-1709.096) * (-1718.165) (-1718.334) [-1710.951] (-1706.365) -- 0:02:14
297500 -- [-1710.637] (-1710.463) (-1712.663) (-1713.422) * (-1710.889) [-1708.727] (-1713.997) (-1716.786) -- 0:02:14
298000 -- (-1711.804) [-1708.431] (-1713.941) (-1716.422) * [-1707.528] (-1713.013) (-1712.463) (-1714.563) -- 0:02:14
298500 -- (-1705.336) (-1708.665) (-1714.793) [-1709.379] * (-1712.001) (-1713.970) (-1707.849) [-1715.508] -- 0:02:13
299000 -- (-1706.295) (-1712.771) (-1716.420) [-1707.190] * (-1707.552) (-1709.534) [-1708.546] (-1709.491) -- 0:02:13
299500 -- (-1710.009) [-1714.541] (-1710.740) (-1712.951) * [-1712.840] (-1715.435) (-1711.174) (-1716.695) -- 0:02:13
300000 -- (-1712.413) (-1709.154) (-1712.284) [-1708.836] * (-1708.420) (-1714.629) (-1723.139) [-1708.818] -- 0:02:13
Average standard deviation of split frequencies: 0.021427
300500 -- (-1711.952) [-1717.602] (-1712.068) (-1711.235) * (-1706.348) (-1712.869) (-1714.415) [-1710.961] -- 0:02:12
301000 -- (-1706.277) [-1711.462] (-1716.562) (-1712.178) * (-1709.421) [-1710.336] (-1712.701) (-1715.501) -- 0:02:12
301500 -- (-1707.897) (-1714.274) [-1713.038] (-1713.866) * (-1710.396) (-1711.235) [-1709.146] (-1706.287) -- 0:02:14
302000 -- (-1711.800) (-1721.287) [-1711.866] (-1712.564) * (-1710.956) (-1712.204) (-1712.915) [-1707.809] -- 0:02:14
302500 -- (-1716.620) (-1712.775) [-1715.088] (-1717.263) * (-1715.248) [-1711.277] (-1713.510) (-1709.351) -- 0:02:13
303000 -- (-1716.442) (-1711.856) (-1717.075) [-1710.054] * (-1718.551) [-1712.221] (-1706.806) (-1709.429) -- 0:02:13
303500 -- (-1707.978) (-1713.543) [-1708.919] (-1706.992) * (-1718.733) [-1711.362] (-1710.991) (-1706.590) -- 0:02:13
304000 -- (-1715.777) (-1707.452) [-1706.183] (-1714.991) * (-1719.892) (-1716.421) (-1713.058) [-1709.206] -- 0:02:12
304500 -- (-1710.900) [-1706.754] (-1712.392) (-1717.584) * (-1714.676) (-1715.726) (-1709.383) [-1707.262] -- 0:02:12
305000 -- (-1708.610) (-1716.943) [-1710.090] (-1707.447) * (-1711.947) (-1717.488) (-1711.635) [-1706.063] -- 0:02:12
Average standard deviation of split frequencies: 0.020541
305500 -- (-1715.730) (-1713.484) [-1717.004] (-1706.699) * (-1710.920) [-1711.318] (-1711.317) (-1707.733) -- 0:02:11
306000 -- (-1710.489) (-1711.474) [-1710.236] (-1712.635) * (-1711.516) [-1712.147] (-1709.269) (-1716.658) -- 0:02:11
306500 -- (-1708.743) [-1706.635] (-1707.324) (-1708.095) * [-1714.703] (-1711.091) (-1707.366) (-1712.360) -- 0:02:11
307000 -- (-1710.793) (-1714.251) (-1715.522) [-1711.214] * (-1712.381) [-1708.445] (-1718.205) (-1712.705) -- 0:02:13
307500 -- (-1716.510) [-1715.198] (-1708.208) (-1710.377) * (-1709.269) (-1710.570) [-1711.587] (-1709.101) -- 0:02:12
308000 -- [-1718.364] (-1711.385) (-1706.953) (-1714.925) * (-1714.591) (-1708.737) (-1707.454) [-1706.408] -- 0:02:12
308500 -- (-1716.328) (-1718.676) (-1714.011) [-1712.451] * [-1712.227] (-1709.368) (-1711.922) (-1715.983) -- 0:02:12
309000 -- (-1721.275) (-1709.172) [-1714.344] (-1710.401) * (-1709.765) (-1715.034) [-1718.482] (-1708.772) -- 0:02:11
309500 -- (-1717.074) (-1712.206) [-1713.289] (-1705.203) * (-1710.819) [-1710.921] (-1719.600) (-1711.549) -- 0:02:11
310000 -- [-1712.141] (-1713.939) (-1709.978) (-1709.455) * (-1720.205) (-1710.390) [-1714.802] (-1713.053) -- 0:02:11
Average standard deviation of split frequencies: 0.023267
310500 -- (-1709.010) (-1719.576) (-1719.239) [-1706.344] * (-1719.267) (-1714.445) [-1708.286] (-1711.725) -- 0:02:11
311000 -- (-1710.383) (-1710.455) (-1714.644) [-1712.428] * (-1720.997) [-1707.547] (-1714.795) (-1719.741) -- 0:02:10
311500 -- (-1709.345) [-1721.390] (-1713.750) (-1708.011) * (-1711.101) (-1709.171) [-1706.642] (-1712.896) -- 0:02:10
312000 -- (-1714.329) (-1714.269) (-1722.067) [-1705.528] * (-1714.189) [-1711.708] (-1709.013) (-1707.666) -- 0:02:12
312500 -- (-1715.590) (-1717.236) (-1719.811) [-1705.218] * (-1712.362) (-1712.640) (-1716.967) [-1710.469] -- 0:02:12
313000 -- (-1722.868) (-1710.239) [-1711.406] (-1708.577) * (-1711.068) (-1707.984) (-1709.785) [-1715.726] -- 0:02:11
313500 -- (-1718.484) [-1710.628] (-1713.410) (-1712.919) * [-1709.778] (-1710.027) (-1719.689) (-1714.427) -- 0:02:11
314000 -- (-1708.113) [-1712.105] (-1710.314) (-1710.051) * (-1710.495) (-1714.555) (-1723.041) [-1714.449] -- 0:02:11
314500 -- [-1713.949] (-1712.377) (-1712.676) (-1715.198) * [-1712.685] (-1713.121) (-1719.032) (-1709.282) -- 0:02:10
315000 -- (-1716.876) (-1725.148) (-1717.101) [-1713.774] * (-1711.793) [-1713.630] (-1708.941) (-1715.217) -- 0:02:10
Average standard deviation of split frequencies: 0.023869
315500 -- (-1716.154) [-1707.335] (-1718.432) (-1709.964) * (-1715.986) [-1708.887] (-1716.456) (-1716.151) -- 0:02:10
316000 -- (-1720.359) (-1709.831) (-1714.066) [-1710.775] * (-1712.268) (-1709.688) [-1711.550] (-1708.957) -- 0:02:09
316500 -- (-1705.672) [-1708.770] (-1711.941) (-1710.967) * (-1711.300) [-1705.256] (-1710.484) (-1708.593) -- 0:02:09
317000 -- (-1704.153) (-1712.100) (-1709.924) [-1706.369] * (-1710.453) [-1712.363] (-1714.282) (-1713.120) -- 0:02:09
317500 -- [-1707.426] (-1712.060) (-1708.267) (-1711.407) * [-1707.388] (-1712.899) (-1714.524) (-1708.825) -- 0:02:11
318000 -- (-1711.106) (-1711.508) (-1712.553) [-1708.339] * (-1706.525) [-1713.233] (-1714.462) (-1709.757) -- 0:02:10
318500 -- (-1716.748) (-1720.630) [-1712.505] (-1714.084) * [-1707.663] (-1705.165) (-1709.525) (-1718.392) -- 0:02:10
319000 -- (-1711.767) (-1712.994) [-1713.672] (-1712.901) * (-1707.108) [-1712.402] (-1709.850) (-1718.347) -- 0:02:10
319500 -- (-1711.499) [-1709.781] (-1714.239) (-1711.091) * (-1712.490) (-1708.714) [-1709.890] (-1707.931) -- 0:02:09
320000 -- (-1714.138) (-1713.504) [-1710.108] (-1714.381) * [-1708.848] (-1708.747) (-1708.201) (-1711.746) -- 0:02:09
Average standard deviation of split frequencies: 0.026461
320500 -- (-1711.855) [-1706.744] (-1715.823) (-1716.475) * (-1712.008) (-1706.075) [-1711.325] (-1714.495) -- 0:02:09
321000 -- [-1708.554] (-1711.849) (-1715.032) (-1714.496) * (-1712.296) [-1713.103] (-1711.079) (-1709.928) -- 0:02:09
321500 -- (-1710.606) (-1717.131) (-1712.640) [-1710.818] * (-1718.051) [-1710.277] (-1710.739) (-1711.568) -- 0:02:08
322000 -- [-1709.801] (-1711.591) (-1711.011) (-1708.040) * (-1715.804) [-1707.094] (-1717.242) (-1715.755) -- 0:02:08
322500 -- (-1711.430) (-1712.437) (-1703.033) [-1709.930] * [-1710.626] (-1713.249) (-1718.474) (-1710.242) -- 0:02:10
323000 -- [-1708.242] (-1716.556) (-1705.683) (-1710.423) * (-1710.084) [-1708.079] (-1720.067) (-1709.020) -- 0:02:09
323500 -- (-1711.705) (-1714.941) [-1710.100] (-1710.301) * (-1720.289) (-1712.888) (-1713.759) [-1709.252] -- 0:02:09
324000 -- [-1710.663] (-1708.869) (-1704.991) (-1712.001) * (-1710.481) [-1714.054] (-1706.329) (-1716.489) -- 0:02:09
324500 -- (-1716.800) (-1707.843) (-1706.587) [-1711.643] * (-1715.507) [-1714.826] (-1711.578) (-1709.989) -- 0:02:09
325000 -- (-1707.117) [-1709.770] (-1710.416) (-1709.989) * (-1716.940) (-1711.669) (-1707.676) [-1710.897] -- 0:02:08
Average standard deviation of split frequencies: 0.023618
325500 -- (-1708.444) (-1706.517) [-1709.034] (-1713.776) * (-1711.147) (-1710.694) (-1714.638) [-1709.992] -- 0:02:08
326000 -- (-1711.778) (-1713.427) [-1705.886] (-1711.486) * (-1715.772) [-1709.908] (-1717.919) (-1710.710) -- 0:02:08
326500 -- (-1713.735) (-1711.740) (-1707.942) [-1711.306] * [-1710.722] (-1710.615) (-1713.849) (-1711.122) -- 0:02:07
327000 -- [-1713.044] (-1715.306) (-1708.873) (-1708.224) * (-1709.451) [-1716.206] (-1711.741) (-1710.105) -- 0:02:07
327500 -- (-1709.941) (-1715.109) (-1710.206) [-1708.935] * [-1709.060] (-1706.156) (-1712.128) (-1710.383) -- 0:02:07
328000 -- [-1714.263] (-1712.551) (-1705.147) (-1712.141) * [-1707.606] (-1706.643) (-1717.608) (-1713.262) -- 0:02:09
328500 -- (-1711.292) (-1710.796) [-1706.240] (-1709.120) * [-1714.060] (-1713.687) (-1717.322) (-1718.296) -- 0:02:08
329000 -- (-1708.290) [-1715.011] (-1713.749) (-1710.489) * (-1710.443) [-1713.011] (-1713.820) (-1719.722) -- 0:02:08
329500 -- (-1706.651) [-1704.029] (-1713.409) (-1714.909) * (-1712.486) [-1712.072] (-1712.664) (-1707.503) -- 0:02:08
330000 -- (-1708.634) [-1707.356] (-1709.285) (-1726.407) * (-1709.871) [-1710.043] (-1714.271) (-1707.296) -- 0:02:07
Average standard deviation of split frequencies: 0.023760
330500 -- (-1711.624) [-1710.686] (-1709.738) (-1717.810) * (-1712.658) (-1709.904) (-1712.006) [-1708.059] -- 0:02:07
331000 -- (-1721.517) [-1710.014] (-1711.729) (-1714.904) * (-1715.846) [-1707.822] (-1714.205) (-1710.891) -- 0:02:07
331500 -- (-1708.892) [-1707.126] (-1710.375) (-1709.454) * (-1710.484) [-1706.651] (-1705.517) (-1717.622) -- 0:02:07
332000 -- (-1713.905) [-1711.625] (-1711.266) (-1717.424) * (-1710.278) (-1712.208) [-1710.379] (-1706.831) -- 0:02:06
332500 -- (-1711.083) (-1709.075) (-1709.178) [-1711.399] * (-1714.544) (-1714.480) (-1712.927) [-1715.577] -- 0:02:06
333000 -- [-1712.091] (-1713.892) (-1712.654) (-1708.838) * [-1709.816] (-1706.924) (-1712.352) (-1712.167) -- 0:02:06
333500 -- (-1713.251) [-1713.902] (-1713.590) (-1717.669) * (-1709.771) [-1712.132] (-1713.485) (-1705.896) -- 0:02:07
334000 -- (-1708.317) [-1712.222] (-1711.107) (-1709.219) * [-1707.579] (-1711.192) (-1712.579) (-1709.102) -- 0:02:07
334500 -- (-1709.567) [-1705.541] (-1710.860) (-1706.862) * [-1706.517] (-1705.248) (-1711.286) (-1713.678) -- 0:02:07
335000 -- [-1706.134] (-1713.488) (-1713.780) (-1713.597) * (-1718.585) (-1706.889) (-1709.839) [-1710.575] -- 0:02:07
Average standard deviation of split frequencies: 0.021045
335500 -- [-1707.048] (-1707.623) (-1715.304) (-1705.755) * (-1713.577) (-1712.925) [-1708.420] (-1715.521) -- 0:02:06
336000 -- (-1713.234) (-1718.947) [-1712.825] (-1707.490) * (-1712.381) (-1707.411) [-1710.480] (-1713.310) -- 0:02:06
336500 -- (-1709.646) (-1715.706) (-1715.361) [-1706.421] * (-1722.588) (-1710.985) [-1713.070] (-1709.399) -- 0:02:06
337000 -- [-1714.041] (-1718.115) (-1720.807) (-1713.560) * [-1709.260] (-1711.203) (-1708.844) (-1709.479) -- 0:02:05
337500 -- [-1708.590] (-1711.435) (-1718.756) (-1713.627) * [-1708.357] (-1715.231) (-1707.797) (-1708.553) -- 0:02:05
338000 -- (-1708.660) [-1711.970] (-1715.251) (-1711.731) * (-1707.551) [-1711.349] (-1709.224) (-1708.841) -- 0:02:05
338500 -- (-1705.252) (-1711.203) (-1713.420) [-1707.331] * [-1713.833] (-1711.597) (-1712.541) (-1707.867) -- 0:02:07
339000 -- [-1705.204] (-1714.757) (-1717.192) (-1711.496) * (-1718.483) (-1706.453) [-1709.257] (-1714.220) -- 0:02:06
339500 -- (-1712.258) (-1710.676) (-1717.076) [-1708.679] * (-1712.345) (-1710.973) (-1715.502) [-1705.347] -- 0:02:06
340000 -- [-1711.419] (-1710.247) (-1715.923) (-1708.234) * (-1718.601) (-1709.233) [-1708.671] (-1709.663) -- 0:02:06
Average standard deviation of split frequencies: 0.020757
340500 -- (-1708.095) (-1715.933) [-1716.285] (-1711.081) * (-1710.228) (-1708.453) [-1712.114] (-1714.954) -- 0:02:05
341000 -- (-1705.378) (-1712.998) [-1711.245] (-1714.824) * [-1713.345] (-1710.195) (-1705.877) (-1714.849) -- 0:02:05
341500 -- (-1709.140) [-1709.157] (-1714.282) (-1710.201) * (-1725.247) (-1708.448) [-1706.783] (-1711.211) -- 0:02:05
342000 -- (-1709.643) (-1717.295) [-1706.948] (-1713.470) * [-1707.455] (-1709.058) (-1705.922) (-1710.464) -- 0:02:05
342500 -- (-1716.028) [-1713.955] (-1711.948) (-1708.739) * [-1710.128] (-1715.738) (-1708.353) (-1708.404) -- 0:02:04
343000 -- (-1715.507) [-1712.577] (-1708.238) (-1709.083) * [-1710.269] (-1713.821) (-1712.929) (-1707.242) -- 0:02:04
343500 -- (-1711.924) (-1716.835) [-1710.530] (-1715.020) * (-1711.220) (-1713.400) [-1706.787] (-1715.225) -- 0:02:04
344000 -- (-1721.549) (-1710.736) [-1713.958] (-1715.901) * (-1713.968) (-1706.442) [-1706.993] (-1719.741) -- 0:02:05
344500 -- (-1711.894) [-1706.594] (-1708.582) (-1709.999) * (-1713.329) (-1717.003) (-1717.686) [-1714.162] -- 0:02:05
345000 -- (-1715.191) (-1710.004) [-1708.551] (-1706.071) * (-1704.871) [-1707.377] (-1707.647) (-1708.022) -- 0:02:05
Average standard deviation of split frequencies: 0.017258
345500 -- (-1712.851) [-1708.568] (-1715.030) (-1709.030) * (-1708.103) [-1710.944] (-1717.136) (-1710.437) -- 0:02:05
346000 -- (-1716.862) [-1710.431] (-1712.915) (-1709.813) * (-1712.282) (-1705.698) (-1707.539) [-1711.841] -- 0:02:04
346500 -- [-1711.104] (-1707.278) (-1704.549) (-1708.855) * (-1707.351) [-1708.547] (-1716.013) (-1706.672) -- 0:02:04
347000 -- (-1713.702) (-1707.015) (-1712.186) [-1710.753] * (-1713.573) (-1707.073) [-1709.187] (-1710.846) -- 0:02:04
347500 -- (-1711.546) [-1708.267] (-1710.422) (-1712.658) * (-1711.181) (-1719.997) (-1708.997) [-1708.119] -- 0:02:03
348000 -- (-1714.968) [-1710.718] (-1719.459) (-1712.230) * (-1715.013) [-1708.701] (-1714.928) (-1713.067) -- 0:02:03
348500 -- (-1713.683) (-1715.944) [-1709.399] (-1714.838) * (-1711.316) (-1715.804) [-1710.039] (-1708.169) -- 0:02:03
349000 -- (-1707.798) (-1718.853) (-1711.074) [-1711.758] * [-1714.092] (-1720.508) (-1706.915) (-1712.544) -- 0:02:04
349500 -- [-1711.716] (-1721.335) (-1714.514) (-1713.316) * (-1714.988) [-1709.926] (-1715.123) (-1711.021) -- 0:02:04
350000 -- (-1711.340) (-1716.262) (-1706.724) [-1711.517] * (-1713.659) [-1711.633] (-1707.787) (-1716.014) -- 0:02:04
Average standard deviation of split frequencies: 0.012547
350500 -- (-1709.911) (-1713.412) (-1710.227) [-1713.281] * (-1708.578) [-1711.744] (-1709.577) (-1721.543) -- 0:02:04
351000 -- (-1705.697) (-1717.003) (-1715.470) [-1709.900] * (-1712.128) (-1713.501) [-1709.572] (-1720.127) -- 0:02:03
351500 -- [-1705.669] (-1712.964) (-1711.758) (-1718.234) * [-1717.250] (-1709.578) (-1713.432) (-1720.484) -- 0:02:03
352000 -- [-1708.389] (-1711.167) (-1709.973) (-1713.888) * (-1710.929) (-1708.810) (-1707.739) [-1710.576] -- 0:02:03
352500 -- [-1711.544] (-1712.020) (-1708.175) (-1708.489) * [-1712.317] (-1713.817) (-1710.133) (-1711.489) -- 0:02:03
353000 -- (-1708.383) [-1710.187] (-1711.597) (-1710.051) * (-1713.171) [-1708.788] (-1711.063) (-1712.856) -- 0:02:02
353500 -- [-1709.818] (-1707.624) (-1712.401) (-1718.235) * [-1707.275] (-1711.846) (-1712.426) (-1717.067) -- 0:02:02
354000 -- (-1707.496) (-1718.771) (-1711.840) [-1706.040] * (-1708.014) [-1709.897] (-1707.877) (-1712.303) -- 0:02:02
354500 -- (-1708.513) (-1712.825) [-1707.068] (-1710.033) * [-1708.056] (-1715.873) (-1711.947) (-1711.559) -- 0:02:03
355000 -- (-1705.233) [-1708.382] (-1712.963) (-1709.957) * [-1713.189] (-1717.594) (-1711.379) (-1712.337) -- 0:02:03
Average standard deviation of split frequencies: 0.012800
355500 -- [-1708.474] (-1711.007) (-1715.300) (-1709.889) * (-1718.254) [-1708.814] (-1710.857) (-1711.307) -- 0:02:03
356000 -- (-1715.908) (-1713.610) (-1714.269) [-1715.865] * [-1709.192] (-1708.941) (-1708.767) (-1711.825) -- 0:02:03
356500 -- (-1706.984) [-1706.639] (-1714.651) (-1711.784) * [-1717.151] (-1706.699) (-1718.777) (-1711.684) -- 0:02:02
357000 -- (-1713.445) (-1709.423) [-1708.248] (-1714.221) * (-1714.784) [-1709.639] (-1709.542) (-1718.031) -- 0:02:02
357500 -- (-1710.045) [-1710.577] (-1709.731) (-1708.211) * (-1710.102) [-1712.647] (-1710.675) (-1712.594) -- 0:02:02
358000 -- (-1719.951) [-1709.965] (-1709.268) (-1710.176) * (-1713.891) [-1706.918] (-1714.746) (-1709.000) -- 0:02:01
358500 -- (-1712.343) [-1709.856] (-1708.615) (-1709.837) * (-1712.155) [-1707.665] (-1718.951) (-1711.439) -- 0:02:01
359000 -- (-1712.847) (-1711.460) [-1711.506] (-1710.330) * [-1715.260] (-1707.166) (-1713.926) (-1707.439) -- 0:02:01
359500 -- (-1714.839) (-1708.206) (-1710.933) [-1711.938] * (-1709.405) [-1707.089] (-1708.942) (-1711.301) -- 0:02:01
360000 -- (-1708.547) (-1708.328) (-1715.347) [-1710.159] * (-1714.831) [-1710.413] (-1716.686) (-1708.488) -- 0:02:02
Average standard deviation of split frequencies: 0.013070
360500 -- (-1713.358) (-1710.639) [-1708.921] (-1709.831) * (-1717.182) (-1716.032) (-1705.345) [-1712.431] -- 0:02:02
361000 -- (-1712.578) (-1708.312) [-1714.710] (-1711.458) * [-1712.858] (-1716.789) (-1712.946) (-1707.981) -- 0:02:02
361500 -- (-1711.876) [-1708.888] (-1711.591) (-1709.074) * (-1711.897) (-1713.793) [-1714.578] (-1707.655) -- 0:02:01
362000 -- (-1714.282) [-1708.863] (-1715.026) (-1706.972) * (-1715.846) (-1712.630) [-1709.076] (-1713.207) -- 0:02:01
362500 -- (-1712.368) (-1711.799) (-1722.301) [-1713.776] * [-1711.732] (-1713.247) (-1709.242) (-1714.077) -- 0:02:01
363000 -- [-1706.356] (-1714.742) (-1712.787) (-1709.567) * (-1713.290) [-1711.796] (-1714.889) (-1716.162) -- 0:02:01
363500 -- [-1713.288] (-1711.528) (-1711.401) (-1705.770) * [-1709.787] (-1717.975) (-1710.620) (-1708.832) -- 0:02:00
364000 -- [-1708.634] (-1707.915) (-1714.073) (-1715.461) * (-1711.283) (-1709.322) [-1706.304] (-1712.177) -- 0:02:00
364500 -- [-1711.348] (-1712.255) (-1714.403) (-1709.684) * (-1716.648) [-1707.171] (-1706.643) (-1707.142) -- 0:02:00
365000 -- (-1711.985) [-1707.882] (-1715.929) (-1711.626) * (-1714.871) (-1710.514) (-1709.739) [-1713.795] -- 0:02:01
Average standard deviation of split frequencies: 0.012451
365500 -- [-1712.968] (-1712.552) (-1712.597) (-1711.936) * (-1713.895) (-1707.229) [-1706.558] (-1724.967) -- 0:02:01
366000 -- (-1716.364) [-1709.003] (-1716.699) (-1707.452) * (-1711.427) (-1718.487) [-1710.488] (-1708.864) -- 0:02:01
366500 -- [-1707.403] (-1714.898) (-1710.832) (-1707.003) * (-1709.444) (-1717.358) [-1711.797] (-1709.634) -- 0:02:00
367000 -- (-1711.264) (-1709.534) [-1708.144] (-1712.762) * (-1709.292) (-1714.248) [-1713.434] (-1709.488) -- 0:02:00
367500 -- (-1711.208) [-1709.046] (-1707.621) (-1716.726) * (-1721.977) [-1704.278] (-1718.944) (-1712.123) -- 0:02:00
368000 -- (-1714.160) (-1707.296) [-1713.499] (-1717.891) * (-1724.102) (-1712.731) (-1713.597) [-1706.984] -- 0:02:00
368500 -- [-1714.649] (-1709.329) (-1717.718) (-1708.781) * [-1711.467] (-1710.483) (-1714.871) (-1706.660) -- 0:01:59
369000 -- [-1713.757] (-1711.257) (-1708.971) (-1714.021) * (-1705.371) (-1711.486) (-1708.637) [-1702.170] -- 0:01:59
369500 -- [-1715.753] (-1709.955) (-1708.407) (-1713.772) * (-1714.418) (-1709.651) (-1708.805) [-1708.800] -- 0:01:59
370000 -- (-1712.661) [-1711.649] (-1711.994) (-1716.029) * [-1706.171] (-1717.925) (-1712.823) (-1707.217) -- 0:01:59
Average standard deviation of split frequencies: 0.011870
370500 -- [-1708.874] (-1716.808) (-1709.221) (-1714.859) * (-1707.967) (-1723.078) [-1712.069] (-1707.597) -- 0:02:00
371000 -- (-1713.570) (-1708.532) (-1716.588) [-1715.218] * [-1713.234] (-1706.420) (-1709.929) (-1712.008) -- 0:02:00
371500 -- (-1709.255) (-1707.758) [-1713.660] (-1709.469) * (-1713.154) [-1717.293] (-1713.826) (-1717.850) -- 0:02:00
372000 -- [-1707.146] (-1711.765) (-1714.276) (-1714.115) * [-1709.304] (-1714.967) (-1710.068) (-1707.922) -- 0:01:59
372500 -- (-1707.532) (-1706.997) (-1709.813) [-1711.224] * (-1721.750) (-1708.763) [-1714.400] (-1705.903) -- 0:01:59
373000 -- (-1708.081) [-1707.560] (-1712.583) (-1717.749) * [-1709.966] (-1716.979) (-1714.318) (-1704.795) -- 0:01:59
373500 -- (-1715.122) [-1708.782] (-1718.323) (-1707.450) * (-1707.542) [-1713.961] (-1707.589) (-1713.173) -- 0:01:59
374000 -- (-1710.623) (-1713.764) [-1708.504] (-1711.680) * [-1713.679] (-1709.993) (-1710.607) (-1711.753) -- 0:01:58
374500 -- (-1714.523) (-1711.882) (-1714.128) [-1706.841] * [-1708.440] (-1708.639) (-1707.954) (-1712.543) -- 0:01:58
375000 -- [-1706.990] (-1706.499) (-1715.670) (-1715.531) * (-1707.111) (-1715.466) [-1708.478] (-1715.839) -- 0:01:58
Average standard deviation of split frequencies: 0.011702
375500 -- (-1708.392) (-1711.902) [-1711.982] (-1710.874) * (-1709.032) [-1709.431] (-1710.367) (-1713.554) -- 0:01:58
376000 -- (-1713.191) (-1709.714) [-1711.161] (-1717.279) * (-1717.707) (-1710.304) (-1710.564) [-1710.810] -- 0:01:59
376500 -- (-1711.974) [-1708.774] (-1712.304) (-1709.442) * (-1710.462) (-1710.686) (-1711.812) [-1707.227] -- 0:01:59
377000 -- [-1712.704] (-1712.315) (-1713.875) (-1717.924) * [-1709.425] (-1713.283) (-1710.015) (-1711.125) -- 0:01:58
377500 -- (-1714.810) [-1710.156] (-1715.387) (-1713.057) * (-1713.217) (-1710.684) [-1713.356] (-1710.465) -- 0:01:58
378000 -- (-1714.074) [-1711.473] (-1707.912) (-1711.464) * (-1712.309) (-1710.917) (-1716.980) [-1707.226] -- 0:01:58
378500 -- (-1711.675) (-1709.701) (-1711.902) [-1712.788] * (-1713.031) (-1707.415) (-1712.613) [-1705.382] -- 0:01:58
379000 -- (-1713.564) (-1706.452) (-1713.272) [-1706.973] * (-1718.137) (-1708.791) [-1712.024] (-1713.313) -- 0:01:57
379500 -- [-1710.113] (-1707.765) (-1711.119) (-1719.603) * (-1715.659) (-1711.713) [-1711.394] (-1712.375) -- 0:01:57
380000 -- (-1707.804) (-1708.873) [-1709.436] (-1720.737) * [-1711.826] (-1720.391) (-1705.290) (-1710.381) -- 0:01:57
Average standard deviation of split frequencies: 0.011558
380500 -- (-1707.081) (-1710.893) (-1708.807) [-1717.086] * [-1712.780] (-1713.707) (-1710.345) (-1709.986) -- 0:01:57
381000 -- (-1709.304) (-1712.544) [-1711.428] (-1709.046) * (-1726.319) [-1713.206] (-1706.156) (-1717.144) -- 0:01:58
381500 -- [-1708.777] (-1713.499) (-1714.461) (-1710.171) * [-1713.479] (-1716.373) (-1708.853) (-1715.420) -- 0:01:58
382000 -- (-1707.335) (-1718.608) [-1714.757] (-1713.662) * [-1712.676] (-1711.248) (-1704.289) (-1716.211) -- 0:01:58
382500 -- (-1706.280) [-1709.234] (-1718.337) (-1715.265) * (-1706.415) (-1717.016) (-1716.705) [-1712.682] -- 0:01:57
383000 -- (-1707.417) (-1712.705) [-1709.389] (-1707.830) * [-1709.198] (-1721.250) (-1711.863) (-1714.078) -- 0:01:57
383500 -- [-1709.439] (-1713.435) (-1707.719) (-1713.235) * (-1708.663) [-1713.226] (-1731.767) (-1708.981) -- 0:01:57
384000 -- (-1713.157) (-1711.662) [-1708.764] (-1711.212) * [-1704.646] (-1711.517) (-1710.358) (-1709.196) -- 0:01:57
384500 -- (-1709.805) (-1704.258) (-1710.132) [-1713.276] * (-1707.994) (-1713.201) (-1711.042) [-1712.207] -- 0:01:56
385000 -- (-1710.884) [-1708.565] (-1708.313) (-1710.895) * (-1711.097) (-1711.890) (-1708.758) [-1714.104] -- 0:01:56
Average standard deviation of split frequencies: 0.014655
385500 -- (-1711.350) (-1706.076) [-1710.886] (-1708.858) * [-1709.562] (-1720.508) (-1708.229) (-1709.461) -- 0:01:56
386000 -- [-1706.665] (-1713.002) (-1709.963) (-1708.466) * (-1704.134) (-1709.973) [-1706.684] (-1705.591) -- 0:01:56
386500 -- [-1706.439] (-1712.590) (-1713.622) (-1713.049) * [-1709.880] (-1712.289) (-1710.076) (-1711.714) -- 0:01:57
387000 -- [-1709.113] (-1714.438) (-1715.107) (-1707.812) * [-1707.506] (-1712.314) (-1713.562) (-1710.043) -- 0:01:57
387500 -- (-1709.828) (-1712.787) [-1711.054] (-1709.417) * (-1710.867) (-1721.150) (-1711.934) [-1709.754] -- 0:01:56
388000 -- [-1710.688] (-1714.161) (-1708.318) (-1710.563) * (-1712.438) (-1719.038) [-1712.727] (-1705.274) -- 0:01:56
388500 -- (-1713.553) (-1713.320) (-1717.424) [-1709.164] * (-1725.816) [-1707.442] (-1706.774) (-1713.780) -- 0:01:56
389000 -- [-1714.045] (-1709.027) (-1707.346) (-1712.509) * (-1711.719) (-1712.246) [-1707.971] (-1711.188) -- 0:01:56
389500 -- (-1712.200) (-1710.435) [-1709.276] (-1707.528) * (-1713.020) [-1711.188] (-1711.016) (-1712.279) -- 0:01:55
390000 -- (-1714.450) (-1709.389) [-1710.959] (-1712.149) * (-1712.476) (-1712.473) [-1711.016] (-1709.742) -- 0:01:55
Average standard deviation of split frequencies: 0.016491
390500 -- (-1707.481) [-1713.228] (-1718.815) (-1715.447) * [-1711.719] (-1711.606) (-1707.540) (-1710.338) -- 0:01:55
391000 -- (-1711.798) (-1712.830) [-1711.050] (-1721.185) * (-1709.928) (-1718.614) (-1708.288) [-1713.120] -- 0:01:55
391500 -- [-1710.321] (-1714.192) (-1711.446) (-1719.820) * (-1713.495) (-1712.320) [-1709.616] (-1705.568) -- 0:01:56
392000 -- (-1707.992) (-1717.564) [-1714.464] (-1719.616) * [-1708.131] (-1712.483) (-1712.534) (-1708.170) -- 0:01:56
392500 -- [-1708.111] (-1712.489) (-1714.837) (-1721.447) * (-1713.234) [-1715.063] (-1710.629) (-1709.005) -- 0:01:56
393000 -- (-1708.274) [-1716.158] (-1717.803) (-1717.411) * (-1716.476) (-1711.520) [-1708.589] (-1713.499) -- 0:01:55
393500 -- (-1708.734) [-1713.843] (-1711.848) (-1709.963) * (-1706.227) (-1716.293) (-1711.654) [-1713.416] -- 0:01:55
394000 -- (-1712.280) (-1708.743) [-1709.970] (-1714.226) * [-1711.758] (-1714.700) (-1711.783) (-1712.104) -- 0:01:55
394500 -- (-1714.500) (-1710.073) (-1715.374) [-1709.128] * (-1709.238) (-1707.893) (-1707.029) [-1715.535] -- 0:01:55
395000 -- (-1713.885) (-1708.544) (-1713.501) [-1713.625] * [-1708.477] (-1713.849) (-1718.182) (-1710.234) -- 0:01:54
Average standard deviation of split frequencies: 0.016269
395500 -- (-1708.375) (-1711.046) [-1714.715] (-1708.601) * (-1710.308) (-1711.390) [-1711.039] (-1720.322) -- 0:01:54
396000 -- (-1710.009) (-1709.217) (-1714.761) [-1710.069] * (-1708.684) (-1715.028) (-1711.946) [-1718.443] -- 0:01:54
396500 -- [-1709.257] (-1711.044) (-1709.454) (-1720.521) * [-1713.835] (-1716.011) (-1711.664) (-1711.364) -- 0:01:54
397000 -- [-1707.118] (-1714.779) (-1710.752) (-1714.576) * (-1713.861) (-1708.087) (-1711.622) [-1714.996] -- 0:01:55
397500 -- (-1711.872) [-1710.739] (-1717.882) (-1709.481) * [-1707.001] (-1712.266) (-1711.672) (-1709.060) -- 0:01:55
398000 -- (-1707.236) [-1707.786] (-1710.988) (-1712.271) * (-1712.173) (-1707.776) [-1715.282] (-1710.049) -- 0:01:54
398500 -- [-1705.240] (-1705.979) (-1714.533) (-1709.155) * (-1710.046) (-1710.733) (-1716.464) [-1709.043] -- 0:01:54
399000 -- [-1708.650] (-1713.399) (-1711.632) (-1704.717) * (-1711.050) (-1710.729) [-1708.104] (-1707.688) -- 0:01:54
399500 -- (-1712.159) [-1705.352] (-1714.439) (-1709.474) * (-1708.436) (-1707.390) [-1711.019] (-1709.883) -- 0:01:54
400000 -- (-1713.197) [-1710.244] (-1711.587) (-1707.976) * (-1716.316) [-1715.511] (-1716.065) (-1708.534) -- 0:01:54
Average standard deviation of split frequencies: 0.017648
400500 -- (-1716.600) [-1708.260] (-1715.188) (-1709.269) * (-1712.147) (-1710.606) [-1711.542] (-1709.006) -- 0:01:53
401000 -- (-1715.985) (-1710.162) (-1715.572) [-1706.143] * (-1715.115) [-1711.580] (-1713.200) (-1709.836) -- 0:01:53
401500 -- (-1713.820) [-1709.144] (-1713.941) (-1711.086) * (-1710.072) (-1709.215) (-1718.232) [-1711.241] -- 0:01:53
402000 -- (-1712.569) (-1713.752) (-1712.144) [-1708.385] * (-1717.887) (-1706.731) (-1707.884) [-1708.076] -- 0:01:54
402500 -- (-1711.167) (-1709.936) [-1715.748] (-1714.754) * (-1713.805) (-1707.983) (-1705.832) [-1705.056] -- 0:01:54
403000 -- (-1705.423) [-1715.584] (-1709.153) (-1715.083) * [-1706.939] (-1716.330) (-1714.563) (-1712.997) -- 0:01:54
403500 -- (-1709.810) [-1710.208] (-1719.774) (-1713.178) * (-1712.148) (-1713.034) (-1710.141) [-1710.245] -- 0:01:53
404000 -- [-1709.905] (-1710.163) (-1713.287) (-1716.534) * (-1711.422) (-1711.710) (-1709.284) [-1710.292] -- 0:01:53
404500 -- [-1711.134] (-1711.107) (-1712.244) (-1716.633) * (-1710.044) (-1707.654) [-1707.614] (-1716.016) -- 0:01:53
405000 -- (-1712.107) [-1707.360] (-1709.735) (-1718.479) * (-1711.758) (-1707.635) [-1710.123] (-1709.811) -- 0:01:53
Average standard deviation of split frequencies: 0.017803
405500 -- (-1714.072) [-1711.153] (-1713.915) (-1711.694) * (-1708.849) [-1704.011] (-1710.681) (-1712.932) -- 0:01:52
406000 -- [-1708.449] (-1714.480) (-1712.640) (-1709.527) * (-1712.629) (-1712.167) (-1707.283) [-1706.781] -- 0:01:52
406500 -- (-1710.598) (-1713.065) (-1709.121) [-1712.629] * (-1709.064) (-1705.835) (-1716.834) [-1711.183] -- 0:01:52
407000 -- (-1707.969) [-1713.474] (-1707.413) (-1714.773) * (-1719.803) [-1706.800] (-1710.922) (-1711.136) -- 0:01:52
407500 -- (-1715.580) (-1712.954) [-1709.924] (-1722.618) * (-1712.323) [-1706.387] (-1708.040) (-1713.178) -- 0:01:53
408000 -- (-1712.939) (-1715.599) (-1709.956) [-1711.056] * (-1717.119) (-1711.421) (-1708.689) [-1712.407] -- 0:01:53
408500 -- (-1715.459) (-1706.462) (-1712.036) [-1710.856] * (-1716.964) [-1709.957] (-1709.457) (-1718.447) -- 0:01:52
409000 -- (-1712.620) (-1713.358) [-1707.512] (-1714.346) * (-1714.987) (-1707.033) (-1709.955) [-1711.945] -- 0:01:52
409500 -- [-1716.687] (-1714.182) (-1709.648) (-1710.830) * (-1710.595) (-1713.390) (-1712.404) [-1713.395] -- 0:01:52
410000 -- (-1714.044) (-1711.660) (-1714.463) [-1714.135] * (-1706.545) [-1709.958] (-1716.425) (-1717.537) -- 0:01:52
Average standard deviation of split frequencies: 0.017984
410500 -- [-1709.769] (-1710.906) (-1707.236) (-1712.254) * (-1712.044) (-1710.526) [-1713.400] (-1710.175) -- 0:01:52
411000 -- [-1709.468] (-1705.395) (-1714.631) (-1708.949) * [-1711.114] (-1712.476) (-1717.263) (-1710.639) -- 0:01:51
411500 -- (-1708.889) (-1711.947) [-1707.408] (-1712.551) * [-1713.225] (-1712.786) (-1713.853) (-1718.118) -- 0:01:51
412000 -- (-1712.695) (-1707.875) (-1711.076) [-1707.366] * (-1713.995) (-1717.161) (-1716.719) [-1715.153] -- 0:01:51
412500 -- (-1711.267) [-1714.282] (-1717.804) (-1707.072) * (-1712.683) (-1719.598) (-1717.413) [-1715.218] -- 0:01:51
413000 -- [-1713.419] (-1707.291) (-1710.990) (-1709.707) * (-1709.314) (-1716.222) (-1713.742) [-1710.932] -- 0:01:52
413500 -- (-1709.564) (-1708.380) [-1707.185] (-1712.061) * [-1708.552] (-1708.799) (-1715.142) (-1714.633) -- 0:01:52
414000 -- (-1716.996) (-1712.548) (-1710.115) [-1710.865] * (-1715.804) (-1706.786) [-1707.571] (-1714.972) -- 0:01:51
414500 -- (-1719.555) (-1709.115) (-1722.705) [-1710.320] * [-1710.015] (-1708.877) (-1710.422) (-1708.281) -- 0:01:51
415000 -- (-1710.528) [-1708.778] (-1710.717) (-1711.517) * (-1710.607) (-1721.360) [-1707.160] (-1713.408) -- 0:01:51
Average standard deviation of split frequencies: 0.016620
415500 -- [-1710.675] (-1711.435) (-1715.213) (-1715.736) * (-1707.833) (-1714.533) [-1711.477] (-1713.963) -- 0:01:51
416000 -- [-1707.160] (-1711.095) (-1709.525) (-1716.494) * (-1712.568) (-1716.439) [-1714.528] (-1716.735) -- 0:01:50
416500 -- [-1713.366] (-1722.696) (-1709.007) (-1715.291) * [-1710.313] (-1710.693) (-1709.936) (-1714.869) -- 0:01:50
417000 -- (-1713.885) [-1710.441] (-1711.290) (-1709.447) * (-1709.121) (-1714.948) (-1713.970) [-1710.871] -- 0:01:50
417500 -- (-1713.379) (-1712.487) (-1708.008) [-1707.821] * (-1708.722) (-1711.877) (-1713.811) [-1710.931] -- 0:01:50
418000 -- [-1710.465] (-1710.785) (-1715.181) (-1707.882) * (-1709.468) (-1715.673) (-1712.264) [-1706.670] -- 0:01:49
418500 -- (-1715.040) [-1713.744] (-1714.585) (-1710.001) * (-1717.830) [-1710.194] (-1710.355) (-1710.339) -- 0:01:51
419000 -- [-1720.285] (-1710.675) (-1709.035) (-1706.350) * (-1715.082) [-1711.293] (-1719.176) (-1709.123) -- 0:01:50
419500 -- (-1714.786) (-1710.362) (-1708.519) [-1706.576] * (-1707.354) (-1715.405) [-1712.432] (-1720.584) -- 0:01:50
420000 -- (-1707.150) (-1711.887) [-1706.184] (-1708.736) * [-1708.336] (-1713.484) (-1710.775) (-1713.818) -- 0:01:50
Average standard deviation of split frequencies: 0.015689
420500 -- (-1707.212) (-1715.065) [-1709.099] (-1714.804) * (-1710.693) (-1712.242) [-1706.640] (-1716.188) -- 0:01:50
421000 -- (-1710.487) (-1713.721) (-1712.109) [-1712.613] * (-1709.845) (-1711.384) [-1709.366] (-1719.671) -- 0:01:50
421500 -- (-1709.492) (-1719.622) (-1709.754) [-1709.474] * (-1710.902) [-1710.632] (-1715.100) (-1711.509) -- 0:01:49
422000 -- (-1712.818) (-1709.670) [-1711.539] (-1710.014) * (-1707.272) (-1713.104) (-1709.172) [-1711.009] -- 0:01:49
422500 -- (-1708.917) (-1706.495) (-1710.689) [-1710.978] * (-1708.320) [-1712.621] (-1713.876) (-1711.449) -- 0:01:49
423000 -- (-1714.213) (-1709.482) (-1710.090) [-1707.908] * (-1709.359) (-1706.222) (-1706.372) [-1714.157] -- 0:01:49
423500 -- (-1716.039) (-1711.703) [-1706.816] (-1711.265) * [-1707.536] (-1719.297) (-1705.180) (-1713.488) -- 0:01:50
424000 -- [-1712.298] (-1714.350) (-1711.645) (-1710.504) * (-1710.675) (-1712.750) [-1705.665] (-1717.855) -- 0:01:50
424500 -- (-1712.735) [-1708.177] (-1706.262) (-1713.873) * [-1710.684] (-1721.441) (-1709.123) (-1716.286) -- 0:01:49
425000 -- [-1710.402] (-1713.024) (-1709.358) (-1711.625) * (-1717.110) (-1713.890) (-1707.066) [-1711.775] -- 0:01:49
Average standard deviation of split frequencies: 0.015861
425500 -- (-1714.824) [-1712.283] (-1709.338) (-1711.296) * (-1705.635) [-1713.984] (-1712.243) (-1708.091) -- 0:01:49
426000 -- (-1714.221) (-1710.863) (-1711.724) [-1713.932] * [-1713.634] (-1710.243) (-1718.681) (-1711.432) -- 0:01:49
426500 -- [-1715.321] (-1709.970) (-1716.061) (-1709.122) * (-1711.408) [-1707.570] (-1710.129) (-1712.741) -- 0:01:48
427000 -- (-1712.064) [-1707.620] (-1707.923) (-1708.954) * (-1706.577) (-1704.623) (-1709.406) [-1712.595] -- 0:01:48
427500 -- (-1720.206) (-1708.807) (-1712.085) [-1708.931] * (-1712.846) (-1705.651) (-1714.204) [-1708.374] -- 0:01:48
428000 -- (-1713.526) (-1708.564) (-1707.398) [-1704.223] * (-1718.434) (-1709.798) (-1706.561) [-1707.565] -- 0:01:48
428500 -- (-1711.142) (-1707.112) [-1705.272] (-1710.822) * [-1712.636] (-1711.079) (-1712.143) (-1713.891) -- 0:01:48
429000 -- (-1714.394) (-1707.982) (-1710.299) [-1709.120] * [-1705.403] (-1711.751) (-1712.515) (-1713.147) -- 0:01:49
429500 -- (-1712.269) (-1711.783) [-1710.248] (-1710.200) * (-1712.673) (-1714.059) (-1715.712) [-1707.239] -- 0:01:48
430000 -- (-1716.942) (-1718.066) [-1718.972] (-1710.627) * [-1710.946] (-1715.093) (-1707.799) (-1713.241) -- 0:01:48
Average standard deviation of split frequencies: 0.014959
430500 -- (-1718.625) (-1716.039) (-1712.996) [-1709.764] * (-1709.846) [-1707.151] (-1711.068) (-1712.196) -- 0:01:48
431000 -- (-1710.620) (-1710.148) (-1710.417) [-1705.297] * (-1708.550) (-1710.321) [-1706.031] (-1714.767) -- 0:01:48
431500 -- (-1710.666) [-1709.220] (-1715.598) (-1711.961) * (-1709.843) (-1708.850) [-1711.616] (-1709.847) -- 0:01:48
432000 -- [-1710.144] (-1712.537) (-1708.959) (-1715.124) * (-1710.916) (-1710.730) [-1713.573] (-1709.577) -- 0:01:47
432500 -- [-1713.984] (-1720.581) (-1710.046) (-1716.354) * (-1708.826) (-1707.269) [-1710.175] (-1717.402) -- 0:01:47
433000 -- (-1713.058) (-1713.450) (-1712.038) [-1708.979] * [-1707.231] (-1707.530) (-1707.441) (-1718.350) -- 0:01:47
433500 -- [-1710.354] (-1716.316) (-1712.101) (-1707.622) * [-1710.767] (-1708.454) (-1708.589) (-1724.631) -- 0:01:47
434000 -- (-1708.512) (-1715.378) [-1711.960] (-1709.125) * [-1708.944] (-1719.937) (-1711.432) (-1712.522) -- 0:01:48
434500 -- (-1717.148) [-1711.646] (-1710.809) (-1710.616) * (-1708.796) (-1708.712) (-1712.089) [-1716.910] -- 0:01:48
435000 -- (-1705.925) [-1713.992] (-1706.322) (-1709.947) * (-1707.214) [-1707.098] (-1714.098) (-1712.172) -- 0:01:47
Average standard deviation of split frequencies: 0.015858
435500 -- (-1708.515) [-1709.800] (-1710.105) (-1709.420) * (-1708.050) [-1707.833] (-1711.074) (-1716.533) -- 0:01:47
436000 -- (-1713.161) (-1705.982) (-1709.618) [-1712.574] * (-1708.090) [-1708.059] (-1707.612) (-1710.694) -- 0:01:47
436500 -- (-1714.916) [-1706.560] (-1714.505) (-1706.080) * (-1708.023) (-1712.141) [-1709.616] (-1708.736) -- 0:01:47
437000 -- [-1711.657] (-1710.191) (-1720.793) (-1707.194) * (-1709.729) (-1714.051) [-1709.970] (-1714.582) -- 0:01:46
437500 -- (-1710.492) (-1709.604) [-1713.654] (-1711.227) * [-1711.253] (-1710.865) (-1716.670) (-1714.429) -- 0:01:46
438000 -- (-1714.126) (-1705.540) (-1712.040) [-1715.874] * [-1707.227] (-1713.267) (-1713.699) (-1707.643) -- 0:01:46
438500 -- [-1708.416] (-1713.598) (-1711.503) (-1705.765) * [-1710.441] (-1706.749) (-1718.593) (-1712.083) -- 0:01:46
439000 -- (-1714.512) (-1714.676) (-1711.631) [-1712.866] * [-1708.769] (-1714.726) (-1712.682) (-1720.249) -- 0:01:46
439500 -- (-1718.217) (-1712.766) (-1715.503) [-1713.794] * (-1709.871) (-1713.773) (-1711.516) [-1715.817] -- 0:01:47
440000 -- (-1715.032) (-1714.051) [-1714.270] (-1707.337) * (-1708.457) (-1708.511) (-1708.176) [-1713.539] -- 0:01:46
Average standard deviation of split frequencies: 0.019256
440500 -- (-1712.620) (-1711.190) (-1717.446) [-1706.909] * (-1707.084) (-1710.408) (-1708.656) [-1706.682] -- 0:01:46
441000 -- (-1714.260) [-1708.677] (-1717.814) (-1710.756) * (-1706.881) [-1710.901] (-1708.381) (-1711.413) -- 0:01:46
441500 -- (-1708.366) (-1709.178) (-1710.442) [-1708.480] * (-1712.388) [-1710.477] (-1708.062) (-1710.826) -- 0:01:46
442000 -- (-1715.064) (-1714.459) (-1709.817) [-1711.976] * [-1704.852] (-1715.377) (-1708.475) (-1708.224) -- 0:01:46
442500 -- (-1706.640) (-1707.407) [-1713.316] (-1711.194) * (-1709.873) [-1710.003] (-1714.614) (-1706.565) -- 0:01:45
443000 -- (-1705.801) [-1709.483] (-1715.371) (-1716.146) * (-1707.051) (-1714.079) (-1713.060) [-1715.371] -- 0:01:45
443500 -- (-1710.103) (-1714.712) [-1712.575] (-1714.383) * (-1713.960) (-1706.330) [-1714.246] (-1708.696) -- 0:01:45
444000 -- (-1711.569) (-1715.493) (-1717.808) [-1707.627] * (-1717.636) (-1715.039) [-1707.809] (-1711.015) -- 0:01:45
444500 -- (-1709.236) (-1710.197) [-1711.925] (-1710.732) * (-1707.424) [-1710.609] (-1710.175) (-1710.778) -- 0:01:44
445000 -- (-1711.041) [-1717.095] (-1708.032) (-1717.348) * (-1705.882) (-1715.586) [-1706.416] (-1713.788) -- 0:01:46
Average standard deviation of split frequencies: 0.016207
445500 -- [-1706.330] (-1710.241) (-1713.205) (-1715.288) * (-1721.134) (-1708.490) [-1710.472] (-1716.397) -- 0:01:45
446000 -- (-1717.574) [-1715.057] (-1715.266) (-1712.035) * (-1712.635) (-1705.450) [-1707.490] (-1711.386) -- 0:01:45
446500 -- (-1712.995) (-1712.233) (-1714.644) [-1710.144] * (-1714.396) (-1711.263) (-1710.782) [-1709.658] -- 0:01:45
447000 -- (-1708.493) (-1710.575) [-1717.709] (-1715.075) * (-1711.551) (-1705.538) [-1714.954] (-1716.905) -- 0:01:45
447500 -- [-1710.389] (-1704.620) (-1714.087) (-1711.974) * (-1714.716) (-1709.707) [-1711.876] (-1712.345) -- 0:01:44
448000 -- (-1712.256) [-1707.722] (-1712.010) (-1717.523) * (-1713.571) [-1711.515] (-1709.333) (-1715.833) -- 0:01:44
448500 -- [-1707.997] (-1707.200) (-1708.272) (-1707.181) * (-1714.809) (-1715.891) (-1710.373) [-1713.545] -- 0:01:44
449000 -- (-1707.092) (-1706.591) [-1708.865] (-1713.596) * (-1712.618) (-1712.222) (-1706.055) [-1708.186] -- 0:01:44
449500 -- (-1709.218) (-1709.781) [-1709.715] (-1708.821) * (-1711.722) (-1714.225) [-1705.731] (-1712.752) -- 0:01:44
450000 -- (-1712.119) (-1719.959) [-1707.601] (-1713.557) * (-1710.754) (-1710.000) (-1714.220) [-1709.929] -- 0:01:45
Average standard deviation of split frequencies: 0.016039
450500 -- (-1711.284) [-1711.711] (-1708.460) (-1712.937) * (-1708.797) [-1716.139] (-1710.884) (-1717.109) -- 0:01:44
451000 -- (-1709.459) (-1719.278) (-1711.902) [-1710.367] * (-1713.709) (-1708.185) (-1719.658) [-1713.394] -- 0:01:44
451500 -- [-1708.445] (-1721.297) (-1713.850) (-1713.786) * [-1707.271] (-1711.459) (-1711.356) (-1707.176) -- 0:01:44
452000 -- (-1707.517) (-1723.735) (-1713.850) [-1707.250] * (-1709.304) [-1710.441] (-1711.835) (-1708.720) -- 0:01:44
452500 -- (-1717.350) (-1715.837) (-1710.942) [-1707.200] * [-1711.572] (-1720.550) (-1708.650) (-1709.723) -- 0:01:44
453000 -- (-1707.767) (-1720.061) (-1711.099) [-1713.437] * (-1713.042) (-1718.577) [-1706.933] (-1710.822) -- 0:01:43
453500 -- (-1713.696) (-1714.970) (-1706.086) [-1712.826] * (-1713.910) [-1711.859] (-1714.615) (-1715.675) -- 0:01:43
454000 -- (-1709.295) (-1716.580) [-1706.231] (-1717.273) * (-1707.889) (-1714.919) [-1715.215] (-1711.130) -- 0:01:43
454500 -- (-1714.972) (-1710.343) (-1711.363) [-1707.020] * (-1711.318) (-1709.936) [-1710.978] (-1709.056) -- 0:01:43
455000 -- (-1716.071) (-1719.621) [-1711.757] (-1710.691) * (-1712.991) [-1707.831] (-1715.591) (-1715.943) -- 0:01:43
Average standard deviation of split frequencies: 0.016885
455500 -- (-1714.920) (-1716.643) [-1706.349] (-1716.144) * (-1711.708) (-1712.782) [-1714.275] (-1707.340) -- 0:01:43
456000 -- [-1710.626] (-1714.002) (-1708.339) (-1709.657) * (-1721.725) (-1707.186) (-1714.230) [-1712.160] -- 0:01:43
456500 -- (-1708.714) [-1705.807] (-1710.444) (-1713.990) * [-1711.132] (-1709.940) (-1716.383) (-1707.582) -- 0:01:43
457000 -- (-1715.017) [-1710.390] (-1713.934) (-1709.091) * [-1710.527] (-1711.625) (-1713.407) (-1706.894) -- 0:01:43
457500 -- (-1717.339) (-1720.084) [-1710.738] (-1712.201) * (-1705.788) (-1705.917) [-1706.815] (-1711.234) -- 0:01:43
458000 -- [-1713.507] (-1714.955) (-1717.277) (-1711.707) * (-1707.453) [-1709.164] (-1710.378) (-1708.087) -- 0:01:42
458500 -- [-1715.624] (-1706.536) (-1706.888) (-1713.616) * (-1710.724) (-1716.726) (-1716.371) [-1707.959] -- 0:01:42
459000 -- (-1710.972) [-1705.816] (-1713.583) (-1719.697) * (-1708.745) (-1714.428) (-1711.847) [-1706.487] -- 0:01:42
459500 -- (-1717.902) (-1709.690) [-1709.724] (-1715.711) * [-1709.677] (-1712.055) (-1715.494) (-1710.467) -- 0:01:42
460000 -- (-1712.690) [-1712.341] (-1713.624) (-1715.629) * (-1713.514) (-1719.225) [-1709.551] (-1717.914) -- 0:01:42
Average standard deviation of split frequencies: 0.016032
460500 -- (-1708.498) [-1710.370] (-1712.922) (-1713.251) * [-1706.769] (-1714.271) (-1711.146) (-1715.488) -- 0:01:41
461000 -- (-1712.575) [-1712.656] (-1708.012) (-1719.918) * [-1711.717] (-1716.733) (-1714.768) (-1720.081) -- 0:01:42
461500 -- (-1709.340) [-1707.015] (-1716.797) (-1717.220) * (-1709.084) (-1710.665) [-1706.524] (-1710.988) -- 0:01:42
462000 -- (-1709.347) (-1711.824) [-1716.194] (-1714.775) * (-1715.904) (-1707.931) [-1707.559] (-1711.283) -- 0:01:42
462500 -- (-1707.376) [-1711.060] (-1710.796) (-1713.612) * (-1705.729) (-1714.543) [-1708.488] (-1712.943) -- 0:01:42
463000 -- (-1716.692) (-1708.197) [-1710.010] (-1713.777) * (-1709.281) [-1712.899] (-1710.548) (-1717.627) -- 0:01:42
463500 -- (-1708.637) (-1716.253) [-1715.735] (-1708.822) * [-1710.806] (-1717.634) (-1709.620) (-1719.477) -- 0:01:41
464000 -- (-1711.329) [-1705.669] (-1710.156) (-1711.225) * (-1710.076) (-1711.113) (-1711.890) [-1718.423] -- 0:01:41
464500 -- (-1707.280) [-1712.183] (-1711.840) (-1711.688) * (-1711.623) [-1713.117] (-1711.646) (-1716.965) -- 0:01:41
465000 -- (-1713.035) [-1706.332] (-1713.318) (-1710.009) * [-1712.723] (-1721.227) (-1714.257) (-1712.622) -- 0:01:41
Average standard deviation of split frequencies: 0.015511
465500 -- (-1708.592) (-1713.151) [-1706.721] (-1712.644) * (-1718.876) [-1712.288] (-1716.605) (-1711.014) -- 0:01:41
466000 -- [-1708.096] (-1710.606) (-1709.486) (-1708.729) * (-1716.131) (-1710.762) (-1712.012) [-1714.904] -- 0:01:41
466500 -- (-1713.821) [-1710.570] (-1716.933) (-1711.808) * [-1717.709] (-1709.083) (-1712.963) (-1708.664) -- 0:01:41
467000 -- (-1710.806) (-1715.615) [-1708.873] (-1712.153) * [-1714.200] (-1709.447) (-1705.977) (-1712.915) -- 0:01:41
467500 -- (-1713.958) [-1716.254] (-1709.171) (-1706.104) * (-1715.614) (-1714.764) [-1711.386] (-1712.305) -- 0:01:41
468000 -- (-1708.555) (-1709.214) (-1712.870) [-1710.258] * (-1714.477) (-1709.767) (-1716.470) [-1712.432] -- 0:01:41
468500 -- (-1722.170) [-1713.380] (-1713.987) (-1710.410) * [-1707.158] (-1712.639) (-1711.924) (-1711.114) -- 0:01:40
469000 -- (-1709.065) (-1717.851) (-1712.404) [-1711.986] * [-1708.815] (-1714.449) (-1706.295) (-1708.724) -- 0:01:40
469500 -- (-1708.803) (-1713.211) (-1714.621) [-1705.171] * [-1709.167] (-1709.850) (-1709.354) (-1707.829) -- 0:01:40
470000 -- (-1709.289) (-1711.056) [-1717.200] (-1711.479) * [-1707.103] (-1713.460) (-1709.590) (-1718.254) -- 0:01:40
Average standard deviation of split frequencies: 0.018696
470500 -- (-1711.439) (-1711.156) [-1710.517] (-1715.868) * [-1710.370] (-1708.263) (-1704.610) (-1718.940) -- 0:01:40
471000 -- (-1713.125) [-1711.334] (-1708.638) (-1710.023) * (-1711.147) [-1707.771] (-1711.083) (-1715.104) -- 0:01:39
471500 -- (-1710.596) (-1714.421) [-1716.675] (-1709.818) * (-1708.934) (-1715.985) [-1714.549] (-1710.097) -- 0:01:40
472000 -- [-1711.029] (-1715.112) (-1710.427) (-1708.429) * (-1717.120) (-1712.921) (-1710.626) [-1707.015] -- 0:01:40
472500 -- (-1716.035) (-1709.270) (-1711.069) [-1711.918] * (-1713.989) [-1713.667] (-1712.769) (-1708.094) -- 0:01:40
473000 -- [-1704.068] (-1710.131) (-1709.337) (-1716.013) * (-1707.700) [-1707.426] (-1707.161) (-1705.367) -- 0:01:40
473500 -- (-1713.687) [-1709.819] (-1705.463) (-1711.581) * [-1710.413] (-1709.170) (-1704.709) (-1717.839) -- 0:01:40
474000 -- (-1717.008) (-1706.968) (-1708.222) [-1713.964] * (-1710.182) (-1707.886) (-1705.462) [-1712.071] -- 0:01:39
474500 -- (-1712.598) (-1708.209) (-1707.304) [-1717.294] * (-1709.561) (-1706.224) [-1712.839] (-1708.702) -- 0:01:39
475000 -- (-1722.439) [-1714.938] (-1710.731) (-1711.885) * (-1708.047) (-1705.879) (-1724.004) [-1706.626] -- 0:01:39
Average standard deviation of split frequencies: 0.017166
475500 -- [-1710.737] (-1714.208) (-1711.006) (-1712.557) * (-1710.383) [-1706.044] (-1712.011) (-1713.903) -- 0:01:39
476000 -- (-1709.861) [-1706.785] (-1707.510) (-1713.516) * [-1711.763] (-1707.083) (-1708.227) (-1711.963) -- 0:01:39
476500 -- (-1710.356) [-1710.231] (-1708.813) (-1711.713) * (-1714.192) [-1709.202] (-1708.388) (-1713.258) -- 0:01:38
477000 -- [-1708.583] (-1710.783) (-1708.362) (-1711.598) * (-1711.543) (-1717.856) (-1713.649) [-1711.498] -- 0:01:39
477500 -- (-1705.914) [-1708.768] (-1714.990) (-1719.216) * [-1709.421] (-1713.004) (-1712.553) (-1714.327) -- 0:01:39
478000 -- (-1708.893) (-1711.244) (-1711.775) [-1711.520] * (-1715.919) (-1714.116) (-1711.429) [-1711.059] -- 0:01:39
478500 -- (-1719.776) (-1716.694) [-1706.442] (-1706.740) * (-1707.596) (-1710.742) (-1711.217) [-1710.161] -- 0:01:39
479000 -- (-1709.400) [-1709.033] (-1708.734) (-1713.579) * (-1718.273) (-1707.069) (-1710.211) [-1706.542] -- 0:01:38
479500 -- (-1708.915) [-1712.550] (-1707.893) (-1716.741) * [-1710.857] (-1709.001) (-1714.037) (-1705.769) -- 0:01:38
480000 -- (-1713.413) (-1710.280) [-1714.046] (-1709.367) * (-1712.983) (-1713.895) (-1716.583) [-1707.795] -- 0:01:38
Average standard deviation of split frequencies: 0.016019
480500 -- (-1707.206) (-1713.998) [-1717.342] (-1704.310) * (-1711.830) [-1710.150] (-1717.635) (-1706.537) -- 0:01:38
481000 -- [-1715.800] (-1716.266) (-1711.126) (-1710.546) * (-1709.613) (-1715.348) (-1715.794) [-1713.118] -- 0:01:38
481500 -- (-1712.844) (-1710.851) (-1715.971) [-1709.555] * [-1705.711] (-1711.360) (-1709.492) (-1711.492) -- 0:01:37
482000 -- (-1710.291) [-1713.967] (-1716.896) (-1712.141) * (-1706.092) (-1710.133) (-1712.559) [-1710.816] -- 0:01:38
482500 -- (-1722.030) [-1709.063] (-1713.043) (-1708.830) * (-1712.933) (-1707.999) (-1707.659) [-1714.725] -- 0:01:38
483000 -- (-1713.727) (-1708.941) [-1705.444] (-1716.334) * (-1719.136) [-1710.762] (-1706.283) (-1719.221) -- 0:01:38
483500 -- (-1712.644) [-1707.958] (-1705.937) (-1720.301) * (-1715.296) (-1710.303) (-1714.297) [-1711.916] -- 0:01:38
484000 -- (-1715.100) (-1708.460) [-1707.522] (-1709.808) * (-1706.655) (-1709.226) [-1712.784] (-1708.521) -- 0:01:38
484500 -- (-1713.472) [-1714.035] (-1708.625) (-1712.169) * [-1705.440] (-1710.379) (-1709.732) (-1710.408) -- 0:01:37
485000 -- (-1706.026) (-1714.862) [-1716.468] (-1708.498) * (-1711.791) [-1712.004] (-1711.301) (-1711.922) -- 0:01:37
Average standard deviation of split frequencies: 0.011640
485500 -- (-1708.949) [-1710.313] (-1712.541) (-1713.523) * (-1711.288) [-1710.156] (-1717.438) (-1712.567) -- 0:01:37
486000 -- (-1706.790) (-1709.671) [-1718.018] (-1709.119) * (-1708.334) (-1716.495) [-1716.172] (-1714.096) -- 0:01:37
486500 -- (-1707.520) [-1718.063] (-1708.291) (-1711.914) * [-1707.623] (-1716.616) (-1714.824) (-1713.415) -- 0:01:37
487000 -- (-1705.400) (-1710.749) [-1709.060] (-1708.961) * (-1713.909) (-1707.562) [-1708.280] (-1708.976) -- 0:01:36
487500 -- [-1710.224] (-1707.960) (-1719.734) (-1714.081) * (-1712.075) (-1709.858) [-1707.402] (-1717.928) -- 0:01:37
488000 -- [-1705.582] (-1712.664) (-1710.286) (-1718.002) * [-1708.906] (-1720.684) (-1710.031) (-1709.012) -- 0:01:37
488500 -- (-1715.593) [-1709.195] (-1712.396) (-1712.440) * (-1716.548) [-1715.578] (-1706.708) (-1711.591) -- 0:01:37
489000 -- (-1708.844) (-1711.985) [-1709.446] (-1712.569) * (-1711.223) (-1708.828) (-1716.233) [-1713.008] -- 0:01:37
489500 -- (-1710.772) (-1708.270) (-1712.156) [-1709.904] * (-1712.759) (-1706.772) [-1706.972] (-1711.796) -- 0:01:36
490000 -- (-1716.897) [-1715.429] (-1713.389) (-1709.825) * (-1712.837) [-1709.419] (-1706.099) (-1707.246) -- 0:01:36
Average standard deviation of split frequencies: 0.010888
490500 -- (-1716.833) (-1710.941) [-1709.838] (-1718.181) * (-1715.881) [-1709.228] (-1706.183) (-1708.549) -- 0:01:36
491000 -- (-1709.171) [-1707.338] (-1711.066) (-1711.864) * (-1713.835) [-1709.562] (-1710.322) (-1709.840) -- 0:01:36
491500 -- (-1712.860) (-1709.730) (-1711.213) [-1718.369] * (-1715.504) (-1708.766) (-1711.510) [-1710.531] -- 0:01:36
492000 -- (-1719.350) (-1712.558) [-1715.743] (-1712.717) * (-1712.615) (-1707.473) (-1712.689) [-1712.674] -- 0:01:36
492500 -- [-1709.946] (-1711.615) (-1710.377) (-1713.254) * [-1710.988] (-1710.591) (-1707.977) (-1712.020) -- 0:01:36
493000 -- (-1708.808) [-1707.278] (-1706.060) (-1713.604) * [-1709.670] (-1715.705) (-1707.448) (-1718.307) -- 0:01:36
493500 -- [-1708.921] (-1708.109) (-1712.497) (-1714.058) * (-1713.965) [-1709.170] (-1717.714) (-1714.140) -- 0:01:36
494000 -- (-1715.393) (-1718.770) [-1705.444] (-1714.064) * (-1712.612) (-1715.336) (-1710.152) [-1711.856] -- 0:01:36
494500 -- [-1707.910] (-1710.649) (-1708.453) (-1711.994) * (-1714.137) [-1710.880] (-1717.898) (-1710.054) -- 0:01:36
495000 -- (-1714.610) (-1711.558) (-1706.915) [-1712.672] * [-1709.124] (-1712.054) (-1719.306) (-1715.745) -- 0:01:35
Average standard deviation of split frequencies: 0.012039
495500 -- (-1712.198) (-1713.428) (-1713.750) [-1703.963] * [-1709.610] (-1708.086) (-1713.358) (-1710.228) -- 0:01:35
496000 -- (-1710.590) (-1711.584) [-1706.403] (-1714.014) * (-1707.256) (-1712.053) [-1712.103] (-1709.495) -- 0:01:35
496500 -- (-1706.439) (-1710.259) (-1706.183) [-1706.700] * (-1708.734) (-1712.319) [-1710.335] (-1711.467) -- 0:01:35
497000 -- (-1724.420) (-1705.205) (-1711.702) [-1710.361] * [-1706.296] (-1713.873) (-1710.573) (-1709.214) -- 0:01:35
497500 -- (-1712.499) [-1713.245] (-1710.902) (-1715.305) * (-1710.268) (-1714.935) (-1708.425) [-1709.408] -- 0:01:34
498000 -- (-1713.793) [-1706.280] (-1709.055) (-1713.931) * [-1712.290] (-1708.574) (-1707.428) (-1714.042) -- 0:01:35
498500 -- [-1707.056] (-1713.499) (-1715.026) (-1715.355) * (-1706.688) [-1708.358] (-1713.376) (-1707.357) -- 0:01:35
499000 -- [-1709.383] (-1710.043) (-1711.740) (-1716.293) * (-1707.047) [-1710.108] (-1711.496) (-1708.707) -- 0:01:35
499500 -- (-1714.110) [-1713.950] (-1712.198) (-1715.748) * [-1706.539] (-1714.067) (-1711.191) (-1711.937) -- 0:01:35
500000 -- (-1711.827) [-1716.286] (-1709.470) (-1714.781) * [-1711.022] (-1717.997) (-1717.901) (-1713.009) -- 0:01:35
Average standard deviation of split frequencies: 0.010357
500500 -- (-1707.480) (-1711.986) [-1713.512] (-1716.341) * (-1712.633) (-1716.174) (-1712.428) [-1710.627] -- 0:01:34
501000 -- (-1712.926) (-1716.773) (-1711.414) [-1712.136] * (-1717.544) (-1721.607) (-1711.871) [-1705.790] -- 0:01:34
501500 -- (-1719.624) (-1719.634) [-1711.399] (-1721.700) * (-1709.741) (-1719.886) [-1710.399] (-1716.932) -- 0:01:34
502000 -- (-1716.854) [-1716.143] (-1710.561) (-1715.349) * (-1706.810) (-1718.017) [-1710.492] (-1711.532) -- 0:01:34
502500 -- (-1710.599) (-1718.951) [-1710.169] (-1714.026) * (-1714.375) (-1720.879) (-1710.253) [-1706.160] -- 0:01:34
503000 -- [-1710.533] (-1713.388) (-1709.462) (-1710.148) * (-1710.279) (-1710.642) (-1710.857) [-1709.619] -- 0:01:33
503500 -- (-1708.639) (-1714.381) [-1708.179] (-1714.717) * (-1706.281) (-1706.810) [-1707.551] (-1708.659) -- 0:01:34
504000 -- (-1712.741) (-1715.523) [-1709.130] (-1708.123) * (-1713.511) (-1715.172) (-1709.394) [-1704.886] -- 0:01:34
504500 -- (-1713.399) (-1706.658) [-1707.975] (-1715.856) * (-1710.734) [-1709.087] (-1709.071) (-1713.535) -- 0:01:34
505000 -- (-1709.101) (-1706.319) [-1711.793] (-1711.143) * [-1707.282] (-1710.284) (-1715.739) (-1712.689) -- 0:01:34
Average standard deviation of split frequencies: 0.009627
505500 -- [-1707.728] (-1714.585) (-1711.973) (-1709.495) * (-1709.297) (-1704.124) (-1711.673) [-1705.561] -- 0:01:33
506000 -- (-1712.254) [-1707.975] (-1715.033) (-1721.798) * (-1709.203) (-1712.783) (-1706.616) [-1708.362] -- 0:01:33
506500 -- (-1713.370) (-1709.911) [-1708.824] (-1711.202) * [-1709.378] (-1712.364) (-1712.816) (-1708.519) -- 0:01:33
507000 -- (-1709.481) (-1714.572) [-1709.245] (-1716.608) * [-1712.062] (-1711.076) (-1712.102) (-1709.113) -- 0:01:33
507500 -- [-1708.194] (-1713.875) (-1706.696) (-1713.355) * (-1712.367) (-1706.604) (-1711.616) [-1706.695] -- 0:01:33
508000 -- (-1715.775) [-1712.353] (-1708.408) (-1709.534) * (-1711.746) [-1709.920] (-1708.934) (-1706.216) -- 0:01:32
508500 -- (-1717.749) (-1707.802) (-1709.765) [-1708.706] * (-1709.424) [-1709.110] (-1713.537) (-1714.329) -- 0:01:33
509000 -- (-1713.231) [-1710.391] (-1710.967) (-1710.073) * (-1715.179) (-1709.357) (-1715.794) [-1712.063] -- 0:01:33
509500 -- (-1719.191) (-1712.412) [-1707.966] (-1712.110) * (-1713.302) (-1708.657) (-1710.696) [-1710.914] -- 0:01:33
510000 -- (-1721.513) [-1712.074] (-1711.269) (-1714.591) * (-1708.719) (-1714.917) [-1715.162] (-1713.807) -- 0:01:33
Average standard deviation of split frequencies: 0.007693
510500 -- (-1709.406) [-1709.928] (-1710.210) (-1710.360) * (-1708.541) (-1717.801) (-1718.189) [-1712.543] -- 0:01:33
511000 -- [-1710.340] (-1711.594) (-1712.320) (-1709.851) * (-1708.812) (-1714.313) (-1711.120) [-1710.337] -- 0:01:32
511500 -- (-1706.887) [-1710.990] (-1714.024) (-1713.553) * (-1707.157) (-1719.124) [-1707.108] (-1706.306) -- 0:01:32
512000 -- (-1708.582) [-1706.542] (-1712.475) (-1713.669) * [-1707.247] (-1712.765) (-1711.043) (-1714.841) -- 0:01:32
512500 -- (-1716.597) (-1714.349) (-1708.995) [-1706.733] * (-1711.489) (-1708.309) (-1715.527) [-1708.475] -- 0:01:32
513000 -- [-1713.471] (-1707.929) (-1709.291) (-1714.023) * (-1710.992) [-1713.563] (-1720.617) (-1713.838) -- 0:01:32
513500 -- (-1715.400) [-1710.233] (-1706.976) (-1711.288) * (-1711.781) (-1711.928) [-1709.037] (-1707.869) -- 0:01:31
514000 -- (-1712.055) (-1716.690) [-1706.064] (-1715.319) * (-1710.464) (-1709.935) (-1711.695) [-1707.320] -- 0:01:32
514500 -- (-1716.323) [-1712.128] (-1712.433) (-1710.404) * (-1708.520) [-1705.973] (-1709.414) (-1711.601) -- 0:01:32
515000 -- (-1713.254) (-1717.664) [-1707.959] (-1706.011) * [-1708.772] (-1707.427) (-1709.165) (-1709.016) -- 0:01:32
Average standard deviation of split frequencies: 0.006700
515500 -- [-1711.652] (-1712.417) (-1706.924) (-1709.562) * [-1711.534] (-1715.294) (-1710.184) (-1710.002) -- 0:01:32
516000 -- (-1719.478) (-1714.560) [-1713.922] (-1708.954) * (-1711.907) (-1705.893) [-1708.947] (-1707.787) -- 0:01:31
516500 -- (-1713.538) [-1712.088] (-1710.025) (-1710.690) * (-1714.847) [-1711.203] (-1711.757) (-1711.427) -- 0:01:31
517000 -- [-1712.237] (-1705.221) (-1713.803) (-1710.299) * (-1721.885) [-1712.255] (-1704.443) (-1707.022) -- 0:01:31
517500 -- (-1716.784) (-1706.823) [-1707.585] (-1709.921) * (-1716.047) (-1714.020) [-1707.160] (-1706.620) -- 0:01:31
518000 -- (-1718.484) (-1707.871) [-1713.554] (-1711.568) * [-1714.450] (-1709.860) (-1708.967) (-1711.727) -- 0:01:31
518500 -- [-1708.074] (-1708.761) (-1711.536) (-1714.268) * (-1707.322) (-1711.544) (-1715.048) [-1713.375] -- 0:01:31
519000 -- (-1711.178) (-1711.006) (-1719.778) [-1706.156] * (-1710.370) [-1711.857] (-1709.809) (-1712.708) -- 0:01:31
519500 -- [-1707.590] (-1710.686) (-1716.262) (-1708.684) * (-1708.184) [-1708.235] (-1707.002) (-1704.656) -- 0:01:31
520000 -- (-1714.116) [-1711.097] (-1718.211) (-1709.939) * (-1707.342) [-1711.404] (-1720.064) (-1711.185) -- 0:01:31
Average standard deviation of split frequencies: 0.004829
520500 -- (-1711.158) [-1708.963] (-1710.408) (-1707.360) * (-1715.409) (-1716.691) (-1717.131) [-1706.299] -- 0:01:31
521000 -- [-1712.567] (-1715.222) (-1709.466) (-1711.025) * (-1713.987) (-1710.560) [-1710.801] (-1711.513) -- 0:01:31
521500 -- [-1712.566] (-1708.075) (-1709.908) (-1711.895) * (-1713.857) (-1712.170) [-1716.765] (-1709.117) -- 0:01:30
522000 -- [-1708.704] (-1710.035) (-1715.286) (-1711.590) * (-1715.985) [-1710.209] (-1710.971) (-1712.267) -- 0:01:30
522500 -- (-1713.034) (-1708.545) (-1709.237) [-1708.723] * (-1712.525) (-1715.627) (-1714.242) [-1709.672] -- 0:01:30
523000 -- (-1715.687) [-1709.540] (-1716.760) (-1708.192) * (-1716.987) (-1711.411) (-1718.386) [-1712.888] -- 0:01:30
523500 -- (-1715.548) (-1715.532) [-1714.721] (-1705.513) * [-1709.562] (-1709.605) (-1711.605) (-1713.015) -- 0:01:30
524000 -- (-1716.495) [-1710.135] (-1710.510) (-1711.235) * [-1705.665] (-1708.442) (-1712.176) (-1714.811) -- 0:01:29
524500 -- [-1709.990] (-1714.262) (-1705.528) (-1710.957) * (-1707.532) (-1716.979) (-1711.108) [-1711.893] -- 0:01:30
525000 -- (-1712.757) [-1708.007] (-1707.926) (-1712.736) * (-1710.791) (-1711.323) [-1710.245] (-1707.264) -- 0:01:30
Average standard deviation of split frequencies: 0.003884
525500 -- (-1712.477) (-1712.793) (-1712.490) [-1712.362] * (-1710.875) [-1710.367] (-1708.762) (-1708.920) -- 0:01:30
526000 -- (-1711.765) (-1708.127) [-1715.695] (-1711.409) * (-1720.011) (-1708.592) (-1707.382) [-1707.442] -- 0:01:30
526500 -- [-1710.015] (-1712.649) (-1704.384) (-1716.974) * (-1713.038) (-1709.575) [-1708.835] (-1720.811) -- 0:01:29
527000 -- (-1713.278) (-1710.834) [-1712.780] (-1708.173) * (-1716.382) (-1706.993) [-1713.176] (-1715.207) -- 0:01:29
527500 -- (-1712.189) [-1711.633] (-1710.250) (-1711.023) * (-1714.387) [-1705.894] (-1722.924) (-1711.122) -- 0:01:29
528000 -- (-1713.613) [-1708.393] (-1709.192) (-1720.958) * [-1712.327] (-1712.031) (-1711.439) (-1713.588) -- 0:01:29
528500 -- (-1712.226) (-1707.732) [-1710.473] (-1710.995) * [-1710.459] (-1713.131) (-1715.773) (-1715.377) -- 0:01:29
529000 -- (-1712.249) [-1706.700] (-1716.205) (-1708.128) * (-1710.233) [-1710.147] (-1715.503) (-1713.348) -- 0:01:29
529500 -- (-1715.879) (-1707.362) (-1707.769) [-1712.443] * (-1711.300) [-1711.786] (-1711.673) (-1710.651) -- 0:01:28
530000 -- (-1715.387) [-1709.500] (-1707.558) (-1716.908) * (-1719.334) (-1715.794) [-1709.864] (-1711.088) -- 0:01:29
Average standard deviation of split frequencies: 0.000592
530500 -- (-1711.136) (-1719.380) [-1708.705] (-1711.400) * (-1713.589) [-1709.097] (-1716.753) (-1710.281) -- 0:01:29
531000 -- (-1709.132) [-1708.088] (-1714.705) (-1712.484) * (-1709.090) [-1710.928] (-1714.665) (-1709.901) -- 0:01:29
531500 -- (-1713.397) [-1715.038] (-1716.735) (-1709.717) * (-1713.576) [-1710.215] (-1715.213) (-1705.713) -- 0:01:29
532000 -- (-1710.661) (-1705.914) (-1718.158) [-1709.834] * (-1716.065) (-1711.546) [-1707.688] (-1707.850) -- 0:01:28
532500 -- (-1711.723) (-1719.920) [-1710.926] (-1709.505) * (-1714.092) (-1712.444) (-1707.467) [-1711.449] -- 0:01:28
533000 -- (-1708.175) (-1711.651) (-1713.038) [-1710.574] * (-1716.330) (-1713.409) (-1709.973) [-1707.465] -- 0:01:28
533500 -- (-1712.547) [-1708.013] (-1710.185) (-1716.878) * (-1709.146) [-1716.614] (-1717.361) (-1710.601) -- 0:01:28
534000 -- (-1714.505) (-1715.140) (-1707.948) [-1712.352] * [-1709.462] (-1713.753) (-1714.098) (-1716.477) -- 0:01:28
534500 -- (-1709.708) (-1715.598) [-1705.486] (-1708.034) * [-1712.074] (-1717.091) (-1715.005) (-1716.525) -- 0:01:27
535000 -- (-1714.877) (-1715.438) [-1710.539] (-1711.724) * (-1710.382) (-1713.976) [-1709.653] (-1712.376) -- 0:01:28
Average standard deviation of split frequencies: 0.000586
535500 -- (-1708.920) [-1708.254] (-1709.911) (-1709.778) * (-1718.090) (-1717.042) [-1710.454] (-1709.678) -- 0:01:28
536000 -- (-1709.109) (-1708.557) [-1710.597] (-1717.774) * (-1717.671) (-1715.933) (-1714.199) [-1710.345] -- 0:01:28
536500 -- (-1719.644) (-1711.555) [-1708.262] (-1716.548) * (-1716.346) (-1709.362) [-1711.790] (-1707.550) -- 0:01:28
537000 -- (-1726.711) (-1718.718) (-1716.580) [-1713.563] * (-1712.299) [-1709.598] (-1710.601) (-1712.518) -- 0:01:27
537500 -- (-1718.220) (-1712.725) (-1712.103) [-1707.722] * [-1708.573] (-1712.199) (-1708.302) (-1712.261) -- 0:01:27
538000 -- (-1725.974) (-1706.815) (-1716.475) [-1709.271] * (-1710.516) (-1716.732) [-1710.860] (-1710.374) -- 0:01:27
538500 -- (-1707.993) [-1713.366] (-1722.411) (-1712.123) * [-1716.331] (-1711.284) (-1717.786) (-1715.458) -- 0:01:27
539000 -- (-1709.586) (-1710.009) [-1724.086] (-1713.740) * [-1707.053] (-1710.415) (-1708.273) (-1711.524) -- 0:01:27
539500 -- [-1714.655] (-1711.961) (-1715.946) (-1713.750) * (-1714.647) (-1712.390) (-1714.282) [-1710.884] -- 0:01:27
540000 -- (-1709.153) [-1709.719] (-1717.152) (-1709.302) * [-1711.283] (-1706.925) (-1713.344) (-1711.149) -- 0:01:26
Average standard deviation of split frequencies: 0.002616
540500 -- [-1708.204] (-1709.882) (-1714.576) (-1711.304) * (-1713.287) [-1706.997] (-1710.590) (-1709.498) -- 0:01:27
541000 -- (-1708.021) (-1714.734) (-1709.901) [-1714.884] * (-1711.219) (-1710.333) (-1713.919) [-1707.446] -- 0:01:27
541500 -- [-1705.930] (-1713.887) (-1710.807) (-1716.684) * (-1714.939) (-1717.166) [-1710.116] (-1712.414) -- 0:01:27
542000 -- (-1709.235) [-1707.875] (-1718.583) (-1709.093) * (-1715.126) (-1714.617) (-1708.489) [-1714.581] -- 0:01:27
542500 -- [-1710.211] (-1711.088) (-1712.982) (-1708.288) * (-1712.529) (-1708.932) [-1709.060] (-1718.873) -- 0:01:26
543000 -- (-1710.789) (-1714.183) [-1708.470] (-1708.941) * (-1710.124) [-1711.043] (-1706.913) (-1711.436) -- 0:01:26
543500 -- (-1711.544) [-1705.443] (-1713.994) (-1710.803) * (-1711.624) (-1707.679) (-1711.400) [-1710.459] -- 0:01:26
544000 -- (-1711.581) (-1709.904) (-1711.613) [-1713.924] * (-1708.410) (-1716.108) (-1717.227) [-1711.269] -- 0:01:26
544500 -- (-1714.836) [-1706.898] (-1708.431) (-1711.046) * (-1712.814) [-1708.864] (-1714.060) (-1710.661) -- 0:01:26
545000 -- (-1711.885) [-1715.030] (-1711.161) (-1711.046) * [-1713.322] (-1708.981) (-1712.376) (-1714.622) -- 0:01:25
Average standard deviation of split frequencies: 0.005468
545500 -- [-1708.459] (-1709.366) (-1710.024) (-1719.354) * [-1718.805] (-1709.981) (-1715.571) (-1710.239) -- 0:01:26
546000 -- (-1711.123) (-1711.267) (-1708.763) [-1706.743] * [-1707.561] (-1709.745) (-1714.085) (-1715.804) -- 0:01:26
546500 -- (-1712.863) [-1707.613] (-1708.002) (-1708.083) * (-1709.870) (-1710.399) [-1715.106] (-1711.666) -- 0:01:26
547000 -- [-1707.439] (-1707.030) (-1712.762) (-1707.206) * [-1705.492] (-1721.009) (-1714.876) (-1714.616) -- 0:01:26
547500 -- (-1706.892) [-1709.884] (-1716.977) (-1710.029) * [-1707.738] (-1718.623) (-1711.742) (-1717.797) -- 0:01:25
548000 -- [-1708.680] (-1711.547) (-1716.471) (-1709.928) * [-1715.829] (-1719.525) (-1706.844) (-1716.696) -- 0:01:25
548500 -- [-1708.204] (-1712.978) (-1709.477) (-1708.014) * (-1715.674) (-1721.201) [-1711.007] (-1722.022) -- 0:01:25
549000 -- [-1712.249] (-1715.524) (-1707.920) (-1710.191) * (-1707.837) (-1709.636) (-1710.393) [-1712.190] -- 0:01:25
549500 -- (-1722.185) (-1714.358) (-1709.770) [-1709.995] * (-1706.040) [-1713.910] (-1707.497) (-1712.961) -- 0:01:25
550000 -- (-1715.301) (-1718.783) [-1712.080] (-1709.228) * (-1709.132) [-1708.816] (-1708.457) (-1717.490) -- 0:01:25
Average standard deviation of split frequencies: 0.004566
550500 -- (-1720.179) [-1707.924] (-1719.620) (-1714.648) * (-1712.802) (-1709.706) [-1709.689] (-1713.183) -- 0:01:24
551000 -- [-1711.005] (-1711.344) (-1709.843) (-1728.477) * [-1708.864] (-1708.842) (-1714.016) (-1710.866) -- 0:01:25
551500 -- [-1709.832] (-1708.636) (-1712.938) (-1714.767) * (-1710.795) (-1712.801) [-1711.092] (-1720.787) -- 0:01:25
552000 -- (-1710.224) (-1720.564) [-1707.587] (-1715.237) * (-1709.709) (-1711.130) (-1714.931) [-1718.438] -- 0:01:25
552500 -- (-1709.929) [-1709.049] (-1707.852) (-1715.565) * [-1705.555] (-1712.196) (-1709.570) (-1715.289) -- 0:01:25
553000 -- (-1712.105) [-1710.014] (-1709.698) (-1715.982) * (-1709.175) [-1712.857] (-1709.090) (-1720.005) -- 0:01:24
553500 -- (-1709.221) [-1708.404] (-1712.187) (-1708.781) * [-1708.622] (-1710.970) (-1723.172) (-1721.660) -- 0:01:24
554000 -- (-1708.934) (-1711.582) (-1715.129) [-1717.536] * [-1715.524] (-1708.819) (-1712.857) (-1719.808) -- 0:01:24
554500 -- (-1709.695) (-1713.563) (-1713.077) [-1707.116] * [-1712.344] (-1708.755) (-1713.880) (-1720.548) -- 0:01:24
555000 -- [-1712.981] (-1714.000) (-1717.311) (-1711.504) * (-1711.014) (-1705.962) [-1711.999] (-1711.512) -- 0:01:24
Average standard deviation of split frequencies: 0.003109
555500 -- (-1708.235) (-1715.639) [-1713.830] (-1720.443) * (-1710.211) (-1715.256) (-1709.123) [-1711.974] -- 0:01:24
556000 -- (-1713.470) [-1712.846] (-1708.902) (-1712.996) * [-1707.568] (-1711.395) (-1707.648) (-1706.272) -- 0:01:23
556500 -- (-1711.628) [-1710.200] (-1712.433) (-1714.235) * (-1714.814) (-1707.523) (-1714.360) [-1706.720] -- 0:01:24
557000 -- (-1713.741) [-1706.249] (-1714.279) (-1714.613) * (-1709.229) (-1712.188) (-1707.554) [-1707.769] -- 0:01:24
557500 -- [-1712.005] (-1706.303) (-1710.898) (-1716.369) * (-1709.509) (-1718.636) (-1706.531) [-1704.409] -- 0:01:24
558000 -- (-1714.470) [-1716.309] (-1711.984) (-1713.552) * [-1710.336] (-1716.682) (-1709.917) (-1714.120) -- 0:01:23
558500 -- (-1712.505) (-1706.831) (-1715.138) [-1712.164] * (-1715.246) (-1717.704) (-1712.084) [-1704.538] -- 0:01:23
559000 -- (-1710.254) (-1713.699) (-1713.874) [-1704.927] * [-1709.299] (-1708.767) (-1710.576) (-1710.584) -- 0:01:23
559500 -- (-1711.937) (-1712.087) [-1713.155] (-1710.626) * [-1716.599] (-1715.907) (-1713.823) (-1706.402) -- 0:01:23
560000 -- (-1710.964) [-1708.374] (-1709.398) (-1711.534) * [-1713.501] (-1710.514) (-1710.411) (-1710.866) -- 0:01:23
Average standard deviation of split frequencies: 0.000841
560500 -- (-1713.214) [-1716.756] (-1711.094) (-1716.748) * (-1713.179) (-1711.756) [-1711.409] (-1713.316) -- 0:01:23
561000 -- (-1710.014) (-1712.345) [-1712.294] (-1709.421) * (-1715.143) [-1712.538] (-1712.034) (-1708.367) -- 0:01:22
561500 -- (-1712.661) (-1707.846) (-1718.360) [-1715.434] * (-1706.881) [-1708.590] (-1712.172) (-1714.783) -- 0:01:23
562000 -- (-1715.197) (-1707.602) (-1716.197) [-1713.597] * [-1707.788] (-1711.783) (-1713.677) (-1713.560) -- 0:01:23
562500 -- (-1712.145) (-1718.507) (-1717.717) [-1708.946] * (-1709.474) [-1710.741] (-1714.225) (-1711.034) -- 0:01:23
563000 -- (-1714.328) (-1710.301) (-1712.300) [-1711.725] * (-1715.538) (-1709.861) (-1706.172) [-1715.280] -- 0:01:23
563500 -- (-1709.621) (-1716.049) (-1712.603) [-1708.826] * (-1709.825) (-1716.333) (-1710.794) [-1711.019] -- 0:01:22
564000 -- (-1710.988) (-1718.793) [-1719.953] (-1712.444) * [-1711.150] (-1712.258) (-1715.397) (-1713.141) -- 0:01:22
564500 -- (-1711.212) (-1711.422) (-1713.046) [-1705.569] * (-1716.106) [-1708.539] (-1711.728) (-1707.985) -- 0:01:22
565000 -- (-1717.744) (-1714.642) (-1711.824) [-1707.672] * (-1710.524) (-1715.604) (-1708.560) [-1712.678] -- 0:01:22
Average standard deviation of split frequencies: 0.000833
565500 -- (-1708.831) [-1715.059] (-1710.299) (-1720.953) * [-1707.315] (-1710.595) (-1715.558) (-1711.099) -- 0:01:22
566000 -- [-1708.969] (-1712.798) (-1713.101) (-1708.228) * (-1710.820) (-1709.659) [-1708.653] (-1711.703) -- 0:01:22
566500 -- (-1708.218) (-1710.267) (-1709.692) [-1709.523] * (-1711.415) (-1712.609) [-1710.864] (-1713.085) -- 0:01:21
567000 -- (-1709.762) [-1713.329] (-1714.161) (-1711.074) * [-1708.609] (-1712.711) (-1707.080) (-1707.313) -- 0:01:22
567500 -- (-1714.370) [-1711.092] (-1708.483) (-1710.685) * [-1711.044] (-1716.297) (-1712.545) (-1713.608) -- 0:01:22
568000 -- (-1707.054) (-1711.722) (-1710.506) [-1718.854] * (-1710.751) (-1711.848) (-1706.878) [-1712.313] -- 0:01:22
568500 -- (-1708.075) [-1710.628] (-1709.979) (-1713.726) * [-1711.069] (-1705.940) (-1705.890) (-1708.887) -- 0:01:21
569000 -- [-1706.728] (-1711.753) (-1714.782) (-1711.350) * (-1708.222) [-1712.906] (-1716.003) (-1710.223) -- 0:01:21
569500 -- [-1707.304] (-1721.900) (-1706.723) (-1713.373) * (-1725.305) (-1711.408) (-1707.768) [-1704.709] -- 0:01:21
570000 -- (-1711.316) (-1715.784) (-1711.789) [-1717.044] * (-1711.601) [-1708.164] (-1712.851) (-1711.371) -- 0:01:21
Average standard deviation of split frequencies: 0.002203
570500 -- (-1711.563) (-1710.254) (-1717.912) [-1709.815] * (-1716.067) (-1715.052) [-1709.895] (-1713.652) -- 0:01:21
571000 -- [-1708.409] (-1708.057) (-1713.440) (-1709.963) * (-1715.120) [-1712.229] (-1716.962) (-1709.203) -- 0:01:21
571500 -- (-1709.705) [-1708.606] (-1708.799) (-1705.360) * (-1717.772) (-1712.964) [-1710.198] (-1711.280) -- 0:01:20
572000 -- (-1715.222) [-1711.093] (-1709.668) (-1706.897) * (-1717.835) [-1708.450] (-1712.678) (-1710.648) -- 0:01:21
572500 -- (-1714.053) (-1707.612) (-1709.467) [-1707.189] * (-1706.402) (-1714.087) [-1707.025] (-1715.603) -- 0:01:21
573000 -- (-1714.516) (-1710.000) [-1710.596] (-1710.304) * (-1714.614) (-1712.406) (-1708.541) [-1709.976] -- 0:01:21
573500 -- (-1711.898) [-1711.837] (-1714.279) (-1709.294) * (-1711.239) (-1715.384) [-1710.754] (-1719.274) -- 0:01:21
574000 -- (-1714.879) (-1708.098) (-1713.767) [-1708.997] * (-1712.505) (-1720.030) (-1714.115) [-1713.069] -- 0:01:20
574500 -- (-1714.446) (-1712.216) (-1714.231) [-1710.232] * (-1712.960) [-1716.436] (-1714.793) (-1712.629) -- 0:01:20
575000 -- (-1711.226) (-1715.768) [-1712.191] (-1713.206) * (-1711.234) (-1716.815) (-1719.701) [-1708.171] -- 0:01:20
Average standard deviation of split frequencies: 0.000273
575500 -- (-1709.006) [-1707.075] (-1712.257) (-1709.306) * (-1709.425) [-1709.181] (-1712.682) (-1716.631) -- 0:01:20
576000 -- (-1707.268) (-1715.495) [-1713.474] (-1714.727) * (-1712.600) [-1710.554] (-1713.546) (-1724.342) -- 0:01:20
576500 -- (-1718.812) (-1715.687) [-1715.641] (-1714.128) * (-1711.628) [-1708.669] (-1717.762) (-1713.232) -- 0:01:20
577000 -- (-1705.037) (-1715.857) (-1721.678) [-1713.398] * [-1714.747] (-1711.972) (-1709.879) (-1717.095) -- 0:01:19
577500 -- (-1712.759) (-1716.354) (-1714.191) [-1714.153] * (-1712.920) [-1707.259] (-1708.025) (-1712.026) -- 0:01:20
578000 -- (-1707.225) (-1718.824) (-1714.373) [-1710.942] * (-1711.004) [-1716.451] (-1712.346) (-1717.552) -- 0:01:20
578500 -- [-1710.326] (-1716.742) (-1713.150) (-1711.035) * (-1718.734) [-1708.377] (-1711.470) (-1711.136) -- 0:01:20
579000 -- [-1708.013] (-1719.659) (-1711.409) (-1711.211) * (-1709.608) (-1708.071) [-1710.040] (-1710.229) -- 0:01:19
579500 -- (-1715.771) [-1713.790] (-1713.830) (-1706.811) * (-1707.969) (-1708.155) [-1706.249] (-1710.898) -- 0:01:19
580000 -- (-1715.019) [-1706.684] (-1714.676) (-1707.159) * (-1713.887) [-1710.458] (-1711.603) (-1713.396) -- 0:01:19
Average standard deviation of split frequencies: 0.000541
580500 -- (-1711.412) (-1713.002) (-1715.676) [-1705.227] * [-1710.752] (-1704.548) (-1709.245) (-1713.777) -- 0:01:19
581000 -- (-1710.612) (-1712.457) (-1718.550) [-1708.174] * (-1709.636) [-1704.806] (-1712.208) (-1714.353) -- 0:01:19
581500 -- (-1709.718) (-1712.039) (-1715.223) [-1709.705] * (-1712.715) [-1709.185] (-1714.995) (-1713.252) -- 0:01:19
582000 -- (-1713.913) (-1710.831) (-1718.668) [-1706.478] * [-1710.257] (-1707.801) (-1715.777) (-1707.967) -- 0:01:19
582500 -- [-1713.384] (-1712.195) (-1706.461) (-1712.173) * [-1707.297] (-1712.367) (-1714.675) (-1710.414) -- 0:01:18
583000 -- (-1715.139) (-1710.144) (-1708.383) [-1708.317] * (-1708.776) (-1713.751) (-1710.335) [-1708.470] -- 0:01:19
583500 -- (-1713.463) [-1706.295] (-1714.472) (-1707.696) * (-1703.904) (-1710.859) (-1711.891) [-1703.457] -- 0:01:19
584000 -- (-1714.364) (-1711.117) (-1706.512) [-1708.557] * (-1712.327) (-1709.509) [-1708.661] (-1712.853) -- 0:01:19
584500 -- (-1714.042) (-1718.505) [-1710.844] (-1712.118) * [-1710.258] (-1716.706) (-1707.656) (-1712.977) -- 0:01:18
585000 -- [-1714.534] (-1711.061) (-1708.831) (-1708.022) * (-1710.870) (-1706.864) (-1706.189) [-1713.488] -- 0:01:18
Average standard deviation of split frequencies: 0.000804
585500 -- (-1713.255) (-1711.423) [-1707.773] (-1709.173) * (-1708.455) (-1713.776) [-1709.939] (-1711.597) -- 0:01:18
586000 -- (-1711.740) (-1711.493) (-1708.561) [-1707.545] * [-1713.530] (-1712.955) (-1707.253) (-1712.670) -- 0:01:18
586500 -- (-1708.604) (-1709.124) (-1710.303) [-1716.727] * (-1714.442) (-1714.960) [-1712.591] (-1717.060) -- 0:01:18
587000 -- (-1711.448) [-1713.317] (-1718.084) (-1717.526) * [-1714.449] (-1715.211) (-1712.881) (-1713.126) -- 0:01:18
587500 -- (-1719.351) (-1711.787) [-1707.556] (-1713.389) * (-1709.731) (-1711.747) [-1710.165] (-1715.040) -- 0:01:17
588000 -- (-1715.156) (-1713.282) [-1708.015] (-1708.256) * (-1713.410) [-1715.833] (-1711.093) (-1709.682) -- 0:01:18
588500 -- (-1709.574) (-1713.655) [-1708.988] (-1708.174) * (-1714.868) (-1713.685) [-1709.438] (-1706.702) -- 0:01:18
589000 -- (-1717.167) (-1715.277) (-1711.008) [-1710.485] * (-1708.784) (-1713.490) [-1707.152] (-1714.739) -- 0:01:18
589500 -- (-1714.534) (-1708.628) [-1710.667] (-1711.421) * (-1713.305) (-1712.491) (-1715.614) [-1708.705] -- 0:01:17
590000 -- (-1714.484) [-1719.765] (-1713.937) (-1712.918) * (-1713.771) (-1709.117) (-1719.130) [-1717.546] -- 0:01:17
Average standard deviation of split frequencies: 0.001596
590500 -- (-1715.684) (-1710.850) (-1708.859) [-1709.977] * [-1712.325] (-1714.661) (-1717.118) (-1721.116) -- 0:01:17
591000 -- (-1714.201) (-1718.891) (-1711.664) [-1709.439] * (-1715.322) (-1708.106) (-1719.565) [-1709.818] -- 0:01:17
591500 -- (-1713.049) [-1715.751] (-1709.923) (-1719.190) * (-1719.458) (-1715.596) (-1712.913) [-1708.399] -- 0:01:17
592000 -- (-1706.937) (-1710.049) [-1714.674] (-1717.247) * (-1718.754) (-1710.272) [-1712.035] (-1713.978) -- 0:01:17
592500 -- [-1714.450] (-1711.721) (-1715.751) (-1712.190) * (-1712.900) [-1715.303] (-1714.057) (-1713.860) -- 0:01:17
593000 -- [-1706.423] (-1704.859) (-1716.982) (-1717.083) * (-1708.928) (-1713.306) (-1717.741) [-1715.854] -- 0:01:16
593500 -- (-1725.477) (-1704.491) (-1714.013) [-1716.323] * (-1719.913) (-1716.142) [-1713.338] (-1715.884) -- 0:01:17
594000 -- (-1718.242) (-1713.548) [-1714.307] (-1713.916) * [-1714.326] (-1719.312) (-1707.634) (-1711.903) -- 0:01:17
594500 -- (-1710.468) [-1712.225] (-1711.192) (-1715.047) * (-1716.731) (-1712.707) (-1708.589) [-1715.931] -- 0:01:17
595000 -- (-1715.524) (-1713.544) (-1712.603) [-1716.979] * (-1718.621) [-1709.535] (-1706.107) (-1719.325) -- 0:01:16
Average standard deviation of split frequencies: 0.001846
595500 -- (-1714.043) [-1708.779] (-1708.593) (-1712.644) * [-1716.599] (-1709.460) (-1710.302) (-1717.710) -- 0:01:16
596000 -- (-1709.700) [-1709.246] (-1707.701) (-1712.139) * [-1711.862] (-1718.359) (-1709.862) (-1715.633) -- 0:01:16
596500 -- (-1715.369) [-1708.140] (-1710.625) (-1714.600) * [-1708.406] (-1710.805) (-1711.905) (-1710.991) -- 0:01:16
597000 -- (-1713.735) (-1710.790) [-1711.745] (-1713.352) * (-1717.617) [-1710.952] (-1713.125) (-1712.349) -- 0:01:16
597500 -- (-1713.886) (-1708.686) (-1720.750) [-1711.985] * (-1723.359) (-1707.753) [-1717.895] (-1708.247) -- 0:01:16
598000 -- (-1709.103) (-1713.889) (-1711.892) [-1709.385] * (-1710.611) [-1705.078] (-1709.841) (-1711.752) -- 0:01:15
598500 -- [-1709.038] (-1710.454) (-1717.340) (-1712.682) * [-1709.869] (-1711.113) (-1718.404) (-1718.706) -- 0:01:16
599000 -- (-1712.883) (-1706.299) (-1711.858) [-1709.248] * [-1709.187] (-1707.576) (-1712.692) (-1712.355) -- 0:01:16
599500 -- (-1714.516) (-1711.039) (-1707.058) [-1706.296] * (-1717.938) (-1705.368) (-1711.671) [-1707.812] -- 0:01:16
600000 -- [-1711.954] (-1714.326) (-1719.006) (-1715.153) * (-1715.442) [-1710.559] (-1715.579) (-1714.597) -- 0:01:16
Average standard deviation of split frequencies: 0.002354
600500 -- (-1718.297) (-1714.843) [-1714.321] (-1706.756) * (-1714.953) [-1708.933] (-1712.476) (-1715.702) -- 0:01:15
601000 -- (-1712.247) (-1713.157) [-1705.337] (-1709.202) * [-1712.376] (-1708.233) (-1709.249) (-1708.415) -- 0:01:15
601500 -- [-1710.855] (-1711.565) (-1707.613) (-1709.069) * (-1714.528) (-1710.964) (-1713.169) [-1710.359] -- 0:01:15
602000 -- (-1711.112) (-1714.756) (-1708.380) [-1709.151] * [-1710.774] (-1712.011) (-1714.940) (-1709.621) -- 0:01:15
602500 -- (-1710.280) [-1707.636] (-1704.780) (-1715.651) * (-1713.143) (-1709.401) (-1710.980) [-1707.455] -- 0:01:15
603000 -- (-1713.813) (-1709.596) [-1712.617] (-1711.982) * (-1713.061) (-1714.037) (-1709.701) [-1708.547] -- 0:01:15
603500 -- [-1710.714] (-1713.510) (-1711.724) (-1714.299) * [-1716.655] (-1711.099) (-1710.899) (-1709.815) -- 0:01:14
604000 -- (-1713.174) (-1709.540) (-1708.683) [-1708.573] * (-1710.613) [-1710.608] (-1714.742) (-1712.785) -- 0:01:15
604500 -- (-1708.509) [-1710.535] (-1709.374) (-1709.377) * (-1711.424) [-1711.391] (-1707.236) (-1712.752) -- 0:01:15
605000 -- (-1712.619) [-1711.309] (-1707.181) (-1711.319) * (-1717.167) [-1707.521] (-1712.258) (-1709.333) -- 0:01:15
Average standard deviation of split frequencies: 0.002593
605500 -- [-1712.044] (-1707.759) (-1711.206) (-1710.984) * [-1714.010] (-1716.521) (-1711.445) (-1715.766) -- 0:01:14
606000 -- [-1711.126] (-1710.488) (-1722.906) (-1714.205) * (-1706.010) [-1710.614] (-1715.374) (-1709.844) -- 0:01:14
606500 -- (-1711.992) [-1713.575] (-1717.293) (-1715.634) * [-1709.153] (-1708.385) (-1706.395) (-1709.366) -- 0:01:14
607000 -- (-1724.950) (-1708.782) [-1714.784] (-1716.804) * (-1710.719) (-1709.493) [-1710.917] (-1711.991) -- 0:01:14
607500 -- [-1716.547] (-1714.204) (-1716.770) (-1715.826) * (-1713.344) [-1712.497] (-1714.369) (-1709.855) -- 0:01:14
608000 -- (-1725.319) (-1713.981) (-1723.796) [-1708.745] * [-1714.291] (-1709.672) (-1720.120) (-1712.806) -- 0:01:14
608500 -- (-1715.088) [-1710.157] (-1719.669) (-1713.588) * (-1708.607) [-1708.694] (-1707.939) (-1716.280) -- 0:01:13
609000 -- (-1715.698) (-1714.237) (-1709.189) [-1706.942] * (-1720.750) (-1710.165) (-1708.542) [-1717.497] -- 0:01:14
609500 -- (-1714.087) [-1708.753] (-1714.149) (-1710.223) * (-1712.647) (-1712.571) [-1709.997] (-1717.442) -- 0:01:14
610000 -- (-1712.521) (-1715.247) (-1712.709) [-1708.389] * (-1715.433) (-1709.734) [-1710.317] (-1714.726) -- 0:01:14
Average standard deviation of split frequencies: 0.002316
610500 -- (-1710.574) [-1710.861] (-1710.997) (-1706.478) * (-1711.432) (-1715.072) (-1716.694) [-1710.408] -- 0:01:14
611000 -- (-1710.787) (-1709.831) (-1708.685) [-1709.550] * (-1711.108) [-1709.629] (-1712.919) (-1716.788) -- 0:01:13
611500 -- [-1706.504] (-1710.027) (-1717.955) (-1709.828) * (-1708.665) (-1704.964) (-1714.199) [-1716.234] -- 0:01:13
612000 -- (-1712.566) (-1712.159) (-1714.575) [-1713.607] * (-1712.871) (-1709.842) (-1722.040) [-1711.504] -- 0:01:13
612500 -- (-1706.565) [-1707.081] (-1723.182) (-1715.988) * (-1713.309) [-1709.676] (-1711.990) (-1708.504) -- 0:01:13
613000 -- [-1708.687] (-1713.206) (-1713.637) (-1708.310) * (-1708.583) [-1710.060] (-1714.493) (-1711.720) -- 0:01:13
613500 -- (-1712.808) [-1707.859] (-1710.113) (-1708.883) * (-1712.686) (-1715.585) [-1715.367] (-1710.066) -- 0:01:13
614000 -- [-1708.401] (-1715.041) (-1712.116) (-1705.555) * (-1714.956) (-1712.652) (-1716.353) [-1706.161] -- 0:01:12
614500 -- [-1707.907] (-1710.965) (-1712.518) (-1707.214) * [-1707.911] (-1717.061) (-1716.308) (-1712.652) -- 0:01:13
615000 -- [-1712.216] (-1709.188) (-1716.742) (-1718.782) * (-1713.221) (-1715.128) (-1718.531) [-1708.115] -- 0:01:13
Average standard deviation of split frequencies: 0.001275
615500 -- (-1711.891) (-1705.655) (-1725.160) [-1717.842] * [-1709.766] (-1708.776) (-1712.772) (-1717.252) -- 0:01:13
616000 -- (-1714.712) [-1708.130] (-1720.342) (-1710.712) * (-1709.661) (-1713.098) [-1707.498] (-1712.155) -- 0:01:12
616500 -- [-1712.050] (-1707.030) (-1714.458) (-1715.999) * (-1714.637) (-1707.181) (-1714.482) [-1710.406] -- 0:01:12
617000 -- (-1715.848) (-1711.418) [-1712.376] (-1713.726) * (-1714.205) [-1706.380] (-1710.942) (-1714.210) -- 0:01:12
617500 -- (-1712.051) (-1707.330) [-1717.325] (-1711.177) * (-1709.956) (-1704.533) [-1716.882] (-1712.180) -- 0:01:12
618000 -- (-1716.311) [-1707.516] (-1709.761) (-1709.210) * (-1713.660) (-1711.593) [-1709.947] (-1707.556) -- 0:01:12
618500 -- [-1708.304] (-1717.868) (-1706.289) (-1713.130) * (-1710.766) (-1712.582) [-1710.402] (-1715.546) -- 0:01:12
619000 -- (-1711.311) [-1710.426] (-1708.144) (-1714.727) * (-1709.428) (-1713.767) (-1714.905) [-1709.116] -- 0:01:12
619500 -- [-1709.783] (-1711.825) (-1706.366) (-1708.863) * [-1716.462] (-1706.926) (-1707.793) (-1714.293) -- 0:01:11
620000 -- [-1708.201] (-1712.713) (-1709.763) (-1707.586) * [-1709.768] (-1707.723) (-1711.113) (-1708.908) -- 0:01:12
Average standard deviation of split frequencies: 0.001266
620500 -- (-1711.824) (-1710.072) (-1706.687) [-1705.391] * [-1712.281] (-1711.322) (-1706.753) (-1713.573) -- 0:01:12
621000 -- (-1706.814) (-1717.281) [-1704.332] (-1708.073) * (-1709.311) [-1708.795] (-1711.769) (-1710.555) -- 0:01:12
621500 -- (-1707.570) [-1708.348] (-1705.291) (-1717.005) * (-1710.546) (-1712.482) [-1712.600] (-1711.122) -- 0:01:11
622000 -- (-1707.893) [-1706.611] (-1711.167) (-1711.352) * (-1716.318) [-1712.374] (-1712.420) (-1711.061) -- 0:01:11
622500 -- (-1709.857) (-1709.754) [-1717.929] (-1708.702) * (-1710.829) [-1709.729] (-1712.692) (-1713.173) -- 0:01:11
623000 -- [-1714.689] (-1707.087) (-1710.291) (-1714.198) * [-1711.342] (-1714.465) (-1708.642) (-1712.018) -- 0:01:11
623500 -- (-1718.023) [-1707.356] (-1709.746) (-1710.833) * [-1708.741] (-1718.163) (-1713.457) (-1719.721) -- 0:01:11
624000 -- (-1724.484) (-1710.538) (-1710.568) [-1710.180] * [-1708.632] (-1714.384) (-1719.252) (-1711.214) -- 0:01:11
624500 -- (-1717.314) [-1708.744] (-1708.023) (-1712.574) * (-1714.252) (-1724.715) [-1706.580] (-1708.832) -- 0:01:10
625000 -- (-1713.697) [-1708.162] (-1713.315) (-1710.835) * (-1711.120) (-1705.269) (-1711.562) [-1707.199] -- 0:01:11
Average standard deviation of split frequencies: 0.000753
625500 -- [-1707.624] (-1708.830) (-1716.902) (-1710.594) * (-1713.706) (-1708.928) (-1710.762) [-1712.617] -- 0:01:11
626000 -- (-1714.521) (-1712.749) [-1709.686] (-1713.270) * (-1711.166) (-1710.506) [-1712.369] (-1708.754) -- 0:01:11
626500 -- (-1717.080) (-1708.342) [-1706.316] (-1710.736) * [-1707.339] (-1714.236) (-1711.229) (-1709.057) -- 0:01:10
627000 -- (-1713.651) (-1714.538) (-1710.661) [-1709.322] * [-1711.279] (-1712.304) (-1710.395) (-1711.376) -- 0:01:10
627500 -- (-1710.803) [-1712.057] (-1713.745) (-1715.171) * [-1706.579] (-1710.069) (-1717.958) (-1709.282) -- 0:01:10
628000 -- [-1708.311] (-1711.906) (-1710.455) (-1708.030) * (-1714.586) [-1708.804] (-1713.422) (-1707.902) -- 0:01:10
628500 -- (-1711.310) (-1716.471) (-1713.293) [-1709.280] * (-1708.644) (-1710.125) [-1706.972] (-1715.482) -- 0:01:10
629000 -- (-1711.411) (-1709.555) [-1712.746] (-1710.592) * (-1708.489) [-1710.199] (-1709.169) (-1708.234) -- 0:01:10
629500 -- (-1710.696) (-1717.789) [-1710.898] (-1717.860) * (-1709.842) (-1715.632) (-1706.670) [-1714.544] -- 0:01:10
630000 -- (-1713.778) [-1713.117] (-1712.596) (-1716.921) * (-1713.829) [-1705.786] (-1706.640) (-1710.835) -- 0:01:09
Average standard deviation of split frequencies: 0.000997
630500 -- (-1708.304) (-1713.352) [-1714.451] (-1716.665) * [-1710.383] (-1716.837) (-1708.630) (-1708.808) -- 0:01:10
631000 -- (-1715.955) (-1712.420) [-1715.755] (-1711.994) * [-1712.500] (-1710.930) (-1707.494) (-1714.485) -- 0:01:10
631500 -- (-1710.024) [-1709.875] (-1706.926) (-1706.668) * (-1718.255) [-1713.689] (-1714.095) (-1714.174) -- 0:01:10
632000 -- (-1710.734) (-1710.650) [-1712.653] (-1715.821) * [-1710.262] (-1715.484) (-1713.663) (-1711.098) -- 0:01:09
632500 -- (-1713.655) (-1711.680) [-1709.678] (-1710.482) * [-1714.519] (-1707.982) (-1711.159) (-1711.168) -- 0:01:09
633000 -- [-1714.029] (-1717.852) (-1710.646) (-1717.426) * [-1711.799] (-1708.712) (-1713.952) (-1714.169) -- 0:01:09
633500 -- [-1707.721] (-1715.954) (-1710.069) (-1711.524) * (-1710.864) (-1712.013) (-1708.874) [-1713.895] -- 0:01:09
634000 -- (-1710.300) (-1710.949) [-1706.509] (-1714.164) * (-1708.935) (-1715.326) (-1706.511) [-1718.419] -- 0:01:09
634500 -- [-1705.120] (-1712.008) (-1716.337) (-1710.335) * (-1712.507) (-1715.787) [-1709.972] (-1713.626) -- 0:01:09
635000 -- [-1711.288] (-1708.581) (-1712.473) (-1707.487) * (-1719.756) (-1717.293) [-1709.267] (-1708.756) -- 0:01:08
Average standard deviation of split frequencies: 0.001729
635500 -- (-1713.837) [-1711.982] (-1710.248) (-1712.225) * (-1720.911) (-1718.355) [-1712.596] (-1707.116) -- 0:01:08
636000 -- [-1711.736] (-1713.507) (-1713.747) (-1710.060) * (-1708.777) (-1715.505) [-1707.783] (-1708.396) -- 0:01:09
636500 -- (-1721.406) (-1707.801) [-1708.112] (-1708.221) * [-1708.892] (-1711.751) (-1718.033) (-1710.287) -- 0:01:09
637000 -- (-1714.003) (-1715.370) [-1710.080] (-1710.685) * (-1708.560) (-1715.090) [-1706.525] (-1711.138) -- 0:01:08
637500 -- (-1712.820) [-1709.242] (-1706.516) (-1711.085) * (-1709.410) (-1714.598) (-1707.805) [-1709.869] -- 0:01:08
638000 -- (-1714.893) (-1715.402) (-1718.230) [-1708.081] * (-1703.835) (-1710.864) (-1711.946) [-1707.178] -- 0:01:08
638500 -- (-1714.571) [-1710.386] (-1710.638) (-1714.978) * [-1704.788] (-1710.802) (-1709.866) (-1705.819) -- 0:01:08
639000 -- (-1712.998) (-1705.269) [-1708.131] (-1718.530) * (-1710.755) (-1707.162) [-1707.570] (-1710.116) -- 0:01:08
639500 -- [-1707.224] (-1713.098) (-1715.955) (-1711.698) * (-1709.144) (-1707.888) (-1708.199) [-1705.948] -- 0:01:08
640000 -- (-1708.999) (-1708.115) [-1708.596] (-1711.335) * (-1708.547) (-1713.042) (-1712.849) [-1707.994] -- 0:01:08
Average standard deviation of split frequencies: 0.003188
640500 -- (-1709.498) (-1705.826) [-1710.975] (-1711.302) * [-1706.884] (-1713.326) (-1714.862) (-1715.715) -- 0:01:07
641000 -- (-1710.323) [-1706.773] (-1710.663) (-1712.886) * (-1715.772) [-1717.956] (-1709.366) (-1707.464) -- 0:01:08
641500 -- (-1714.849) [-1710.342] (-1712.834) (-1711.745) * [-1712.914] (-1720.642) (-1710.317) (-1711.198) -- 0:01:08
642000 -- (-1718.155) (-1711.299) [-1713.169] (-1716.354) * (-1707.822) (-1711.506) (-1715.998) [-1712.025] -- 0:01:08
642500 -- [-1714.131] (-1710.391) (-1717.563) (-1712.015) * (-1715.067) (-1709.685) [-1712.966] (-1707.434) -- 0:01:07
643000 -- [-1710.225] (-1716.603) (-1712.792) (-1715.582) * (-1706.306) (-1712.806) [-1708.452] (-1710.041) -- 0:01:07
643500 -- (-1712.265) (-1706.460) (-1708.722) [-1708.710] * [-1714.150] (-1716.006) (-1711.941) (-1717.796) -- 0:01:07
644000 -- (-1709.926) [-1709.402] (-1709.582) (-1707.372) * (-1715.251) (-1712.112) [-1713.544] (-1710.530) -- 0:01:07
644500 -- [-1711.661] (-1708.859) (-1711.276) (-1709.416) * (-1709.721) (-1708.739) [-1709.704] (-1710.611) -- 0:01:07
645000 -- [-1709.067] (-1712.453) (-1713.646) (-1709.384) * (-1723.902) (-1709.815) [-1711.049] (-1711.235) -- 0:01:07
Average standard deviation of split frequencies: 0.001459
645500 -- [-1710.931] (-1710.674) (-1716.451) (-1715.646) * (-1718.260) (-1713.513) (-1707.545) [-1708.457] -- 0:01:07
646000 -- [-1704.882] (-1716.174) (-1717.931) (-1708.864) * (-1712.572) (-1714.124) (-1712.474) [-1714.085] -- 0:01:06
646500 -- (-1712.871) (-1717.353) (-1717.052) [-1713.622] * [-1710.993] (-1723.447) (-1716.942) (-1708.133) -- 0:01:07
647000 -- (-1710.221) [-1711.144] (-1708.455) (-1710.767) * [-1712.505] (-1707.441) (-1710.986) (-1716.639) -- 0:01:07
647500 -- (-1707.835) (-1710.138) (-1709.621) [-1711.540] * (-1710.648) [-1715.769] (-1710.919) (-1713.117) -- 0:01:06
648000 -- (-1706.919) [-1713.201] (-1712.226) (-1710.877) * (-1709.335) (-1713.445) [-1717.017] (-1711.571) -- 0:01:06
648500 -- (-1708.519) (-1705.433) (-1711.582) [-1710.145] * (-1710.434) [-1707.938] (-1711.187) (-1710.644) -- 0:01:06
649000 -- [-1703.775] (-1709.541) (-1710.843) (-1712.547) * (-1713.271) (-1715.756) [-1709.967] (-1710.922) -- 0:01:06
649500 -- [-1709.565] (-1707.184) (-1714.118) (-1713.790) * (-1714.357) (-1711.632) [-1709.953] (-1715.215) -- 0:01:06
650000 -- [-1706.902] (-1712.411) (-1711.715) (-1720.369) * (-1713.188) [-1716.726] (-1716.889) (-1711.948) -- 0:01:06
Average standard deviation of split frequencies: 0.002898
650500 -- (-1704.393) (-1712.439) (-1707.194) [-1719.306] * (-1713.887) [-1708.619] (-1710.155) (-1711.638) -- 0:01:06
651000 -- (-1705.438) (-1715.183) [-1703.533] (-1711.194) * (-1711.767) [-1714.009] (-1710.029) (-1710.073) -- 0:01:05
651500 -- (-1710.778) [-1714.790] (-1711.152) (-1712.801) * (-1709.734) (-1710.595) [-1709.492] (-1715.342) -- 0:01:05
652000 -- (-1709.279) (-1710.948) [-1709.624] (-1706.737) * [-1708.519] (-1723.046) (-1711.536) (-1709.511) -- 0:01:06
652500 -- (-1708.397) [-1714.160] (-1708.313) (-1714.321) * (-1716.204) (-1709.857) [-1711.147] (-1710.156) -- 0:01:06
653000 -- (-1711.192) (-1709.423) [-1708.264] (-1713.614) * (-1722.956) (-1712.709) (-1716.638) [-1714.098] -- 0:01:05
653500 -- (-1714.277) [-1707.192] (-1715.108) (-1710.428) * (-1715.032) (-1709.386) [-1709.775] (-1711.333) -- 0:01:05
654000 -- [-1708.066] (-1711.687) (-1713.486) (-1707.946) * (-1710.129) (-1709.933) (-1707.550) [-1712.275] -- 0:01:05
654500 -- [-1706.329] (-1711.270) (-1706.507) (-1711.734) * (-1713.313) (-1711.777) (-1711.332) [-1710.971] -- 0:01:05
655000 -- [-1706.723] (-1711.760) (-1711.087) (-1713.056) * (-1709.610) (-1706.152) [-1707.404] (-1713.351) -- 0:01:05
Average standard deviation of split frequencies: 0.001437
655500 -- [-1714.930] (-1712.560) (-1716.189) (-1710.820) * (-1713.662) (-1708.238) (-1711.138) [-1705.284] -- 0:01:05
656000 -- (-1709.142) (-1712.440) (-1710.410) [-1708.883] * (-1709.678) [-1720.221] (-1708.644) (-1710.556) -- 0:01:05
656500 -- [-1709.901] (-1708.806) (-1708.158) (-1716.416) * (-1717.118) [-1706.092] (-1708.081) (-1709.305) -- 0:01:04
657000 -- [-1708.961] (-1704.848) (-1716.857) (-1715.312) * (-1706.846) (-1708.423) [-1710.502] (-1715.865) -- 0:01:05
657500 -- (-1707.713) (-1710.776) (-1709.713) [-1708.115] * (-1714.243) [-1710.742] (-1709.929) (-1712.619) -- 0:01:05
658000 -- (-1708.544) [-1707.212] (-1716.839) (-1709.091) * (-1708.459) [-1710.171] (-1715.017) (-1706.511) -- 0:01:04
658500 -- (-1711.530) (-1711.096) (-1720.256) [-1709.838] * (-1710.749) [-1706.483] (-1711.002) (-1704.377) -- 0:01:04
659000 -- (-1715.039) [-1710.082] (-1715.428) (-1709.956) * (-1713.089) (-1712.752) (-1720.684) [-1711.026] -- 0:01:04
659500 -- (-1714.944) (-1712.410) (-1712.656) [-1706.395] * (-1715.907) [-1714.957] (-1711.684) (-1706.065) -- 0:01:04
660000 -- (-1714.523) [-1715.589] (-1707.077) (-1711.043) * (-1721.355) [-1710.075] (-1717.624) (-1714.033) -- 0:01:04
Average standard deviation of split frequencies: 0.001427
660500 -- (-1711.527) (-1710.448) (-1710.254) [-1712.802] * (-1706.383) [-1714.708] (-1708.497) (-1711.851) -- 0:01:04
661000 -- [-1710.467] (-1711.261) (-1716.750) (-1711.812) * (-1708.703) [-1707.215] (-1712.428) (-1711.546) -- 0:01:04
661500 -- (-1712.595) (-1707.780) (-1706.354) [-1710.543] * (-1711.659) [-1711.488] (-1712.840) (-1706.349) -- 0:01:03
662000 -- (-1711.424) (-1712.249) (-1708.097) [-1706.939] * [-1708.640] (-1710.057) (-1716.379) (-1713.458) -- 0:01:03
662500 -- [-1707.117] (-1713.400) (-1712.154) (-1711.043) * [-1710.873] (-1706.795) (-1712.280) (-1719.184) -- 0:01:04
663000 -- [-1709.701] (-1714.225) (-1710.067) (-1709.264) * (-1710.067) (-1710.293) (-1710.821) [-1710.529] -- 0:01:04
663500 -- [-1708.315] (-1712.535) (-1706.084) (-1718.253) * (-1713.147) [-1705.837] (-1713.860) (-1707.018) -- 0:01:03
664000 -- (-1710.404) [-1713.478] (-1708.583) (-1711.429) * (-1710.438) (-1707.406) [-1719.434] (-1706.446) -- 0:01:03
664500 -- [-1706.998] (-1708.014) (-1713.934) (-1708.339) * (-1710.000) (-1715.333) [-1709.711] (-1708.841) -- 0:01:03
665000 -- (-1717.203) (-1708.157) (-1716.274) [-1709.053] * (-1712.822) (-1724.147) [-1710.971] (-1710.035) -- 0:01:03
Average standard deviation of split frequencies: 0.000708
665500 -- (-1707.161) [-1710.809] (-1713.785) (-1713.217) * (-1713.313) [-1710.723] (-1708.792) (-1705.872) -- 0:01:03
666000 -- (-1707.200) (-1711.816) [-1712.467] (-1706.323) * [-1707.004] (-1722.246) (-1706.397) (-1711.577) -- 0:01:03
666500 -- (-1707.479) (-1705.124) [-1711.285] (-1715.558) * (-1712.916) (-1714.811) [-1712.340] (-1715.953) -- 0:01:03
667000 -- [-1707.523] (-1712.925) (-1714.912) (-1710.832) * (-1717.096) [-1711.043] (-1713.278) (-1713.742) -- 0:01:02
667500 -- (-1703.826) (-1705.833) [-1709.203] (-1708.826) * (-1715.400) (-1708.566) [-1710.396] (-1714.485) -- 0:01:02
668000 -- (-1712.395) [-1712.473] (-1707.142) (-1715.107) * (-1712.238) [-1718.694] (-1712.539) (-1712.668) -- 0:01:03
668500 -- [-1705.495] (-1708.504) (-1708.661) (-1710.963) * (-1709.566) (-1714.686) (-1717.601) [-1711.126] -- 0:01:02
669000 -- [-1707.772] (-1707.782) (-1709.343) (-1712.910) * (-1708.887) (-1713.897) (-1719.351) [-1710.032] -- 0:01:02
669500 -- (-1713.366) [-1713.921] (-1718.022) (-1710.576) * (-1710.417) (-1713.208) (-1716.430) [-1710.130] -- 0:01:02
670000 -- (-1715.387) (-1705.953) [-1715.212] (-1717.268) * (-1708.285) [-1707.021] (-1714.391) (-1712.494) -- 0:01:02
Average standard deviation of split frequencies: 0.000469
670500 -- (-1708.791) [-1712.151] (-1709.627) (-1713.742) * [-1709.433] (-1710.011) (-1718.367) (-1706.742) -- 0:01:02
671000 -- (-1708.191) (-1707.427) [-1709.699] (-1709.424) * (-1717.538) (-1713.695) [-1708.715] (-1713.783) -- 0:01:02
671500 -- (-1716.893) (-1709.218) [-1707.274] (-1709.817) * (-1710.116) [-1711.187] (-1708.459) (-1714.881) -- 0:01:02
672000 -- (-1714.206) (-1707.506) [-1722.569] (-1710.715) * (-1711.341) (-1707.382) (-1711.906) [-1715.774] -- 0:01:01
672500 -- (-1711.800) (-1710.702) [-1719.406] (-1707.795) * (-1711.251) [-1713.238] (-1706.187) (-1716.658) -- 0:01:01
673000 -- (-1712.711) (-1710.335) [-1714.072] (-1716.722) * (-1710.254) (-1709.442) [-1711.413] (-1708.976) -- 0:01:02
673500 -- (-1712.022) (-1716.893) [-1711.382] (-1714.458) * (-1707.329) (-1713.833) (-1713.805) [-1707.727] -- 0:01:02
674000 -- (-1715.725) (-1713.447) (-1711.956) [-1714.748] * (-1706.254) (-1709.204) (-1716.486) [-1708.674] -- 0:01:01
674500 -- (-1714.564) [-1711.722] (-1713.696) (-1705.768) * [-1711.987] (-1716.787) (-1709.752) (-1708.637) -- 0:01:01
675000 -- (-1714.004) [-1712.704] (-1715.594) (-1707.979) * [-1706.774] (-1708.964) (-1720.236) (-1717.412) -- 0:01:01
Average standard deviation of split frequencies: 0.000697
675500 -- (-1718.627) (-1715.045) (-1715.115) [-1708.890] * [-1707.736] (-1710.819) (-1720.768) (-1715.791) -- 0:01:01
676000 -- (-1717.569) (-1711.533) (-1712.998) [-1715.923] * (-1715.512) (-1711.614) [-1706.379] (-1710.932) -- 0:01:01
676500 -- (-1716.802) (-1712.602) [-1710.305] (-1708.576) * (-1710.640) (-1709.813) [-1711.805] (-1708.417) -- 0:01:01
677000 -- (-1714.697) (-1708.232) (-1714.363) [-1711.986] * (-1713.897) [-1706.790] (-1711.474) (-1710.854) -- 0:01:01
677500 -- (-1711.246) [-1710.984] (-1712.173) (-1710.676) * (-1712.255) (-1714.486) [-1709.907] (-1706.990) -- 0:01:00
678000 -- (-1717.972) (-1715.860) (-1713.267) [-1709.180] * (-1714.764) [-1707.159] (-1711.017) (-1710.435) -- 0:01:00
678500 -- (-1715.302) (-1705.818) [-1716.003] (-1704.892) * (-1715.258) [-1711.907] (-1713.344) (-1704.793) -- 0:01:01
679000 -- (-1708.879) (-1710.315) (-1713.807) [-1711.484] * (-1712.853) (-1713.499) (-1710.501) [-1705.721] -- 0:01:00
679500 -- [-1712.190] (-1708.112) (-1712.668) (-1710.095) * (-1712.308) (-1717.623) (-1715.951) [-1711.062] -- 0:01:00
680000 -- [-1707.791] (-1717.233) (-1710.507) (-1709.919) * (-1717.363) [-1712.286] (-1713.207) (-1710.735) -- 0:01:00
Average standard deviation of split frequencies: 0.001385
680500 -- (-1709.182) (-1713.973) (-1712.341) [-1710.519] * [-1716.836] (-1708.003) (-1712.930) (-1709.855) -- 0:01:00
681000 -- (-1713.886) (-1711.805) (-1708.606) [-1709.481] * (-1717.095) (-1711.472) (-1706.978) [-1720.492] -- 0:01:00
681500 -- [-1709.428] (-1714.925) (-1708.239) (-1708.133) * (-1706.822) [-1705.813] (-1715.368) (-1718.620) -- 0:01:00
682000 -- (-1715.036) [-1710.681] (-1716.314) (-1717.381) * (-1712.996) (-1707.294) (-1710.783) [-1712.270] -- 0:01:00
682500 -- [-1709.389] (-1715.076) (-1708.780) (-1709.694) * [-1711.191] (-1707.960) (-1709.210) (-1711.706) -- 0:01:00
683000 -- (-1708.944) [-1704.777] (-1711.547) (-1715.596) * (-1706.232) (-1706.407) [-1713.723] (-1706.165) -- 0:00:59
683500 -- [-1708.207] (-1710.456) (-1711.397) (-1707.651) * (-1715.101) (-1711.815) [-1716.276] (-1708.157) -- 0:01:00
684000 -- (-1708.132) (-1707.734) [-1711.889] (-1709.220) * [-1712.350] (-1711.097) (-1719.667) (-1712.867) -- 0:01:00
684500 -- (-1713.246) [-1708.692] (-1716.891) (-1711.845) * [-1710.450] (-1716.535) (-1711.459) (-1711.559) -- 0:00:59
685000 -- (-1712.518) [-1709.930] (-1719.457) (-1715.152) * (-1713.587) [-1706.640] (-1710.795) (-1709.450) -- 0:00:59
Average standard deviation of split frequencies: 0.002978
685500 -- (-1709.512) (-1708.101) (-1709.362) [-1709.669] * [-1708.388] (-1713.727) (-1716.708) (-1711.052) -- 0:00:59
686000 -- [-1709.311] (-1710.589) (-1711.080) (-1709.655) * (-1717.126) (-1709.558) [-1714.160] (-1710.535) -- 0:00:59
686500 -- (-1708.155) [-1708.696] (-1714.972) (-1709.753) * (-1712.051) (-1725.653) (-1705.901) [-1713.731] -- 0:00:59
687000 -- (-1711.898) (-1712.230) [-1711.903] (-1712.807) * [-1714.472] (-1710.523) (-1709.159) (-1711.814) -- 0:00:59
687500 -- (-1711.173) (-1717.500) (-1713.684) [-1713.295] * [-1712.090] (-1709.620) (-1710.497) (-1711.529) -- 0:00:59
688000 -- (-1707.809) (-1714.248) (-1718.830) [-1710.853] * [-1712.765] (-1708.566) (-1712.778) (-1710.081) -- 0:00:58
688500 -- (-1714.837) (-1711.559) (-1717.434) [-1713.746] * (-1717.023) (-1709.773) [-1710.203] (-1712.314) -- 0:00:58
689000 -- (-1712.788) (-1709.523) [-1709.210] (-1715.346) * (-1710.643) (-1713.468) (-1710.587) [-1711.464] -- 0:00:59
689500 -- [-1712.490] (-1706.109) (-1715.031) (-1713.792) * (-1711.956) [-1710.176] (-1710.111) (-1709.684) -- 0:00:58
690000 -- [-1708.061] (-1711.128) (-1707.743) (-1708.422) * [-1709.478] (-1705.800) (-1710.779) (-1714.732) -- 0:00:58
Average standard deviation of split frequencies: 0.003868
690500 -- [-1708.898] (-1709.386) (-1707.501) (-1709.647) * (-1709.383) [-1711.929] (-1713.434) (-1714.795) -- 0:00:58
691000 -- (-1713.782) (-1709.044) [-1714.663] (-1714.161) * [-1710.702] (-1718.997) (-1708.658) (-1707.526) -- 0:00:58
691500 -- (-1710.151) [-1708.323] (-1707.559) (-1716.016) * (-1711.537) [-1705.630] (-1710.176) (-1709.029) -- 0:00:58
692000 -- (-1713.415) (-1711.036) (-1711.100) [-1709.900] * (-1716.762) (-1712.083) [-1712.446] (-1713.181) -- 0:00:58
692500 -- (-1717.734) [-1713.167] (-1711.895) (-1708.838) * (-1708.266) [-1713.729] (-1715.012) (-1717.472) -- 0:00:58
693000 -- (-1710.237) (-1712.528) (-1707.437) [-1707.654] * [-1704.860] (-1712.190) (-1716.138) (-1712.753) -- 0:00:58
693500 -- (-1709.656) (-1711.099) [-1710.119] (-1711.311) * (-1713.867) (-1712.050) (-1710.218) [-1709.277] -- 0:00:57
694000 -- (-1708.423) (-1713.136) (-1709.342) [-1707.758] * [-1705.563] (-1711.074) (-1710.878) (-1713.301) -- 0:00:57
694500 -- (-1717.123) (-1711.736) [-1707.377] (-1708.590) * [-1707.935] (-1710.245) (-1709.275) (-1708.697) -- 0:00:58
695000 -- (-1715.358) (-1711.926) [-1712.650] (-1709.901) * [-1706.273] (-1709.449) (-1710.452) (-1709.824) -- 0:00:57
Average standard deviation of split frequencies: 0.005418
695500 -- [-1705.971] (-1723.056) (-1712.417) (-1715.936) * [-1709.919] (-1707.832) (-1712.440) (-1711.726) -- 0:00:57
696000 -- (-1711.409) (-1707.880) (-1719.187) [-1712.581] * (-1718.248) (-1709.136) [-1713.073] (-1713.095) -- 0:00:57
696500 -- (-1719.682) (-1710.375) (-1707.614) [-1710.118] * (-1710.574) [-1716.171] (-1709.192) (-1718.028) -- 0:00:57
697000 -- [-1711.444] (-1707.450) (-1714.728) (-1720.864) * (-1715.934) [-1716.044] (-1712.808) (-1719.150) -- 0:00:57
697500 -- (-1708.256) (-1716.600) [-1710.164] (-1713.336) * [-1715.621] (-1715.757) (-1708.254) (-1710.813) -- 0:00:57
698000 -- (-1715.560) [-1709.893] (-1707.712) (-1715.639) * (-1711.820) (-1710.701) [-1709.748] (-1708.605) -- 0:00:57
698500 -- (-1714.033) [-1710.245] (-1713.114) (-1713.352) * (-1712.348) (-1707.315) (-1718.780) [-1709.232] -- 0:00:56
699000 -- [-1709.257] (-1714.312) (-1710.398) (-1712.010) * (-1716.887) (-1713.750) (-1718.990) [-1710.917] -- 0:00:56
699500 -- (-1710.519) (-1712.117) (-1712.411) [-1705.696] * (-1708.805) (-1710.740) [-1708.528] (-1709.670) -- 0:00:57
700000 -- [-1710.605] (-1707.596) (-1710.631) (-1708.075) * (-1712.267) [-1709.784] (-1711.169) (-1717.413) -- 0:00:57
Average standard deviation of split frequencies: 0.004485
700500 -- (-1716.324) [-1706.587] (-1713.518) (-1712.407) * (-1708.309) [-1709.468] (-1720.341) (-1708.554) -- 0:00:56
701000 -- (-1711.639) [-1710.494] (-1712.578) (-1725.797) * (-1711.161) [-1709.295] (-1712.753) (-1717.782) -- 0:00:56
701500 -- (-1706.612) [-1713.910] (-1709.032) (-1713.024) * [-1712.388] (-1713.835) (-1721.027) (-1716.316) -- 0:00:56
702000 -- [-1708.317] (-1708.891) (-1709.584) (-1714.929) * (-1712.323) (-1709.407) [-1711.994] (-1715.694) -- 0:00:56
702500 -- (-1713.205) (-1706.872) [-1709.043] (-1713.780) * (-1707.810) (-1710.547) (-1713.863) [-1713.511] -- 0:00:56
703000 -- (-1716.600) (-1709.187) (-1717.904) [-1716.548] * [-1712.051] (-1711.136) (-1710.346) (-1709.574) -- 0:00:56
703500 -- (-1711.921) (-1711.515) [-1715.673] (-1710.000) * [-1715.147] (-1709.773) (-1715.892) (-1717.177) -- 0:00:56
704000 -- (-1712.047) [-1714.356] (-1712.987) (-1714.584) * (-1711.338) (-1709.506) [-1714.100] (-1714.079) -- 0:00:55
704500 -- (-1711.160) [-1715.174] (-1709.882) (-1719.952) * (-1713.554) (-1714.817) (-1706.249) [-1712.537] -- 0:00:55
705000 -- (-1712.534) [-1712.918] (-1715.513) (-1715.529) * [-1710.291] (-1709.644) (-1715.380) (-1708.623) -- 0:00:56
Average standard deviation of split frequencies: 0.003784
705500 -- (-1711.680) [-1711.481] (-1717.009) (-1720.195) * (-1715.921) (-1709.548) [-1710.142] (-1712.847) -- 0:00:55
706000 -- [-1713.095] (-1714.766) (-1713.758) (-1719.158) * (-1709.310) (-1706.571) [-1710.016] (-1710.167) -- 0:00:55
706500 -- (-1711.316) (-1716.404) (-1714.348) [-1710.280] * (-1709.381) (-1713.032) [-1709.381] (-1708.340) -- 0:00:55
707000 -- [-1710.136] (-1710.482) (-1714.587) (-1715.174) * (-1713.131) (-1712.354) [-1715.753] (-1712.312) -- 0:00:55
707500 -- (-1718.968) (-1715.446) (-1718.963) [-1710.145] * (-1713.009) [-1718.354] (-1705.805) (-1709.448) -- 0:00:55
708000 -- (-1707.826) (-1707.769) (-1711.213) [-1718.698] * (-1717.481) (-1720.555) [-1706.568] (-1708.595) -- 0:00:55
708500 -- (-1718.200) (-1712.053) [-1710.325] (-1711.828) * (-1718.023) (-1714.487) [-1710.863] (-1713.601) -- 0:00:55
709000 -- [-1710.116] (-1714.365) (-1707.561) (-1710.370) * (-1711.542) (-1712.231) (-1711.804) [-1707.027] -- 0:00:54
709500 -- (-1706.702) (-1719.937) (-1709.616) [-1706.167] * (-1717.903) [-1710.280] (-1705.961) (-1709.755) -- 0:00:54
710000 -- (-1707.171) (-1713.844) [-1713.331] (-1710.826) * (-1708.971) (-1709.377) (-1712.590) [-1714.041] -- 0:00:54
Average standard deviation of split frequencies: 0.004864
710500 -- [-1710.551] (-1707.916) (-1711.262) (-1710.022) * (-1717.745) [-1706.739] (-1713.741) (-1709.520) -- 0:00:55
711000 -- (-1717.201) [-1706.713] (-1719.521) (-1708.191) * (-1707.836) (-1709.458) (-1714.584) [-1715.647] -- 0:00:54
711500 -- (-1715.291) (-1709.159) [-1708.307] (-1714.182) * (-1712.976) (-1712.673) (-1712.393) [-1709.964] -- 0:00:54
712000 -- (-1715.273) (-1707.452) (-1713.183) [-1715.087] * (-1706.827) [-1707.829] (-1711.816) (-1707.948) -- 0:00:54
712500 -- (-1712.517) (-1707.002) (-1715.035) [-1712.099] * (-1710.225) (-1716.232) (-1709.560) [-1707.701] -- 0:00:54
713000 -- (-1709.802) (-1713.460) [-1713.946] (-1708.449) * (-1711.731) [-1711.350] (-1713.428) (-1707.975) -- 0:00:54
713500 -- [-1708.458] (-1714.102) (-1715.219) (-1710.374) * (-1706.150) (-1711.622) [-1709.622] (-1707.006) -- 0:00:54
714000 -- (-1708.434) [-1709.532] (-1706.993) (-1713.221) * (-1716.014) (-1707.185) (-1706.900) [-1720.811] -- 0:00:54
714500 -- (-1718.318) (-1712.585) [-1704.311] (-1709.912) * (-1719.531) (-1707.920) (-1705.977) [-1707.289] -- 0:00:53
715000 -- (-1714.681) (-1706.817) (-1706.879) [-1707.672] * [-1711.908] (-1707.916) (-1710.345) (-1716.213) -- 0:00:53
Average standard deviation of split frequencies: 0.006364
715500 -- (-1709.426) [-1711.503] (-1716.988) (-1711.117) * [-1708.315] (-1713.661) (-1709.794) (-1716.048) -- 0:00:54
716000 -- (-1711.444) [-1710.008] (-1710.491) (-1715.339) * [-1705.878] (-1706.115) (-1707.962) (-1712.653) -- 0:00:53
716500 -- [-1710.673] (-1713.666) (-1711.339) (-1711.049) * (-1710.345) (-1710.159) (-1708.280) [-1707.443] -- 0:00:53
717000 -- [-1711.226] (-1707.850) (-1711.037) (-1714.057) * [-1707.621] (-1708.822) (-1708.303) (-1714.920) -- 0:00:53
717500 -- (-1727.945) (-1712.160) [-1709.127] (-1721.545) * (-1710.627) (-1707.632) [-1707.961] (-1708.907) -- 0:00:53
718000 -- (-1712.650) (-1710.815) [-1710.325] (-1720.286) * (-1711.241) [-1708.965] (-1714.598) (-1714.103) -- 0:00:53
718500 -- (-1710.832) (-1714.198) [-1706.590] (-1717.058) * [-1711.373] (-1711.355) (-1727.397) (-1714.244) -- 0:00:53
719000 -- (-1711.022) [-1709.562] (-1714.726) (-1711.856) * (-1711.304) [-1714.930] (-1716.809) (-1712.732) -- 0:00:53
719500 -- (-1712.104) (-1711.026) (-1707.827) [-1709.181] * (-1717.278) (-1709.553) (-1713.336) [-1713.852] -- 0:00:53
720000 -- (-1708.723) [-1708.596] (-1709.248) (-1708.665) * [-1711.989] (-1711.844) (-1709.513) (-1714.134) -- 0:00:52
Average standard deviation of split frequencies: 0.006105
720500 -- (-1710.112) (-1709.195) (-1713.734) [-1708.259] * (-1712.788) [-1711.791] (-1715.689) (-1715.444) -- 0:00:52
721000 -- (-1712.238) (-1709.650) (-1712.225) [-1705.588] * (-1714.114) (-1716.003) (-1708.636) [-1707.020] -- 0:00:53
721500 -- (-1711.372) (-1710.200) [-1715.782] (-1713.174) * [-1713.460] (-1711.051) (-1709.957) (-1706.150) -- 0:00:52
722000 -- (-1711.307) (-1706.694) [-1716.206] (-1709.589) * (-1707.686) (-1716.532) [-1707.509] (-1708.972) -- 0:00:52
722500 -- [-1717.402] (-1713.544) (-1710.395) (-1712.449) * (-1713.812) (-1718.124) [-1717.876] (-1716.110) -- 0:00:52
723000 -- (-1714.099) (-1713.815) [-1712.557] (-1710.826) * (-1707.661) (-1712.666) [-1713.250] (-1707.973) -- 0:00:52
723500 -- (-1721.793) (-1713.234) [-1717.237] (-1714.346) * (-1711.874) [-1711.736] (-1716.178) (-1707.783) -- 0:00:52
724000 -- (-1708.769) [-1709.545] (-1708.376) (-1710.112) * (-1711.024) (-1714.995) (-1714.006) [-1711.424] -- 0:00:52
724500 -- (-1707.794) [-1710.338] (-1713.966) (-1711.882) * (-1711.355) [-1706.298] (-1728.333) (-1718.158) -- 0:00:52
725000 -- [-1706.103] (-1711.112) (-1714.260) (-1712.687) * (-1711.076) (-1709.021) [-1712.107] (-1708.665) -- 0:00:51
Average standard deviation of split frequencies: 0.004329
725500 -- (-1707.525) (-1706.674) (-1709.837) [-1714.325] * [-1716.347] (-1710.247) (-1721.922) (-1712.651) -- 0:00:51
726000 -- [-1710.549] (-1711.328) (-1714.037) (-1709.827) * (-1715.276) [-1708.043] (-1723.885) (-1704.389) -- 0:00:51
726500 -- [-1714.295] (-1708.549) (-1710.135) (-1710.094) * [-1709.726] (-1710.240) (-1719.403) (-1716.627) -- 0:00:51
727000 -- (-1710.478) (-1709.103) [-1714.029] (-1712.614) * (-1712.155) (-1714.785) (-1711.543) [-1707.524] -- 0:00:51
727500 -- (-1712.805) (-1715.642) (-1711.516) [-1712.481] * [-1708.988] (-1716.660) (-1714.066) (-1713.642) -- 0:00:51
728000 -- (-1718.204) (-1706.483) (-1709.513) [-1708.689] * (-1719.371) (-1716.793) (-1713.183) [-1711.936] -- 0:00:51
728500 -- (-1714.945) (-1713.435) (-1715.389) [-1710.973] * [-1709.383] (-1716.757) (-1717.531) (-1714.017) -- 0:00:51
729000 -- (-1714.275) (-1711.642) [-1712.760] (-1705.200) * (-1710.402) [-1707.408] (-1709.273) (-1716.212) -- 0:00:51
729500 -- (-1709.567) (-1714.588) [-1706.587] (-1714.252) * (-1711.934) (-1721.264) (-1705.931) [-1707.709] -- 0:00:51
730000 -- (-1714.398) (-1707.868) [-1707.624] (-1714.327) * (-1716.470) (-1712.163) (-1710.620) [-1708.757] -- 0:00:51
Average standard deviation of split frequencies: 0.004301
730500 -- (-1715.874) [-1708.894] (-1710.961) (-1707.764) * [-1707.925] (-1713.532) (-1710.456) (-1709.547) -- 0:00:50
731000 -- (-1713.457) (-1712.540) (-1715.480) [-1712.630] * (-1718.956) (-1710.089) (-1719.373) [-1708.500] -- 0:00:50
731500 -- (-1714.456) (-1714.222) [-1709.000] (-1715.378) * (-1715.723) (-1711.949) [-1711.008] (-1712.622) -- 0:00:51
732000 -- (-1721.392) (-1716.479) (-1717.370) [-1709.865] * (-1715.698) [-1715.748] (-1713.430) (-1708.560) -- 0:00:50
732500 -- (-1717.197) [-1709.060] (-1711.533) (-1711.858) * (-1713.643) (-1710.049) (-1718.418) [-1711.314] -- 0:00:50
733000 -- [-1717.634] (-1709.258) (-1713.049) (-1707.609) * (-1712.516) (-1710.251) (-1717.383) [-1710.929] -- 0:00:50
733500 -- (-1712.926) [-1717.027] (-1716.447) (-1717.671) * [-1712.846] (-1722.395) (-1709.540) (-1712.378) -- 0:00:50
734000 -- (-1714.127) (-1707.922) [-1714.236] (-1718.684) * (-1714.998) [-1714.310] (-1710.823) (-1711.780) -- 0:00:50
734500 -- (-1708.380) (-1715.479) (-1709.489) [-1708.319] * (-1722.692) (-1712.848) [-1715.534] (-1711.472) -- 0:00:50
735000 -- (-1712.718) (-1713.712) [-1708.295] (-1707.710) * (-1712.097) (-1712.871) (-1712.544) [-1710.317] -- 0:00:50
Average standard deviation of split frequencies: 0.003629
735500 -- [-1705.989] (-1714.682) (-1710.959) (-1722.041) * (-1712.876) [-1711.941] (-1711.514) (-1715.662) -- 0:00:49
736000 -- (-1711.505) (-1712.984) [-1708.007] (-1714.843) * (-1718.748) (-1710.490) (-1713.975) [-1709.465] -- 0:00:49
736500 -- (-1708.604) (-1712.884) (-1707.704) [-1709.582] * (-1718.337) (-1708.296) (-1707.514) [-1717.653] -- 0:00:49
737000 -- (-1717.625) (-1707.891) (-1712.446) [-1704.674] * (-1712.426) [-1711.422] (-1708.060) (-1708.949) -- 0:00:49
737500 -- [-1712.791] (-1712.461) (-1709.956) (-1709.205) * (-1723.160) [-1708.250] (-1705.280) (-1710.692) -- 0:00:49
738000 -- (-1714.995) [-1708.951] (-1713.856) (-1707.156) * (-1709.795) [-1708.393] (-1712.892) (-1710.054) -- 0:00:49
738500 -- (-1710.400) [-1712.152] (-1712.800) (-1709.551) * (-1714.773) [-1709.994] (-1710.238) (-1708.132) -- 0:00:49
739000 -- (-1715.537) (-1712.118) [-1706.712] (-1712.890) * (-1708.976) (-1710.244) [-1707.538] (-1705.923) -- 0:00:49
739500 -- [-1710.027] (-1713.222) (-1709.775) (-1712.887) * (-1712.731) [-1706.889] (-1710.099) (-1709.820) -- 0:00:49
740000 -- (-1707.802) (-1710.745) (-1716.489) [-1711.448] * (-1707.298) (-1715.546) [-1705.793] (-1709.416) -- 0:00:49
Average standard deviation of split frequencies: 0.004880
740500 -- [-1711.580] (-1710.291) (-1713.984) (-1713.103) * (-1706.410) [-1705.609] (-1707.844) (-1709.692) -- 0:00:49
741000 -- (-1714.794) (-1712.346) [-1712.678] (-1705.447) * (-1710.955) [-1706.379] (-1710.111) (-1709.424) -- 0:00:48
741500 -- [-1705.089] (-1712.427) (-1714.018) (-1710.661) * (-1712.561) (-1707.168) [-1713.638] (-1719.148) -- 0:00:48
742000 -- (-1712.763) (-1712.727) (-1712.790) [-1707.045] * [-1708.475] (-1708.574) (-1714.604) (-1712.969) -- 0:00:48
742500 -- (-1716.019) (-1710.649) [-1705.938] (-1717.318) * (-1710.634) [-1709.361] (-1711.376) (-1710.895) -- 0:00:48
743000 -- (-1705.263) (-1713.320) [-1707.409] (-1705.480) * [-1708.844] (-1708.910) (-1712.391) (-1710.707) -- 0:00:48
743500 -- [-1706.812] (-1715.285) (-1707.106) (-1712.727) * (-1711.212) (-1712.053) [-1710.123] (-1714.403) -- 0:00:48
744000 -- (-1711.111) (-1717.964) (-1711.238) [-1710.751] * (-1709.314) (-1711.446) [-1711.551] (-1721.840) -- 0:00:48
744500 -- (-1712.912) (-1715.548) (-1715.172) [-1708.861] * (-1708.483) [-1711.998] (-1708.604) (-1715.641) -- 0:00:48
745000 -- (-1719.250) (-1706.465) [-1712.799] (-1711.978) * [-1706.731] (-1714.500) (-1711.936) (-1718.588) -- 0:00:48
Average standard deviation of split frequencies: 0.004634
745500 -- (-1713.148) (-1713.069) [-1711.735] (-1710.348) * (-1715.623) (-1707.147) (-1712.851) [-1718.749] -- 0:00:48
746000 -- (-1707.365) (-1716.874) (-1711.340) [-1711.699] * (-1711.166) (-1712.322) [-1710.410] (-1708.811) -- 0:00:48
746500 -- [-1708.678] (-1707.977) (-1710.605) (-1711.712) * [-1710.387] (-1716.302) (-1714.699) (-1709.524) -- 0:00:47
747000 -- (-1706.879) [-1710.818] (-1710.451) (-1712.628) * (-1713.491) (-1710.675) (-1712.856) [-1708.621] -- 0:00:47
747500 -- [-1709.738] (-1711.935) (-1711.921) (-1711.613) * (-1713.063) [-1711.587] (-1711.083) (-1710.478) -- 0:00:47
748000 -- (-1712.557) (-1712.233) (-1711.719) [-1715.048] * [-1707.648] (-1710.684) (-1710.956) (-1708.522) -- 0:00:47
748500 -- (-1713.793) (-1715.709) (-1715.278) [-1708.208] * (-1714.104) (-1711.107) [-1707.243] (-1708.932) -- 0:00:47
749000 -- [-1707.817] (-1714.754) (-1707.911) (-1720.345) * (-1710.041) (-1711.642) (-1718.353) [-1708.659] -- 0:00:47
749500 -- (-1705.395) (-1717.331) [-1708.378] (-1709.623) * [-1709.297] (-1709.763) (-1710.883) (-1708.134) -- 0:00:47
750000 -- [-1712.602] (-1714.231) (-1707.464) (-1708.163) * (-1712.572) (-1709.402) (-1710.518) [-1705.729] -- 0:00:47
Average standard deviation of split frequencies: 0.004605
750500 -- (-1708.523) [-1711.287] (-1711.469) (-1709.646) * (-1712.946) (-1711.335) (-1712.670) [-1709.012] -- 0:00:47
751000 -- (-1713.154) (-1715.873) [-1711.833] (-1711.969) * [-1710.247] (-1709.803) (-1713.581) (-1716.363) -- 0:00:47
751500 -- (-1718.346) (-1717.269) [-1708.167] (-1711.560) * (-1710.160) (-1706.902) [-1713.419] (-1713.441) -- 0:00:46
752000 -- (-1710.773) (-1716.361) (-1706.624) [-1712.739] * (-1709.331) [-1707.766] (-1714.777) (-1713.734) -- 0:00:46
752500 -- (-1708.714) (-1710.391) (-1714.017) [-1710.009] * [-1710.839] (-1713.658) (-1714.855) (-1708.878) -- 0:00:46
753000 -- [-1710.512] (-1708.861) (-1710.953) (-1714.471) * (-1708.235) (-1717.715) [-1714.527] (-1713.234) -- 0:00:46
753500 -- (-1706.351) [-1711.389] (-1708.627) (-1713.795) * (-1712.641) (-1713.663) (-1715.152) [-1707.795] -- 0:00:46
754000 -- (-1709.212) (-1710.702) [-1709.144] (-1712.795) * (-1715.457) (-1717.444) [-1709.496] (-1716.846) -- 0:00:46
754500 -- (-1716.641) (-1707.067) [-1710.095] (-1711.213) * (-1708.318) (-1713.970) [-1713.035] (-1710.462) -- 0:00:46
755000 -- (-1711.159) (-1713.610) [-1707.362] (-1708.847) * (-1712.790) (-1707.670) (-1712.334) [-1712.883] -- 0:00:46
Average standard deviation of split frequencies: 0.005612
755500 -- (-1709.075) (-1715.046) [-1712.213] (-1714.925) * (-1713.305) [-1715.563] (-1712.964) (-1708.746) -- 0:00:46
756000 -- (-1707.423) (-1714.755) (-1719.749) [-1719.372] * (-1712.274) (-1714.142) [-1709.968] (-1711.665) -- 0:00:46
756500 -- [-1713.108] (-1717.889) (-1708.028) (-1717.241) * (-1711.095) (-1714.503) [-1709.180] (-1705.237) -- 0:00:46
757000 -- [-1709.355] (-1717.837) (-1713.549) (-1710.012) * (-1712.906) (-1709.975) (-1712.592) [-1708.148] -- 0:00:45
757500 -- [-1707.687] (-1714.123) (-1710.751) (-1717.637) * [-1713.954] (-1717.100) (-1711.763) (-1711.188) -- 0:00:45
758000 -- (-1707.409) (-1713.227) [-1713.293] (-1715.497) * (-1710.313) (-1716.523) [-1707.187] (-1709.800) -- 0:00:45
758500 -- (-1709.962) (-1717.337) [-1707.535] (-1712.975) * (-1709.448) (-1715.764) (-1708.832) [-1709.137] -- 0:00:45
759000 -- [-1711.338] (-1709.979) (-1707.146) (-1710.962) * [-1709.820] (-1707.255) (-1712.012) (-1709.252) -- 0:00:45
759500 -- (-1709.625) (-1709.879) [-1709.433] (-1713.887) * (-1710.342) (-1720.246) [-1721.641] (-1707.079) -- 0:00:45
760000 -- [-1713.174] (-1708.838) (-1711.053) (-1720.531) * (-1712.467) (-1711.305) [-1708.872] (-1707.356) -- 0:00:45
Average standard deviation of split frequencies: 0.006404
760500 -- (-1709.061) (-1709.516) [-1710.281] (-1711.742) * (-1711.585) [-1710.464] (-1709.146) (-1708.653) -- 0:00:45
761000 -- [-1709.197] (-1712.152) (-1704.199) (-1716.317) * (-1708.385) (-1709.573) (-1713.149) [-1708.327] -- 0:00:45
761500 -- [-1716.404] (-1711.204) (-1710.213) (-1716.943) * (-1714.620) [-1707.103] (-1709.494) (-1710.534) -- 0:00:45
762000 -- (-1715.452) (-1711.722) (-1705.038) [-1720.738] * [-1708.144] (-1709.485) (-1708.292) (-1707.817) -- 0:00:44
762500 -- (-1708.559) (-1711.079) (-1706.449) [-1714.629] * (-1709.955) (-1709.829) [-1707.302] (-1707.790) -- 0:00:44
763000 -- (-1713.265) (-1713.785) [-1712.867] (-1713.586) * [-1705.880] (-1713.679) (-1725.879) (-1708.166) -- 0:00:44
763500 -- (-1710.516) (-1708.961) (-1711.047) [-1711.204] * [-1709.454] (-1710.204) (-1712.640) (-1706.098) -- 0:00:44
764000 -- (-1708.751) [-1715.646] (-1718.240) (-1709.937) * (-1714.987) (-1711.886) (-1709.460) [-1714.149] -- 0:00:44
764500 -- [-1708.875] (-1716.286) (-1710.468) (-1711.701) * (-1715.883) (-1715.621) (-1709.987) [-1710.055] -- 0:00:44
765000 -- (-1715.174) (-1716.123) (-1710.242) [-1711.031] * (-1708.888) (-1710.232) [-1707.215] (-1707.257) -- 0:00:44
Average standard deviation of split frequencies: 0.006564
765500 -- [-1709.977] (-1710.803) (-1714.070) (-1710.384) * (-1707.446) (-1712.415) (-1710.017) [-1707.539] -- 0:00:44
766000 -- (-1714.277) (-1715.497) [-1710.428] (-1711.490) * (-1712.449) [-1716.856] (-1709.380) (-1711.753) -- 0:00:44
766500 -- (-1725.213) (-1712.041) [-1706.227] (-1709.321) * [-1709.853] (-1713.842) (-1715.665) (-1711.568) -- 0:00:44
767000 -- [-1714.350] (-1719.992) (-1711.191) (-1714.574) * (-1708.321) [-1714.769] (-1712.915) (-1715.315) -- 0:00:44
767500 -- (-1713.878) (-1713.970) (-1716.954) [-1714.301] * [-1710.629] (-1713.920) (-1715.147) (-1708.786) -- 0:00:43
768000 -- (-1710.022) (-1714.021) (-1711.220) [-1705.494] * [-1708.162] (-1710.820) (-1711.077) (-1712.213) -- 0:00:43
768500 -- (-1704.841) (-1715.098) (-1706.540) [-1704.956] * (-1709.047) [-1708.744] (-1718.482) (-1712.166) -- 0:00:43
769000 -- (-1710.041) [-1711.595] (-1710.302) (-1709.371) * [-1710.973] (-1718.297) (-1716.299) (-1710.835) -- 0:00:43
769500 -- (-1716.264) (-1712.091) [-1704.856] (-1711.936) * (-1713.082) [-1710.868] (-1716.312) (-1716.828) -- 0:00:43
770000 -- (-1709.122) [-1704.248] (-1708.870) (-1716.169) * (-1717.410) [-1707.182] (-1713.634) (-1718.680) -- 0:00:43
Average standard deviation of split frequencies: 0.007952
770500 -- [-1709.070] (-1707.812) (-1707.306) (-1719.732) * [-1712.007] (-1706.701) (-1723.789) (-1710.023) -- 0:00:43
771000 -- (-1714.890) (-1711.223) [-1708.388] (-1714.705) * (-1705.055) [-1714.661] (-1713.660) (-1708.727) -- 0:00:43
771500 -- (-1715.613) (-1710.398) [-1709.101] (-1715.164) * (-1719.698) (-1725.359) [-1706.126] (-1714.120) -- 0:00:43
772000 -- (-1710.629) [-1719.731] (-1712.334) (-1715.546) * (-1721.002) (-1729.076) [-1708.450] (-1710.434) -- 0:00:43
772500 -- [-1713.248] (-1708.535) (-1713.845) (-1716.707) * [-1714.192] (-1725.812) (-1711.286) (-1709.698) -- 0:00:42
773000 -- (-1724.396) [-1707.195] (-1712.699) (-1713.416) * (-1715.136) (-1720.078) [-1709.425] (-1710.160) -- 0:00:42
773500 -- (-1716.105) (-1708.481) (-1712.292) [-1707.601] * (-1713.215) (-1720.451) [-1711.120] (-1706.497) -- 0:00:42
774000 -- (-1719.531) (-1709.290) (-1709.773) [-1712.414] * (-1713.810) (-1716.129) (-1715.531) [-1716.182] -- 0:00:42
774500 -- (-1709.688) (-1712.750) (-1717.797) [-1713.116] * [-1711.705] (-1711.778) (-1712.929) (-1717.569) -- 0:00:42
775000 -- [-1713.133] (-1720.235) (-1714.833) (-1716.635) * (-1711.702) (-1714.766) [-1708.721] (-1711.777) -- 0:00:42
Average standard deviation of split frequencies: 0.007897
775500 -- (-1717.517) [-1715.444] (-1715.930) (-1711.574) * (-1706.662) [-1720.084] (-1709.621) (-1715.838) -- 0:00:42
776000 -- (-1718.031) (-1711.056) (-1707.063) [-1709.156] * [-1708.587] (-1714.358) (-1706.826) (-1711.649) -- 0:00:42
776500 -- (-1714.656) [-1710.473] (-1709.252) (-1709.809) * (-1713.186) (-1721.394) [-1711.943] (-1710.299) -- 0:00:42
777000 -- (-1710.671) (-1712.769) [-1705.221] (-1705.535) * [-1709.579] (-1712.551) (-1712.264) (-1709.673) -- 0:00:42
777500 -- (-1711.025) (-1714.563) (-1713.951) [-1704.858] * (-1714.524) (-1708.932) [-1712.183] (-1711.301) -- 0:00:42
778000 -- (-1707.345) [-1711.546] (-1713.391) (-1709.528) * (-1714.920) (-1710.865) (-1712.466) [-1711.141] -- 0:00:41
778500 -- (-1707.084) (-1713.326) [-1711.327] (-1709.347) * (-1713.750) [-1708.908] (-1707.466) (-1716.475) -- 0:00:41
779000 -- (-1711.406) (-1709.102) (-1707.608) [-1706.556] * (-1710.158) (-1711.548) (-1705.526) [-1707.868] -- 0:00:41
779500 -- (-1708.658) (-1713.772) [-1708.067] (-1711.428) * (-1711.599) (-1710.599) [-1704.216] (-1712.700) -- 0:00:41
780000 -- (-1707.827) [-1708.667] (-1717.260) (-1712.934) * (-1715.594) (-1715.190) [-1707.569] (-1716.221) -- 0:00:41
Average standard deviation of split frequencies: 0.006441
780500 -- [-1717.189] (-1708.990) (-1713.654) (-1708.854) * [-1708.762] (-1708.533) (-1706.371) (-1713.671) -- 0:00:41
781000 -- (-1710.817) [-1708.490] (-1713.830) (-1709.483) * (-1709.731) [-1709.359] (-1707.876) (-1709.255) -- 0:00:41
781500 -- [-1713.245] (-1717.138) (-1714.363) (-1714.965) * [-1715.309] (-1714.805) (-1709.980) (-1707.990) -- 0:00:41
782000 -- (-1710.896) (-1714.386) [-1713.503] (-1714.205) * (-1709.952) (-1709.602) [-1712.690] (-1708.938) -- 0:00:41
782500 -- (-1714.068) (-1718.796) (-1722.701) [-1712.509] * (-1709.058) [-1709.137] (-1708.771) (-1713.041) -- 0:00:41
783000 -- [-1711.780] (-1715.113) (-1718.905) (-1715.584) * (-1711.338) (-1705.254) (-1712.302) [-1711.174] -- 0:00:41
783500 -- (-1715.111) (-1709.371) (-1710.636) [-1708.842] * (-1705.534) (-1711.633) (-1712.135) [-1709.656] -- 0:00:40
784000 -- (-1711.989) [-1712.117] (-1709.700) (-1716.101) * (-1711.083) (-1711.031) [-1713.211] (-1706.735) -- 0:00:40
784500 -- (-1719.901) [-1711.149] (-1709.310) (-1719.179) * (-1714.108) [-1713.579] (-1711.548) (-1711.450) -- 0:00:40
785000 -- (-1723.733) [-1710.500] (-1717.831) (-1711.291) * (-1706.513) (-1710.552) [-1712.981] (-1715.608) -- 0:00:40
Average standard deviation of split frequencies: 0.006397
785500 -- (-1723.469) (-1711.522) (-1715.862) [-1712.182] * (-1708.565) (-1709.493) [-1716.205] (-1711.163) -- 0:00:40
786000 -- (-1713.142) (-1716.398) [-1704.847] (-1713.992) * (-1713.553) [-1709.131] (-1714.647) (-1710.722) -- 0:00:40
786500 -- [-1708.489] (-1721.837) (-1707.388) (-1717.327) * [-1710.176] (-1712.214) (-1707.354) (-1713.422) -- 0:00:40
787000 -- (-1708.382) [-1714.272] (-1711.803) (-1708.025) * (-1718.350) (-1715.212) (-1709.956) [-1713.479] -- 0:00:40
787500 -- [-1706.862] (-1713.325) (-1710.027) (-1709.495) * (-1711.691) [-1712.142] (-1712.220) (-1709.530) -- 0:00:40
788000 -- (-1711.754) (-1714.826) [-1713.749] (-1714.338) * (-1708.059) (-1705.416) (-1714.148) [-1710.738] -- 0:00:40
788500 -- [-1706.548] (-1712.047) (-1705.664) (-1711.279) * (-1708.500) (-1717.300) (-1713.073) [-1713.487] -- 0:00:39
789000 -- (-1712.616) (-1709.162) (-1707.739) [-1713.704] * (-1712.440) (-1721.757) (-1709.732) [-1706.396] -- 0:00:39
789500 -- (-1709.295) (-1716.636) (-1709.160) [-1712.879] * (-1713.649) (-1708.737) [-1714.567] (-1717.023) -- 0:00:39
790000 -- (-1708.195) (-1707.192) (-1711.956) [-1710.607] * (-1722.674) (-1705.452) (-1710.844) [-1710.836] -- 0:00:39
Average standard deviation of split frequencies: 0.006360
790500 -- (-1709.428) [-1711.583] (-1717.913) (-1713.421) * (-1715.618) (-1709.480) [-1707.089] (-1707.947) -- 0:00:39
791000 -- (-1710.524) (-1716.990) [-1711.110] (-1711.379) * (-1714.179) (-1707.822) [-1713.215] (-1714.136) -- 0:00:39
791500 -- (-1711.609) (-1712.265) [-1710.340] (-1706.483) * [-1705.616] (-1710.431) (-1716.173) (-1711.029) -- 0:00:39
792000 -- (-1713.332) (-1709.491) [-1706.215] (-1708.499) * (-1713.380) [-1713.383] (-1713.458) (-1710.198) -- 0:00:39
792500 -- [-1711.219] (-1717.006) (-1707.782) (-1703.455) * (-1715.108) (-1710.968) [-1707.049] (-1706.843) -- 0:00:39
793000 -- (-1714.551) (-1707.784) [-1707.441] (-1711.452) * (-1722.119) (-1714.665) [-1706.044] (-1710.595) -- 0:00:39
793500 -- (-1716.464) (-1708.853) [-1712.135] (-1710.054) * (-1715.333) [-1712.863] (-1709.585) (-1720.357) -- 0:00:39
794000 -- (-1710.719) (-1713.071) [-1707.796] (-1711.100) * (-1708.758) [-1710.981] (-1709.687) (-1715.469) -- 0:00:38
794500 -- [-1709.017] (-1718.175) (-1708.921) (-1711.309) * (-1707.454) (-1711.434) (-1710.240) [-1705.672] -- 0:00:38
795000 -- (-1708.499) (-1709.775) [-1705.257] (-1708.616) * (-1717.527) (-1714.305) [-1712.548] (-1709.132) -- 0:00:38
Average standard deviation of split frequencies: 0.006514
795500 -- (-1714.220) (-1707.781) [-1713.998] (-1711.397) * [-1710.144] (-1716.914) (-1710.004) (-1714.314) -- 0:00:38
796000 -- (-1717.820) (-1725.202) [-1708.001] (-1712.175) * [-1706.438] (-1711.246) (-1710.074) (-1712.983) -- 0:00:38
796500 -- [-1710.869] (-1709.619) (-1715.923) (-1714.613) * [-1709.489] (-1711.072) (-1712.170) (-1711.395) -- 0:00:38
797000 -- [-1708.902] (-1720.012) (-1711.688) (-1716.160) * (-1712.824) (-1710.748) [-1709.356] (-1710.952) -- 0:00:38
797500 -- [-1710.122] (-1709.184) (-1706.532) (-1706.598) * [-1706.291] (-1707.893) (-1709.531) (-1708.489) -- 0:00:38
798000 -- (-1707.538) [-1712.675] (-1712.723) (-1711.981) * (-1723.554) (-1706.428) (-1717.749) [-1707.269] -- 0:00:38
798500 -- (-1713.982) [-1711.701] (-1711.285) (-1720.695) * (-1720.241) (-1708.943) [-1710.843] (-1716.436) -- 0:00:38
799000 -- (-1710.752) [-1716.620] (-1720.321) (-1709.694) * (-1713.615) (-1710.487) (-1720.408) [-1709.007] -- 0:00:37
799500 -- (-1707.766) [-1712.734] (-1721.938) (-1708.805) * (-1711.378) (-1709.143) [-1705.503] (-1709.123) -- 0:00:37
800000 -- (-1705.875) (-1710.623) (-1713.695) [-1712.485] * (-1711.423) [-1711.633] (-1710.774) (-1707.362) -- 0:00:37
Average standard deviation of split frequencies: 0.006476
800500 -- [-1710.935] (-1709.093) (-1707.561) (-1708.937) * [-1713.473] (-1706.965) (-1712.262) (-1711.098) -- 0:00:37
801000 -- (-1711.885) (-1706.999) (-1709.576) [-1712.742] * (-1719.919) (-1711.011) (-1714.816) [-1708.273] -- 0:00:37
801500 -- (-1714.764) [-1710.010] (-1715.796) (-1708.908) * [-1710.142] (-1710.778) (-1709.446) (-1712.005) -- 0:00:37
802000 -- (-1712.700) (-1708.873) (-1715.381) [-1706.673] * (-1708.350) (-1707.259) [-1712.139] (-1711.202) -- 0:00:37
802500 -- (-1711.104) (-1712.791) (-1720.652) [-1707.620] * [-1708.729] (-1707.522) (-1708.891) (-1713.859) -- 0:00:37
803000 -- (-1717.009) (-1710.745) [-1712.876] (-1711.574) * (-1711.209) (-1708.871) [-1708.176] (-1712.646) -- 0:00:37
803500 -- (-1712.041) [-1710.673] (-1714.454) (-1708.066) * (-1712.240) (-1709.592) [-1708.582] (-1713.655) -- 0:00:37
804000 -- (-1710.115) (-1712.060) [-1710.279] (-1718.703) * (-1724.275) (-1707.837) (-1711.759) [-1715.757] -- 0:00:37
804500 -- [-1711.123] (-1709.967) (-1715.052) (-1713.045) * (-1709.403) (-1716.153) (-1713.160) [-1710.478] -- 0:00:36
805000 -- (-1710.124) (-1707.425) (-1715.837) [-1712.128] * (-1713.642) (-1722.691) [-1708.553] (-1710.810) -- 0:00:36
Average standard deviation of split frequencies: 0.007018
805500 -- [-1707.112] (-1706.782) (-1709.610) (-1710.979) * (-1715.211) [-1707.800] (-1710.621) (-1706.450) -- 0:00:36
806000 -- (-1710.667) [-1710.489] (-1712.672) (-1709.489) * (-1714.136) [-1715.711] (-1706.905) (-1708.651) -- 0:00:36
806500 -- (-1708.446) (-1715.359) (-1710.264) [-1708.091] * (-1716.489) (-1710.242) (-1709.112) [-1717.949] -- 0:00:36
807000 -- (-1710.768) (-1715.027) [-1710.929] (-1711.565) * (-1709.853) (-1710.595) [-1709.693] (-1710.544) -- 0:00:36
807500 -- (-1717.693) (-1722.457) (-1711.512) [-1716.458] * (-1710.045) [-1710.543] (-1708.519) (-1706.165) -- 0:00:36
808000 -- (-1713.519) (-1717.346) [-1712.797] (-1714.613) * (-1717.541) [-1706.053] (-1714.471) (-1706.047) -- 0:00:36
808500 -- [-1706.988] (-1711.627) (-1709.490) (-1719.187) * (-1710.354) [-1706.644] (-1712.609) (-1713.357) -- 0:00:36
809000 -- (-1712.724) (-1711.479) [-1712.067] (-1710.360) * (-1710.596) (-1709.706) [-1715.651] (-1721.622) -- 0:00:36
809500 -- [-1713.953] (-1718.705) (-1708.191) (-1706.810) * [-1711.172] (-1710.015) (-1713.483) (-1707.517) -- 0:00:36
810000 -- (-1715.146) (-1717.492) [-1709.595] (-1712.211) * (-1712.214) [-1709.656] (-1719.721) (-1709.000) -- 0:00:35
Average standard deviation of split frequencies: 0.007560
810500 -- (-1708.960) (-1716.596) (-1707.260) [-1709.801] * [-1708.245] (-1710.659) (-1717.889) (-1707.115) -- 0:00:35
811000 -- (-1708.163) (-1714.054) [-1708.716] (-1714.896) * (-1715.430) (-1709.361) (-1718.805) [-1714.306] -- 0:00:35
811500 -- (-1713.667) [-1707.935] (-1708.432) (-1717.445) * (-1710.258) [-1708.085] (-1724.911) (-1713.006) -- 0:00:35
812000 -- [-1706.892] (-1711.310) (-1711.698) (-1710.156) * (-1717.893) (-1710.121) [-1710.959] (-1708.542) -- 0:00:35
812500 -- (-1711.844) (-1719.126) [-1714.664] (-1716.700) * (-1707.786) [-1709.176] (-1710.710) (-1709.008) -- 0:00:35
813000 -- (-1709.503) (-1708.258) [-1709.344] (-1716.936) * [-1709.289] (-1718.341) (-1716.790) (-1710.447) -- 0:00:35
813500 -- [-1709.531] (-1713.867) (-1708.150) (-1708.753) * (-1721.035) (-1713.784) (-1708.726) [-1707.171] -- 0:00:35
814000 -- (-1712.555) (-1707.512) (-1710.952) [-1713.742] * (-1719.332) (-1708.409) [-1714.217] (-1710.634) -- 0:00:35
814500 -- [-1712.183] (-1709.403) (-1712.165) (-1718.506) * (-1711.284) (-1711.378) [-1707.933] (-1717.837) -- 0:00:35
815000 -- [-1717.407] (-1710.123) (-1711.661) (-1708.019) * (-1718.676) (-1706.969) (-1713.653) [-1707.017] -- 0:00:34
Average standard deviation of split frequencies: 0.006740
815500 -- [-1710.185] (-1709.219) (-1712.178) (-1716.741) * (-1713.869) (-1709.605) [-1710.772] (-1714.268) -- 0:00:34
816000 -- (-1714.101) [-1707.375] (-1712.114) (-1713.022) * (-1714.837) (-1715.556) (-1706.930) [-1708.318] -- 0:00:34
816500 -- (-1708.119) (-1716.002) [-1715.287] (-1717.971) * [-1706.182] (-1710.781) (-1714.480) (-1708.307) -- 0:00:34
817000 -- [-1706.735] (-1709.697) (-1716.908) (-1717.239) * [-1708.228] (-1711.571) (-1710.649) (-1714.193) -- 0:00:34
817500 -- (-1715.483) (-1709.866) [-1708.906] (-1711.298) * (-1710.941) [-1706.799] (-1713.894) (-1713.587) -- 0:00:34
818000 -- (-1712.532) (-1711.016) [-1712.966] (-1710.818) * (-1708.448) (-1710.749) (-1712.375) [-1707.647] -- 0:00:34
818500 -- (-1712.065) (-1710.498) [-1707.866] (-1712.989) * (-1712.358) (-1714.029) (-1712.426) [-1711.362] -- 0:00:34
819000 -- (-1713.565) (-1705.938) [-1705.773] (-1720.406) * [-1705.626] (-1710.595) (-1709.130) (-1722.997) -- 0:00:34
819500 -- [-1712.947] (-1718.234) (-1710.933) (-1716.126) * (-1711.211) (-1714.474) (-1717.740) [-1710.673] -- 0:00:34
820000 -- (-1709.935) [-1710.520] (-1713.504) (-1709.758) * [-1711.463] (-1708.379) (-1710.139) (-1719.482) -- 0:00:34
Average standard deviation of split frequencies: 0.005936
820500 -- (-1709.197) (-1720.098) (-1713.090) [-1708.238] * (-1713.088) (-1710.174) (-1714.637) [-1711.348] -- 0:00:33
821000 -- [-1711.357] (-1715.609) (-1711.826) (-1709.361) * [-1718.913] (-1710.782) (-1715.878) (-1718.323) -- 0:00:33
821500 -- (-1712.604) (-1709.607) [-1710.086] (-1712.500) * (-1709.544) [-1710.648] (-1709.587) (-1711.463) -- 0:00:33
822000 -- (-1716.229) [-1711.844] (-1713.966) (-1713.287) * (-1710.574) [-1709.443] (-1706.544) (-1716.767) -- 0:00:33
822500 -- (-1713.008) (-1712.428) [-1712.074] (-1712.850) * (-1707.488) (-1709.102) (-1710.676) [-1710.931] -- 0:00:33
823000 -- (-1713.995) (-1711.795) (-1711.236) [-1711.858] * (-1714.123) [-1709.295] (-1713.804) (-1710.440) -- 0:00:33
823500 -- [-1716.593] (-1713.340) (-1718.661) (-1711.806) * (-1727.458) (-1714.802) (-1710.966) [-1708.274] -- 0:00:33
824000 -- (-1714.418) [-1712.759] (-1709.972) (-1710.029) * (-1713.232) (-1706.479) [-1709.614] (-1716.382) -- 0:00:33
824500 -- [-1709.417] (-1710.235) (-1711.121) (-1705.221) * (-1717.027) [-1708.344] (-1706.797) (-1713.572) -- 0:00:33
825000 -- (-1716.886) [-1712.314] (-1710.929) (-1711.836) * (-1715.270) (-1706.806) [-1706.366] (-1712.977) -- 0:00:33
Average standard deviation of split frequencies: 0.005707
825500 -- [-1709.510] (-1717.639) (-1711.756) (-1713.925) * (-1716.355) (-1710.636) [-1710.977] (-1706.460) -- 0:00:32
826000 -- (-1710.906) [-1708.102] (-1714.148) (-1710.618) * (-1714.720) [-1710.367] (-1707.071) (-1708.763) -- 0:00:32
826500 -- (-1712.109) (-1721.318) (-1714.485) [-1710.609] * (-1711.248) (-1713.195) (-1710.308) [-1714.955] -- 0:00:32
827000 -- (-1713.433) [-1711.179] (-1719.384) (-1706.316) * [-1705.419] (-1712.580) (-1715.003) (-1711.520) -- 0:00:32
827500 -- (-1711.288) (-1713.107) [-1718.328] (-1708.700) * (-1712.078) (-1716.688) (-1708.069) [-1709.472] -- 0:00:32
828000 -- (-1711.272) [-1711.585] (-1708.379) (-1709.448) * (-1713.475) [-1717.222] (-1712.973) (-1709.849) -- 0:00:32
828500 -- (-1713.332) (-1710.640) [-1710.604] (-1713.384) * (-1714.496) (-1715.026) [-1716.046] (-1711.944) -- 0:00:32
829000 -- (-1716.056) [-1711.518] (-1712.648) (-1711.897) * (-1712.326) [-1713.504] (-1709.735) (-1712.011) -- 0:00:32
829500 -- (-1713.551) [-1712.467] (-1713.846) (-1716.777) * (-1713.440) (-1710.685) (-1707.123) [-1711.377] -- 0:00:32
830000 -- [-1718.344] (-1711.878) (-1707.632) (-1709.134) * (-1717.651) (-1708.458) [-1709.069] (-1716.198) -- 0:00:32
Average standard deviation of split frequencies: 0.006053
830500 -- (-1717.125) [-1712.236] (-1707.201) (-1707.176) * (-1711.019) (-1709.479) [-1715.468] (-1705.856) -- 0:00:32
831000 -- (-1713.923) (-1717.667) (-1709.806) [-1709.180] * [-1719.195] (-1707.693) (-1710.232) (-1708.225) -- 0:00:31
831500 -- [-1714.179] (-1713.167) (-1708.751) (-1713.247) * (-1715.893) (-1709.559) (-1715.336) [-1715.456] -- 0:00:31
832000 -- [-1709.019] (-1707.899) (-1707.897) (-1708.228) * (-1705.471) (-1709.465) [-1714.781] (-1711.044) -- 0:00:31
832500 -- (-1712.889) [-1709.629] (-1707.772) (-1715.916) * (-1709.774) (-1712.774) (-1714.824) [-1710.637] -- 0:00:31
833000 -- [-1709.134] (-1711.456) (-1711.265) (-1712.867) * (-1708.666) (-1709.318) [-1708.644] (-1713.724) -- 0:00:31
833500 -- [-1706.958] (-1711.019) (-1713.270) (-1713.295) * (-1712.127) (-1709.361) [-1712.969] (-1710.378) -- 0:00:31
834000 -- (-1708.931) [-1708.497] (-1713.518) (-1713.148) * [-1709.457] (-1711.881) (-1711.428) (-1709.694) -- 0:00:31
834500 -- [-1712.932] (-1709.491) (-1714.058) (-1706.538) * [-1716.354] (-1711.510) (-1706.781) (-1710.836) -- 0:00:31
835000 -- (-1716.826) [-1711.242] (-1709.319) (-1717.942) * (-1713.038) (-1712.369) [-1710.070] (-1709.320) -- 0:00:31
Average standard deviation of split frequencies: 0.005827
835500 -- (-1714.812) (-1713.494) (-1709.549) [-1712.164] * (-1714.863) (-1714.285) (-1706.713) [-1708.275] -- 0:00:31
836000 -- [-1709.507] (-1711.704) (-1716.535) (-1707.260) * (-1713.380) (-1718.527) [-1712.748] (-1714.620) -- 0:00:30
836500 -- [-1709.059] (-1709.016) (-1721.243) (-1706.673) * (-1721.400) (-1710.710) [-1711.392] (-1709.684) -- 0:00:30
837000 -- (-1708.735) [-1709.479] (-1719.064) (-1714.112) * [-1713.797] (-1713.339) (-1707.420) (-1714.739) -- 0:00:30
837500 -- (-1707.930) [-1713.494] (-1718.904) (-1712.760) * (-1708.978) (-1716.784) [-1704.614] (-1710.076) -- 0:00:30
838000 -- (-1709.872) [-1715.858] (-1712.433) (-1711.825) * (-1706.627) (-1718.084) (-1708.945) [-1715.314] -- 0:00:30
838500 -- (-1717.265) (-1713.306) [-1713.716] (-1720.463) * (-1711.791) [-1709.308] (-1708.057) (-1709.669) -- 0:00:30
839000 -- (-1715.302) [-1710.043] (-1712.962) (-1715.191) * (-1706.936) [-1712.857] (-1710.675) (-1709.865) -- 0:00:30
839500 -- (-1715.262) [-1711.250] (-1714.423) (-1709.413) * (-1712.839) (-1706.590) (-1716.571) [-1707.167] -- 0:00:30
840000 -- [-1707.379] (-1709.768) (-1712.279) (-1716.784) * [-1711.709] (-1711.936) (-1709.046) (-1724.408) -- 0:00:30
Average standard deviation of split frequencies: 0.006542
840500 -- [-1710.945] (-1707.886) (-1717.381) (-1715.131) * (-1710.864) (-1710.082) [-1712.128] (-1714.896) -- 0:00:30
841000 -- [-1711.322] (-1706.158) (-1726.308) (-1715.166) * (-1714.050) (-1711.820) [-1711.380] (-1709.778) -- 0:00:30
841500 -- (-1712.307) [-1704.413] (-1715.347) (-1713.267) * (-1710.310) (-1709.418) (-1718.190) [-1711.386] -- 0:00:29
842000 -- (-1719.816) [-1710.746] (-1707.993) (-1710.242) * (-1712.105) [-1713.435] (-1715.186) (-1712.629) -- 0:00:29
842500 -- (-1718.700) [-1711.326] (-1712.897) (-1708.634) * [-1710.969] (-1713.476) (-1716.200) (-1715.747) -- 0:00:29
843000 -- [-1706.222] (-1708.108) (-1715.026) (-1708.893) * [-1712.190] (-1716.501) (-1710.299) (-1708.352) -- 0:00:29
843500 -- (-1710.244) (-1709.329) [-1719.309] (-1721.807) * (-1719.579) [-1715.085] (-1708.881) (-1712.618) -- 0:00:29
844000 -- (-1709.346) (-1710.484) (-1713.430) [-1711.410] * (-1708.448) (-1709.513) (-1709.214) [-1706.167] -- 0:00:29
844500 -- (-1716.116) (-1714.224) [-1711.971] (-1714.554) * (-1716.074) [-1708.033] (-1709.952) (-1711.221) -- 0:00:29
845000 -- (-1709.338) [-1708.421] (-1708.955) (-1714.464) * (-1713.254) (-1712.157) [-1719.410] (-1706.471) -- 0:00:29
Average standard deviation of split frequencies: 0.006501
845500 -- (-1713.021) (-1709.882) [-1707.970] (-1709.055) * (-1714.192) (-1713.746) (-1720.938) [-1710.435] -- 0:00:29
846000 -- (-1716.290) (-1714.352) (-1709.744) [-1708.965] * [-1715.311] (-1708.561) (-1711.942) (-1709.921) -- 0:00:29
846500 -- (-1713.121) (-1714.828) [-1710.998] (-1709.747) * [-1710.499] (-1713.836) (-1709.579) (-1709.854) -- 0:00:29
847000 -- (-1714.732) (-1711.579) [-1710.198] (-1710.309) * (-1710.696) [-1711.121] (-1712.853) (-1709.977) -- 0:00:28
847500 -- (-1711.561) (-1714.711) (-1708.578) [-1709.835] * (-1710.769) (-1706.656) [-1709.925] (-1708.284) -- 0:00:28
848000 -- [-1705.868] (-1713.435) (-1711.164) (-1713.824) * (-1708.453) (-1710.410) (-1712.062) [-1715.725] -- 0:00:28
848500 -- [-1711.962] (-1708.534) (-1717.694) (-1712.009) * (-1715.703) [-1710.993] (-1716.648) (-1711.939) -- 0:00:28
849000 -- (-1715.533) (-1715.507) (-1718.874) [-1711.732] * (-1715.106) (-1713.394) (-1714.332) [-1712.971] -- 0:00:28
849500 -- (-1714.183) [-1709.725] (-1710.987) (-1716.305) * (-1717.360) (-1717.973) [-1706.809] (-1712.122) -- 0:00:28
850000 -- (-1714.403) (-1718.042) (-1709.465) [-1714.495] * (-1714.523) (-1714.444) [-1705.723] (-1708.332) -- 0:00:28
Average standard deviation of split frequencies: 0.006465
850500 -- (-1709.883) [-1710.443] (-1706.164) (-1715.407) * [-1710.191] (-1716.606) (-1714.198) (-1709.981) -- 0:00:28
851000 -- (-1711.689) (-1713.871) [-1710.468] (-1706.516) * (-1717.469) (-1712.138) [-1717.660] (-1711.465) -- 0:00:28
851500 -- (-1711.340) [-1709.050] (-1716.244) (-1713.606) * (-1712.048) (-1713.610) (-1710.581) [-1717.633] -- 0:00:28
852000 -- (-1706.348) (-1709.102) [-1713.824] (-1709.824) * (-1711.767) (-1715.999) (-1711.258) [-1715.233] -- 0:00:27
852500 -- (-1710.394) [-1707.633] (-1709.881) (-1713.263) * (-1706.441) (-1712.306) [-1714.034] (-1712.025) -- 0:00:27
853000 -- (-1707.987) (-1713.108) (-1710.378) [-1715.825] * (-1711.038) [-1707.859] (-1718.816) (-1718.482) -- 0:00:27
853500 -- (-1705.064) (-1708.384) [-1710.200] (-1722.943) * (-1713.530) (-1714.102) (-1715.199) [-1708.423] -- 0:00:27
854000 -- (-1707.623) (-1707.740) (-1718.717) [-1710.395] * (-1707.862) [-1709.080] (-1717.514) (-1714.917) -- 0:00:27
854500 -- (-1714.413) [-1715.071] (-1715.323) (-1710.818) * (-1709.791) (-1718.851) (-1708.692) [-1711.283] -- 0:00:27
855000 -- (-1706.750) (-1721.104) (-1711.432) [-1712.745] * [-1709.631] (-1711.738) (-1706.949) (-1717.303) -- 0:00:27
Average standard deviation of split frequencies: 0.006425
855500 -- (-1708.841) (-1712.684) [-1715.634] (-1717.477) * (-1709.374) [-1707.584] (-1706.773) (-1711.498) -- 0:00:27
856000 -- (-1708.897) (-1707.912) [-1705.458] (-1713.640) * [-1706.410] (-1720.355) (-1711.875) (-1715.544) -- 0:00:27
856500 -- [-1710.063] (-1714.969) (-1711.989) (-1714.533) * (-1711.988) [-1717.296] (-1713.809) (-1715.668) -- 0:00:27
857000 -- (-1716.839) (-1705.125) [-1712.328] (-1712.117) * (-1715.646) (-1710.332) [-1708.720] (-1709.918) -- 0:00:27
857500 -- (-1714.849) (-1712.894) [-1707.047] (-1710.336) * (-1713.890) (-1710.709) (-1717.784) [-1709.569] -- 0:00:26
858000 -- (-1710.769) (-1710.789) [-1712.590] (-1710.162) * (-1709.743) (-1709.633) (-1706.075) [-1709.003] -- 0:00:26
858500 -- [-1707.592] (-1710.695) (-1711.456) (-1710.884) * (-1709.492) (-1717.450) [-1709.288] (-1720.101) -- 0:00:26
859000 -- [-1708.154] (-1712.013) (-1713.706) (-1714.565) * (-1719.280) (-1710.070) (-1705.780) [-1708.741] -- 0:00:26
859500 -- (-1712.299) (-1714.748) (-1708.682) [-1711.648] * (-1715.036) [-1709.314] (-1711.349) (-1714.856) -- 0:00:26
860000 -- (-1709.548) (-1715.386) (-1713.295) [-1712.526] * (-1709.680) [-1706.470] (-1710.930) (-1706.350) -- 0:00:26
Average standard deviation of split frequencies: 0.005842
860500 -- [-1712.557] (-1710.317) (-1712.520) (-1718.093) * (-1710.874) [-1711.798] (-1717.071) (-1710.680) -- 0:00:26
861000 -- (-1707.754) (-1710.946) (-1707.675) [-1708.843] * (-1716.576) (-1709.091) (-1713.962) [-1707.131] -- 0:00:26
861500 -- (-1710.631) (-1714.690) [-1706.418] (-1709.043) * (-1717.532) (-1708.161) [-1722.165] (-1707.180) -- 0:00:26
862000 -- (-1712.003) [-1711.610] (-1706.196) (-1707.373) * (-1716.928) [-1712.385] (-1711.209) (-1715.705) -- 0:00:26
862500 -- (-1707.838) (-1712.261) (-1712.196) [-1706.946] * [-1717.968] (-1709.124) (-1711.886) (-1706.318) -- 0:00:25
863000 -- (-1711.111) (-1706.712) (-1707.579) [-1707.621] * (-1710.640) (-1710.321) (-1716.200) [-1707.158] -- 0:00:25
863500 -- (-1714.944) (-1712.383) [-1714.661] (-1709.481) * (-1706.731) (-1715.477) [-1709.431] (-1712.421) -- 0:00:25
864000 -- (-1714.356) (-1713.237) (-1717.155) [-1711.963] * (-1720.453) (-1709.246) [-1709.166] (-1710.782) -- 0:00:25
864500 -- (-1709.069) (-1711.199) [-1707.488] (-1710.493) * (-1708.477) [-1720.146] (-1710.472) (-1715.258) -- 0:00:25
865000 -- (-1711.616) (-1712.988) (-1709.332) [-1715.403] * (-1712.409) (-1719.739) [-1710.902] (-1709.802) -- 0:00:25
Average standard deviation of split frequencies: 0.004536
865500 -- (-1708.149) (-1714.337) (-1713.400) [-1711.176] * (-1715.529) [-1713.627] (-1713.572) (-1721.132) -- 0:00:25
866000 -- (-1714.198) (-1714.571) [-1715.040] (-1716.407) * (-1712.950) (-1709.825) [-1711.183] (-1713.845) -- 0:00:25
866500 -- (-1719.373) (-1716.668) [-1714.729] (-1711.476) * (-1712.561) (-1706.190) [-1712.337] (-1708.361) -- 0:00:25
867000 -- [-1708.631] (-1712.036) (-1710.488) (-1711.188) * (-1713.033) (-1713.127) [-1713.187] (-1710.898) -- 0:00:25
867500 -- (-1712.230) (-1713.376) [-1712.813] (-1709.829) * (-1709.739) (-1720.636) (-1712.759) [-1712.299] -- 0:00:25
868000 -- (-1709.934) (-1719.281) [-1709.021] (-1715.761) * (-1709.266) (-1709.507) (-1715.527) [-1711.516] -- 0:00:24
868500 -- [-1707.933] (-1715.211) (-1715.543) (-1715.349) * (-1717.331) (-1710.813) [-1708.746] (-1709.355) -- 0:00:24
869000 -- (-1715.921) (-1719.747) [-1713.020] (-1707.146) * (-1714.085) [-1705.620] (-1718.095) (-1709.365) -- 0:00:24
869500 -- (-1712.705) (-1713.298) [-1717.069] (-1712.763) * (-1710.806) (-1713.556) [-1712.343] (-1712.621) -- 0:00:24
870000 -- (-1716.316) [-1709.523] (-1707.909) (-1719.692) * (-1714.140) (-1713.433) [-1712.763] (-1710.027) -- 0:00:24
Average standard deviation of split frequencies: 0.004873
870500 -- (-1714.084) [-1707.471] (-1708.462) (-1710.060) * (-1717.775) (-1713.684) (-1710.865) [-1710.849] -- 0:00:24
871000 -- (-1707.930) [-1709.635] (-1708.601) (-1717.544) * [-1711.940] (-1720.927) (-1706.099) (-1712.105) -- 0:00:24
871500 -- (-1707.614) [-1708.849] (-1707.974) (-1718.805) * (-1709.269) (-1718.495) (-1707.880) [-1716.492] -- 0:00:24
872000 -- (-1719.297) (-1712.551) (-1708.781) [-1710.690] * (-1711.221) [-1707.285] (-1708.843) (-1708.037) -- 0:00:24
872500 -- (-1715.686) (-1714.480) (-1710.069) [-1709.612] * [-1710.053] (-1709.479) (-1717.674) (-1710.366) -- 0:00:24
873000 -- (-1713.867) (-1713.102) (-1712.576) [-1713.079] * (-1722.193) [-1709.516] (-1711.755) (-1710.295) -- 0:00:24
873500 -- [-1706.614] (-1721.693) (-1713.149) (-1714.901) * (-1716.783) (-1705.728) [-1715.332] (-1720.299) -- 0:00:23
874000 -- [-1712.039] (-1714.931) (-1714.608) (-1708.813) * (-1717.271) (-1705.284) (-1708.490) [-1708.377] -- 0:00:23
874500 -- (-1708.575) (-1707.749) (-1708.700) [-1711.140] * (-1715.864) (-1713.056) (-1711.809) [-1712.691] -- 0:00:23
875000 -- (-1711.760) (-1714.135) [-1705.701] (-1711.368) * (-1713.179) (-1709.964) [-1710.045] (-1712.818) -- 0:00:23
Average standard deviation of split frequencies: 0.004843
875500 -- [-1714.591] (-1709.581) (-1711.501) (-1709.972) * [-1707.070] (-1709.639) (-1716.135) (-1706.557) -- 0:00:23
876000 -- (-1707.426) (-1707.696) (-1712.598) [-1708.481] * [-1709.568] (-1712.059) (-1712.198) (-1710.628) -- 0:00:23
876500 -- (-1723.429) (-1709.996) [-1711.275] (-1707.716) * (-1713.320) (-1716.639) [-1711.782] (-1711.849) -- 0:00:23
877000 -- (-1713.680) (-1710.717) [-1708.389] (-1717.910) * [-1709.555] (-1718.051) (-1713.046) (-1712.674) -- 0:00:23
877500 -- (-1714.696) [-1706.994] (-1715.337) (-1709.792) * (-1712.903) (-1713.522) [-1706.502] (-1709.792) -- 0:00:23
878000 -- (-1711.213) [-1707.713] (-1713.541) (-1710.016) * [-1708.331] (-1714.254) (-1709.818) (-1709.163) -- 0:00:23
878500 -- (-1716.047) (-1706.546) [-1708.139] (-1712.593) * (-1716.500) (-1710.969) (-1710.840) [-1710.814] -- 0:00:22
879000 -- (-1712.210) (-1711.109) (-1720.558) [-1714.190] * (-1709.476) [-1717.442] (-1711.884) (-1712.592) -- 0:00:22
879500 -- (-1707.143) [-1708.981] (-1712.520) (-1722.472) * [-1708.045] (-1715.237) (-1706.824) (-1708.732) -- 0:00:22
880000 -- (-1710.360) [-1705.668] (-1712.276) (-1715.102) * (-1710.336) [-1710.113] (-1713.118) (-1711.476) -- 0:00:22
Average standard deviation of split frequencies: 0.004282
880500 -- (-1710.037) [-1711.030] (-1710.372) (-1710.150) * (-1711.279) (-1717.019) (-1708.154) [-1707.671] -- 0:00:22
881000 -- (-1708.753) (-1713.959) [-1711.620] (-1711.642) * (-1707.822) (-1714.094) (-1708.992) [-1712.368] -- 0:00:22
881500 -- [-1711.974] (-1713.616) (-1706.582) (-1710.314) * [-1710.222] (-1710.140) (-1712.905) (-1707.225) -- 0:00:22
882000 -- [-1708.654] (-1716.267) (-1712.558) (-1710.334) * (-1716.324) (-1708.329) [-1707.553] (-1710.009) -- 0:00:22
882500 -- (-1709.521) [-1712.441] (-1709.325) (-1708.857) * (-1711.512) (-1711.021) [-1708.628] (-1707.446) -- 0:00:22
883000 -- (-1714.613) [-1708.840] (-1710.420) (-1712.650) * (-1721.318) [-1707.385] (-1715.076) (-1710.095) -- 0:00:22
883500 -- (-1712.724) (-1711.431) [-1708.677] (-1711.584) * (-1712.905) [-1708.170] (-1718.089) (-1710.531) -- 0:00:22
884000 -- (-1710.435) [-1706.553] (-1710.898) (-1713.141) * (-1713.823) (-1708.297) [-1709.363] (-1711.550) -- 0:00:21
884500 -- [-1711.398] (-1705.389) (-1718.491) (-1715.067) * [-1710.705] (-1709.370) (-1708.325) (-1708.048) -- 0:00:21
885000 -- [-1712.886] (-1712.806) (-1709.012) (-1716.033) * (-1709.022) [-1710.492] (-1709.086) (-1714.691) -- 0:00:21
Average standard deviation of split frequencies: 0.004079
885500 -- (-1707.717) [-1710.416] (-1710.726) (-1710.960) * (-1713.444) [-1708.066] (-1710.744) (-1711.349) -- 0:00:21
886000 -- (-1707.397) [-1709.986] (-1709.408) (-1712.510) * (-1713.691) (-1714.593) [-1711.177] (-1713.248) -- 0:00:21
886500 -- (-1711.754) (-1715.101) [-1709.926] (-1708.441) * (-1715.822) [-1713.236] (-1712.529) (-1709.769) -- 0:00:21
887000 -- (-1711.125) [-1708.118] (-1711.176) (-1707.754) * [-1715.882] (-1707.978) (-1703.251) (-1715.370) -- 0:00:21
887500 -- (-1716.708) [-1709.605] (-1711.735) (-1709.651) * (-1715.723) (-1713.763) [-1710.926] (-1713.637) -- 0:00:21
888000 -- (-1713.453) (-1713.290) [-1710.174] (-1711.527) * (-1710.567) (-1714.621) [-1714.210] (-1717.774) -- 0:00:21
888500 -- [-1715.936] (-1711.388) (-1708.733) (-1709.483) * (-1707.325) [-1707.950] (-1720.075) (-1710.849) -- 0:00:21
889000 -- [-1714.863] (-1716.071) (-1712.228) (-1715.466) * [-1711.569] (-1709.891) (-1720.432) (-1709.061) -- 0:00:20
889500 -- (-1713.043) (-1709.451) (-1711.490) [-1707.757] * [-1709.097] (-1712.610) (-1723.623) (-1713.020) -- 0:00:20
890000 -- (-1713.028) (-1710.781) [-1705.755] (-1711.087) * (-1713.147) [-1713.891] (-1717.115) (-1712.328) -- 0:00:20
Average standard deviation of split frequencies: 0.005116
890500 -- (-1711.423) (-1710.109) (-1706.983) [-1708.030] * [-1714.949] (-1711.630) (-1714.668) (-1714.570) -- 0:00:20
891000 -- (-1716.871) (-1710.361) [-1710.676] (-1706.553) * (-1716.887) (-1710.782) (-1719.205) [-1710.362] -- 0:00:20
891500 -- [-1713.308] (-1710.824) (-1711.062) (-1707.238) * [-1708.559] (-1712.485) (-1717.107) (-1709.628) -- 0:00:20
892000 -- (-1708.066) (-1710.857) [-1710.784] (-1713.049) * [-1707.509] (-1710.156) (-1712.113) (-1708.718) -- 0:00:20
892500 -- [-1711.990] (-1712.535) (-1710.787) (-1714.224) * (-1708.671) (-1715.830) [-1713.038] (-1711.641) -- 0:00:20
893000 -- [-1708.408] (-1711.594) (-1711.750) (-1714.642) * [-1712.806] (-1712.001) (-1711.545) (-1712.944) -- 0:00:20
893500 -- [-1714.367] (-1717.493) (-1711.902) (-1712.252) * (-1706.043) (-1711.972) (-1704.972) [-1708.758] -- 0:00:20
894000 -- (-1714.942) [-1715.871] (-1714.008) (-1708.894) * (-1709.802) (-1711.586) [-1709.728] (-1709.639) -- 0:00:20
894500 -- (-1711.348) (-1713.450) [-1713.054] (-1713.350) * (-1716.983) (-1719.482) [-1707.302] (-1711.977) -- 0:00:19
895000 -- [-1707.871] (-1711.382) (-1714.463) (-1711.671) * (-1712.985) (-1715.021) [-1710.581] (-1712.365) -- 0:00:19
Average standard deviation of split frequencies: 0.004034
895500 -- [-1707.802] (-1715.129) (-1710.979) (-1710.480) * (-1709.953) (-1715.190) [-1707.629] (-1714.555) -- 0:00:19
896000 -- (-1708.530) (-1719.285) [-1707.806] (-1710.886) * [-1710.061] (-1717.359) (-1711.464) (-1711.781) -- 0:00:19
896500 -- (-1714.550) [-1715.604] (-1709.106) (-1713.590) * [-1710.906] (-1706.720) (-1711.056) (-1710.912) -- 0:00:19
897000 -- (-1710.589) (-1716.279) (-1711.808) [-1713.741] * (-1711.157) (-1710.067) [-1718.751] (-1710.888) -- 0:00:19
897500 -- (-1724.719) (-1712.766) (-1708.323) [-1713.388] * [-1709.384] (-1706.752) (-1707.195) (-1707.668) -- 0:00:19
898000 -- (-1716.610) (-1720.595) [-1706.283] (-1715.149) * (-1708.353) (-1707.227) [-1708.787] (-1708.419) -- 0:00:19
898500 -- [-1711.199] (-1717.542) (-1708.334) (-1704.971) * [-1706.320] (-1707.463) (-1711.387) (-1710.611) -- 0:00:19
899000 -- (-1711.431) (-1714.466) (-1714.268) [-1706.440] * (-1706.554) (-1712.009) [-1710.550] (-1715.280) -- 0:00:19
899500 -- (-1709.719) (-1716.825) (-1715.154) [-1705.592] * (-1708.452) (-1711.792) [-1708.607] (-1716.225) -- 0:00:18
900000 -- [-1707.874] (-1717.255) (-1715.660) (-1715.455) * (-1707.322) [-1712.477] (-1711.652) (-1712.242) -- 0:00:18
Average standard deviation of split frequencies: 0.003489
900500 -- (-1713.576) (-1710.111) [-1714.941] (-1713.877) * [-1714.398] (-1710.801) (-1708.691) (-1711.227) -- 0:00:18
901000 -- [-1713.027] (-1713.376) (-1713.972) (-1709.991) * (-1714.393) (-1715.354) [-1711.399] (-1712.401) -- 0:00:18
901500 -- (-1721.064) [-1708.908] (-1709.732) (-1716.826) * (-1716.861) [-1711.359] (-1708.125) (-1710.770) -- 0:00:18
902000 -- (-1710.979) [-1707.148] (-1714.692) (-1715.323) * (-1714.841) [-1716.089] (-1709.852) (-1715.697) -- 0:00:18
902500 -- [-1707.869] (-1721.297) (-1710.391) (-1714.805) * (-1716.219) (-1718.491) [-1712.242] (-1710.363) -- 0:00:18
903000 -- (-1706.659) [-1708.890] (-1713.608) (-1716.449) * (-1708.061) (-1710.961) (-1710.750) [-1707.586] -- 0:00:18
903500 -- [-1708.381] (-1708.473) (-1711.930) (-1715.965) * [-1710.628] (-1712.899) (-1709.125) (-1712.654) -- 0:00:18
904000 -- [-1707.721] (-1710.550) (-1712.679) (-1712.461) * (-1710.982) (-1713.851) [-1708.094] (-1709.632) -- 0:00:18
904500 -- (-1718.342) [-1710.471] (-1714.533) (-1714.866) * (-1708.121) [-1707.586] (-1710.937) (-1714.054) -- 0:00:18
905000 -- (-1708.346) (-1716.083) (-1707.489) [-1708.801] * (-1711.926) (-1708.106) (-1711.382) [-1710.465] -- 0:00:17
Average standard deviation of split frequencies: 0.002948
905500 -- (-1712.980) (-1712.721) (-1709.081) [-1709.574] * (-1713.327) (-1713.327) (-1714.145) [-1711.925] -- 0:00:17
906000 -- (-1710.636) [-1712.781] (-1708.901) (-1709.767) * (-1705.702) (-1712.407) [-1712.531] (-1712.602) -- 0:00:17
906500 -- (-1715.931) (-1716.449) (-1707.163) [-1710.196] * (-1717.838) [-1709.654] (-1710.585) (-1709.659) -- 0:00:17
907000 -- (-1714.241) [-1711.481] (-1715.252) (-1716.833) * [-1706.615] (-1710.435) (-1715.870) (-1709.684) -- 0:00:17
907500 -- (-1712.898) (-1716.360) (-1720.142) [-1711.893] * (-1712.274) (-1712.993) [-1711.964] (-1712.658) -- 0:00:17
908000 -- (-1711.935) (-1712.573) (-1719.519) [-1708.126] * (-1709.853) (-1706.887) [-1707.754] (-1717.992) -- 0:00:17
908500 -- [-1710.810] (-1707.929) (-1714.564) (-1715.001) * (-1711.858) [-1710.123] (-1707.913) (-1717.665) -- 0:00:17
909000 -- (-1709.610) [-1710.780] (-1713.757) (-1714.527) * (-1711.428) (-1719.174) (-1711.436) [-1712.913] -- 0:00:17
909500 -- [-1713.715] (-1706.033) (-1711.856) (-1706.811) * (-1712.021) (-1715.945) (-1708.916) [-1706.686] -- 0:00:17
910000 -- (-1709.545) [-1707.223] (-1717.370) (-1707.647) * (-1710.269) (-1712.043) [-1707.304] (-1709.150) -- 0:00:17
Average standard deviation of split frequencies: 0.004659
910500 -- [-1707.187] (-1716.517) (-1714.166) (-1707.840) * (-1711.300) [-1721.657] (-1713.797) (-1706.575) -- 0:00:16
911000 -- [-1711.739] (-1710.355) (-1716.475) (-1712.748) * (-1706.763) [-1711.601] (-1716.225) (-1715.459) -- 0:00:16
911500 -- (-1711.833) [-1704.942] (-1716.263) (-1711.538) * (-1713.826) (-1707.740) (-1708.306) [-1710.543] -- 0:00:16
912000 -- (-1708.639) (-1706.554) [-1715.161] (-1715.222) * [-1710.517] (-1706.154) (-1714.501) (-1711.195) -- 0:00:16
912500 -- (-1711.724) (-1712.511) (-1721.578) [-1711.392] * (-1713.413) [-1707.263] (-1710.648) (-1710.202) -- 0:00:16
913000 -- (-1709.093) (-1711.521) (-1717.124) [-1711.652] * [-1710.406] (-1713.843) (-1708.643) (-1713.465) -- 0:00:16
913500 -- (-1713.497) [-1708.884] (-1707.419) (-1709.690) * (-1706.326) (-1709.826) [-1714.998] (-1719.260) -- 0:00:16
914000 -- (-1724.663) (-1711.246) (-1708.504) [-1711.867] * (-1709.994) [-1714.830] (-1709.589) (-1713.639) -- 0:00:16
914500 -- (-1714.212) (-1716.581) [-1712.981] (-1710.069) * (-1710.694) [-1714.489] (-1706.330) (-1708.632) -- 0:00:16
915000 -- [-1713.187] (-1716.072) (-1717.014) (-1714.062) * (-1707.166) (-1713.793) [-1711.964] (-1713.916) -- 0:00:16
Average standard deviation of split frequencies: 0.005318
915500 -- (-1711.988) (-1717.609) [-1708.038] (-1715.505) * (-1715.365) (-1709.469) (-1716.418) [-1709.740] -- 0:00:15
916000 -- (-1718.750) (-1714.986) (-1715.860) [-1710.613] * (-1711.626) [-1716.934] (-1715.339) (-1711.226) -- 0:00:15
916500 -- (-1715.944) [-1711.463] (-1721.727) (-1710.386) * (-1708.015) [-1708.806] (-1712.476) (-1708.061) -- 0:00:15
917000 -- (-1716.351) [-1706.022] (-1710.742) (-1712.073) * [-1708.193] (-1707.111) (-1710.302) (-1713.955) -- 0:00:15
917500 -- (-1709.464) (-1712.144) (-1708.223) [-1709.300] * (-1710.260) (-1710.202) (-1711.335) [-1711.991] -- 0:00:15
918000 -- (-1714.479) (-1708.920) (-1710.256) [-1708.464] * [-1712.319] (-1712.940) (-1713.009) (-1709.541) -- 0:00:15
918500 -- (-1711.229) (-1712.686) (-1706.026) [-1716.811] * (-1717.143) (-1715.943) (-1728.321) [-1707.308] -- 0:00:15
919000 -- [-1710.717] (-1709.951) (-1710.415) (-1718.202) * (-1714.035) (-1710.406) (-1710.945) [-1708.740] -- 0:00:15
919500 -- [-1709.938] (-1708.777) (-1709.352) (-1710.327) * (-1720.040) (-1713.039) (-1711.677) [-1712.143] -- 0:00:15
920000 -- (-1713.231) (-1717.971) (-1708.571) [-1709.459] * (-1707.575) (-1712.759) (-1711.107) [-1710.356] -- 0:00:15
Average standard deviation of split frequencies: 0.005632
920500 -- [-1712.231] (-1713.587) (-1707.760) (-1714.317) * (-1708.675) (-1705.259) (-1715.063) [-1712.111] -- 0:00:15
921000 -- (-1715.322) [-1709.295] (-1708.687) (-1710.941) * (-1706.326) (-1707.871) (-1709.014) [-1706.739] -- 0:00:14
921500 -- (-1709.252) (-1710.213) (-1708.834) [-1707.894] * [-1711.333] (-1714.138) (-1716.120) (-1714.142) -- 0:00:14
922000 -- (-1710.612) [-1706.337] (-1708.211) (-1706.076) * (-1708.563) [-1708.375] (-1716.932) (-1712.692) -- 0:00:14
922500 -- (-1711.708) (-1707.087) (-1718.536) [-1710.223] * (-1710.780) (-1715.364) [-1718.038] (-1708.500) -- 0:00:14
923000 -- (-1707.309) (-1710.793) (-1709.775) [-1709.392] * [-1708.241] (-1715.659) (-1713.447) (-1710.249) -- 0:00:14
923500 -- (-1705.720) [-1709.208] (-1711.580) (-1705.570) * (-1709.081) (-1715.210) [-1712.816] (-1710.681) -- 0:00:14
924000 -- [-1707.325] (-1716.298) (-1710.983) (-1707.761) * (-1711.998) [-1711.708] (-1709.191) (-1709.737) -- 0:00:14
924500 -- (-1708.016) (-1710.611) [-1712.388] (-1708.485) * (-1713.509) [-1711.524] (-1717.942) (-1708.535) -- 0:00:14
925000 -- (-1714.509) [-1705.577] (-1708.876) (-1711.998) * (-1721.388) [-1706.768] (-1713.349) (-1714.457) -- 0:00:14
Average standard deviation of split frequencies: 0.005939
925500 -- (-1711.111) [-1704.603] (-1709.337) (-1707.240) * [-1709.989] (-1711.604) (-1714.959) (-1713.673) -- 0:00:14
926000 -- (-1717.035) (-1705.815) [-1706.444] (-1714.643) * (-1710.545) (-1707.534) (-1709.910) [-1707.046] -- 0:00:13
926500 -- [-1711.055] (-1711.029) (-1708.492) (-1708.299) * (-1709.842) (-1709.001) (-1709.755) [-1708.184] -- 0:00:13
927000 -- [-1709.089] (-1710.336) (-1713.897) (-1710.420) * [-1709.477] (-1706.164) (-1708.980) (-1708.049) -- 0:00:13
927500 -- [-1708.019] (-1711.359) (-1710.261) (-1711.103) * (-1712.149) (-1709.856) (-1708.814) [-1715.391] -- 0:00:13
928000 -- (-1707.875) (-1714.860) (-1712.691) [-1711.075] * (-1709.939) [-1712.358] (-1720.291) (-1711.737) -- 0:00:13
928500 -- (-1714.336) (-1714.016) [-1709.529] (-1713.728) * (-1710.298) [-1709.250] (-1715.930) (-1709.792) -- 0:00:13
929000 -- [-1710.155] (-1710.273) (-1709.525) (-1707.674) * [-1712.188] (-1711.441) (-1721.821) (-1714.751) -- 0:00:13
929500 -- [-1708.992] (-1711.307) (-1716.281) (-1707.515) * (-1711.490) [-1706.282] (-1720.795) (-1709.280) -- 0:00:13
930000 -- (-1711.791) (-1713.100) (-1716.211) [-1705.363] * (-1713.089) [-1709.966] (-1723.234) (-1709.965) -- 0:00:13
Average standard deviation of split frequencies: 0.006078
930500 -- (-1713.960) [-1712.918] (-1714.337) (-1712.919) * (-1711.266) (-1708.979) (-1720.508) [-1709.070] -- 0:00:13
931000 -- [-1711.169] (-1717.694) (-1712.833) (-1708.848) * [-1713.764] (-1717.324) (-1722.423) (-1716.900) -- 0:00:13
931500 -- [-1709.894] (-1717.594) (-1714.887) (-1713.556) * (-1709.489) [-1713.367] (-1714.833) (-1707.670) -- 0:00:12
932000 -- (-1708.890) (-1716.721) (-1714.053) [-1710.243] * (-1708.308) (-1707.888) [-1712.426] (-1709.607) -- 0:00:12
932500 -- (-1715.053) [-1714.515] (-1718.150) (-1709.053) * [-1706.527] (-1708.885) (-1713.951) (-1708.109) -- 0:00:12
933000 -- [-1709.364] (-1709.512) (-1712.875) (-1708.261) * [-1708.314] (-1711.197) (-1709.846) (-1711.868) -- 0:00:12
933500 -- (-1708.142) (-1711.172) [-1710.771] (-1709.578) * (-1708.670) (-1716.278) (-1711.899) [-1707.111] -- 0:00:12
934000 -- (-1705.828) [-1709.160] (-1710.643) (-1724.919) * (-1717.187) (-1714.802) (-1707.222) [-1707.373] -- 0:00:12
934500 -- (-1709.434) (-1710.737) [-1707.365] (-1708.373) * (-1710.855) (-1713.078) (-1712.072) [-1708.712] -- 0:00:12
935000 -- (-1716.163) (-1712.916) (-1712.550) [-1709.319] * (-1720.792) (-1710.393) [-1708.397] (-1708.430) -- 0:00:12
Average standard deviation of split frequencies: 0.006044
935500 -- (-1716.390) [-1706.767] (-1719.035) (-1711.278) * (-1714.419) (-1713.450) (-1714.851) [-1709.524] -- 0:00:12
936000 -- (-1716.524) (-1710.107) (-1708.281) [-1708.252] * (-1714.564) (-1708.789) [-1709.571] (-1708.314) -- 0:00:12
936500 -- (-1712.660) (-1708.619) (-1704.068) [-1707.663] * (-1708.447) [-1710.746] (-1714.036) (-1712.439) -- 0:00:12
937000 -- [-1714.965] (-1712.469) (-1706.233) (-1716.737) * (-1708.085) [-1706.621] (-1713.817) (-1708.637) -- 0:00:11
937500 -- (-1714.443) (-1711.173) (-1707.216) [-1707.119] * (-1704.313) [-1706.049] (-1708.945) (-1708.403) -- 0:00:11
938000 -- (-1708.611) (-1714.012) (-1708.641) [-1706.017] * [-1709.604] (-1710.492) (-1711.660) (-1711.198) -- 0:00:11
938500 -- (-1707.731) (-1712.549) (-1708.634) [-1707.100] * (-1709.777) [-1709.954] (-1711.946) (-1711.975) -- 0:00:11
939000 -- (-1711.884) (-1708.448) (-1708.130) [-1706.863] * (-1708.456) [-1709.689] (-1714.380) (-1716.303) -- 0:00:11
939500 -- (-1706.408) (-1708.886) [-1711.675] (-1712.217) * [-1710.898] (-1709.815) (-1714.138) (-1714.244) -- 0:00:11
940000 -- (-1711.854) (-1715.013) [-1707.279] (-1711.830) * (-1710.218) (-1709.933) (-1709.480) [-1705.867] -- 0:00:11
Average standard deviation of split frequencies: 0.006348
940500 -- (-1715.655) (-1705.553) [-1706.670] (-1712.932) * (-1712.508) (-1711.676) [-1709.700] (-1707.136) -- 0:00:11
941000 -- (-1714.420) (-1710.782) [-1707.791] (-1715.355) * (-1710.877) (-1711.620) (-1708.820) [-1710.124] -- 0:00:11
941500 -- (-1713.643) [-1704.323] (-1717.649) (-1709.330) * (-1707.081) (-1710.009) [-1709.799] (-1715.284) -- 0:00:11
942000 -- (-1709.754) (-1709.436) [-1714.536] (-1717.320) * (-1715.214) [-1709.166] (-1711.370) (-1706.095) -- 0:00:10
942500 -- [-1709.805] (-1708.375) (-1711.038) (-1717.703) * (-1710.498) [-1711.943] (-1716.464) (-1708.423) -- 0:00:10
943000 -- [-1713.037] (-1716.628) (-1710.951) (-1708.870) * [-1707.248] (-1711.201) (-1713.308) (-1714.104) -- 0:00:10
943500 -- [-1707.275] (-1712.354) (-1708.714) (-1707.556) * (-1708.194) [-1714.647] (-1708.158) (-1711.038) -- 0:00:10
944000 -- (-1718.135) (-1708.223) (-1713.161) [-1708.532] * [-1709.630] (-1711.751) (-1710.352) (-1710.525) -- 0:00:10
944500 -- [-1712.607] (-1718.642) (-1711.491) (-1713.579) * (-1710.419) [-1708.659] (-1713.641) (-1708.654) -- 0:00:10
945000 -- (-1708.016) [-1714.651] (-1712.029) (-1716.084) * [-1707.936] (-1712.491) (-1712.372) (-1719.202) -- 0:00:10
Average standard deviation of split frequencies: 0.006478
945500 -- (-1707.036) (-1706.237) (-1716.629) [-1706.536] * [-1709.527] (-1708.174) (-1713.994) (-1709.255) -- 0:00:10
946000 -- (-1709.591) (-1716.711) [-1711.045] (-1707.579) * [-1707.231] (-1708.569) (-1721.639) (-1710.336) -- 0:00:10
946500 -- (-1710.753) (-1710.924) [-1708.996] (-1708.145) * (-1709.798) [-1714.308] (-1717.265) (-1712.120) -- 0:00:10
947000 -- (-1716.983) (-1709.177) (-1714.067) [-1708.862] * (-1714.616) (-1715.342) [-1717.443] (-1708.494) -- 0:00:10
947500 -- [-1714.539] (-1707.822) (-1709.239) (-1708.953) * [-1712.374] (-1711.077) (-1716.123) (-1713.925) -- 0:00:09
948000 -- (-1707.942) (-1706.907) [-1705.744] (-1714.105) * (-1708.751) (-1717.744) [-1710.634] (-1709.856) -- 0:00:09
948500 -- [-1711.378] (-1713.604) (-1720.746) (-1713.480) * (-1715.582) (-1710.054) (-1715.422) [-1712.296] -- 0:00:09
949000 -- [-1712.679] (-1709.843) (-1710.724) (-1712.240) * (-1711.605) (-1710.064) [-1716.458] (-1713.902) -- 0:00:09
949500 -- (-1716.747) (-1713.260) [-1711.210] (-1716.301) * (-1715.357) [-1708.762] (-1712.839) (-1714.145) -- 0:00:09
950000 -- (-1709.796) (-1706.863) (-1721.363) [-1708.017] * [-1712.259] (-1711.668) (-1710.574) (-1706.108) -- 0:00:09
Average standard deviation of split frequencies: 0.006116
950500 -- (-1716.940) (-1705.722) (-1714.638) [-1715.145] * (-1709.291) (-1713.435) (-1709.278) [-1705.170] -- 0:00:09
951000 -- (-1710.657) [-1706.636] (-1709.034) (-1708.415) * (-1727.523) [-1706.125] (-1720.824) (-1708.272) -- 0:00:09
951500 -- (-1711.594) (-1713.542) [-1714.431] (-1712.762) * (-1710.014) [-1704.897] (-1710.424) (-1710.348) -- 0:00:09
952000 -- (-1708.802) (-1714.466) [-1709.118] (-1716.378) * (-1709.589) [-1705.602] (-1715.656) (-1708.144) -- 0:00:09
952500 -- (-1715.332) (-1713.105) (-1709.842) [-1709.787] * (-1715.400) (-1707.910) [-1708.600] (-1715.722) -- 0:00:08
953000 -- [-1713.826] (-1720.245) (-1707.391) (-1709.627) * (-1711.067) [-1706.869] (-1713.475) (-1715.923) -- 0:00:08
953500 -- (-1714.698) (-1707.524) (-1721.644) [-1705.915] * (-1717.360) [-1710.920] (-1712.261) (-1711.386) -- 0:00:08
954000 -- (-1711.545) [-1715.141] (-1720.328) (-1711.573) * [-1712.729] (-1709.136) (-1713.933) (-1706.348) -- 0:00:08
954500 -- (-1717.146) [-1710.318] (-1708.745) (-1707.822) * (-1715.096) (-1716.155) [-1715.137] (-1714.210) -- 0:00:08
955000 -- (-1711.059) [-1704.966] (-1711.948) (-1711.296) * (-1710.713) (-1712.098) (-1710.957) [-1707.760] -- 0:00:08
Average standard deviation of split frequencies: 0.006410
955500 -- (-1710.339) (-1709.145) [-1710.519] (-1709.724) * [-1707.228] (-1725.199) (-1721.893) (-1714.735) -- 0:00:08
956000 -- (-1716.451) (-1712.166) (-1716.924) [-1707.761] * [-1709.271] (-1718.671) (-1708.539) (-1706.251) -- 0:00:08
956500 -- [-1705.841] (-1718.798) (-1717.349) (-1709.856) * (-1713.261) (-1715.705) [-1712.679] (-1709.713) -- 0:00:08
957000 -- (-1711.265) [-1709.584] (-1710.216) (-1721.136) * (-1708.386) [-1715.301] (-1714.962) (-1720.272) -- 0:00:08
957500 -- (-1709.070) (-1710.714) (-1710.196) [-1712.506] * (-1715.660) (-1713.460) (-1709.709) [-1715.370] -- 0:00:08
958000 -- (-1710.848) (-1708.992) [-1710.266] (-1719.409) * (-1708.804) [-1712.216] (-1712.039) (-1716.751) -- 0:00:07
958500 -- [-1709.610] (-1707.546) (-1710.351) (-1709.006) * (-1711.846) (-1714.681) (-1721.832) [-1719.757] -- 0:00:07
959000 -- [-1708.859] (-1708.794) (-1706.872) (-1716.639) * (-1714.866) (-1709.432) [-1709.769] (-1709.352) -- 0:00:07
959500 -- (-1708.619) (-1714.024) (-1719.877) [-1712.981] * (-1719.882) [-1709.102] (-1708.225) (-1712.278) -- 0:00:07
960000 -- (-1708.361) (-1712.486) [-1707.983] (-1704.913) * (-1715.485) [-1707.637] (-1708.446) (-1707.677) -- 0:00:07
Average standard deviation of split frequencies: 0.006052
960500 -- [-1706.737] (-1713.508) (-1709.613) (-1710.070) * (-1713.158) (-1711.275) [-1716.848] (-1709.894) -- 0:00:07
961000 -- (-1708.840) (-1711.887) (-1714.618) [-1708.197] * (-1719.839) (-1710.389) (-1713.241) [-1712.143] -- 0:00:07
961500 -- (-1709.630) [-1706.594] (-1705.342) (-1715.442) * [-1713.177] (-1704.504) (-1709.324) (-1708.093) -- 0:00:07
962000 -- (-1713.352) (-1704.612) [-1704.930] (-1714.113) * (-1717.861) (-1710.067) [-1707.747] (-1707.702) -- 0:00:07
962500 -- (-1709.349) [-1712.318] (-1707.185) (-1716.769) * (-1708.803) [-1710.535] (-1710.861) (-1713.993) -- 0:00:07
963000 -- (-1710.675) [-1708.747] (-1710.837) (-1712.473) * [-1712.003] (-1711.200) (-1715.248) (-1709.853) -- 0:00:06
963500 -- (-1711.823) (-1711.499) [-1713.388] (-1709.998) * (-1712.464) (-1711.879) [-1713.063] (-1715.566) -- 0:00:06
964000 -- (-1712.654) [-1714.828] (-1717.518) (-1713.684) * (-1709.596) (-1707.916) (-1710.154) [-1705.263] -- 0:00:06
964500 -- (-1709.165) (-1713.651) (-1710.041) [-1704.312] * (-1706.018) (-1713.668) (-1714.183) [-1709.630] -- 0:00:06
965000 -- (-1708.130) [-1708.385] (-1711.134) (-1712.227) * (-1705.225) (-1711.731) [-1710.607] (-1707.100) -- 0:00:06
Average standard deviation of split frequencies: 0.006832
965500 -- (-1711.870) (-1712.306) [-1709.280] (-1713.130) * (-1708.538) (-1713.248) (-1712.199) [-1710.910] -- 0:00:06
966000 -- [-1715.887] (-1709.643) (-1711.770) (-1718.899) * (-1709.325) [-1712.112] (-1713.693) (-1712.106) -- 0:00:06
966500 -- [-1713.438] (-1714.864) (-1710.391) (-1716.264) * (-1713.327) [-1715.522] (-1715.286) (-1714.069) -- 0:00:06
967000 -- [-1710.028] (-1720.420) (-1709.315) (-1714.012) * (-1715.012) (-1709.615) (-1708.827) [-1709.884] -- 0:00:06
967500 -- [-1712.061] (-1711.922) (-1711.493) (-1713.651) * (-1712.737) [-1708.742] (-1708.160) (-1710.124) -- 0:00:06
968000 -- (-1710.836) (-1711.815) (-1709.055) [-1712.144] * [-1707.979] (-1706.555) (-1711.590) (-1714.589) -- 0:00:06
968500 -- (-1710.556) (-1719.249) [-1708.285] (-1709.938) * (-1708.958) (-1712.148) [-1710.847] (-1714.003) -- 0:00:05
969000 -- (-1717.473) (-1711.059) (-1713.539) [-1709.912] * (-1708.829) (-1711.809) (-1711.049) [-1713.725] -- 0:00:05
969500 -- (-1708.114) [-1704.885] (-1707.681) (-1709.221) * [-1705.713] (-1708.294) (-1712.140) (-1720.275) -- 0:00:05
970000 -- [-1714.059] (-1712.598) (-1706.098) (-1714.991) * (-1708.837) (-1710.646) [-1707.201] (-1709.506) -- 0:00:05
Average standard deviation of split frequencies: 0.005828
970500 -- (-1709.400) (-1709.046) [-1707.331] (-1718.966) * (-1710.899) (-1712.513) [-1709.871] (-1722.906) -- 0:00:05
971000 -- (-1708.571) [-1709.090] (-1711.630) (-1718.019) * (-1706.706) (-1710.161) (-1707.142) [-1709.421] -- 0:00:05
971500 -- (-1711.495) (-1707.061) (-1708.357) [-1710.907] * (-1714.656) (-1714.336) (-1709.977) [-1711.721] -- 0:00:05
972000 -- (-1712.797) (-1712.923) [-1709.934] (-1712.082) * [-1714.408] (-1710.406) (-1715.616) (-1707.188) -- 0:00:05
972500 -- (-1714.475) (-1709.972) (-1714.385) [-1713.209] * (-1712.866) (-1717.767) [-1715.539] (-1713.968) -- 0:00:05
973000 -- [-1709.933] (-1710.271) (-1712.883) (-1716.048) * (-1714.300) [-1710.595] (-1709.107) (-1715.416) -- 0:00:05
973500 -- (-1712.402) (-1710.447) [-1711.148] (-1707.326) * (-1713.758) [-1709.822] (-1705.946) (-1714.729) -- 0:00:05
974000 -- [-1707.747] (-1709.068) (-1710.085) (-1712.718) * (-1711.559) (-1711.643) (-1705.644) [-1711.114] -- 0:00:04
974500 -- (-1713.520) [-1715.648] (-1710.488) (-1717.046) * [-1716.718] (-1712.601) (-1717.007) (-1710.820) -- 0:00:04
975000 -- (-1710.100) (-1712.025) [-1705.335] (-1717.148) * (-1706.226) [-1715.924] (-1711.251) (-1711.026) -- 0:00:04
Average standard deviation of split frequencies: 0.005313
975500 -- (-1709.874) (-1714.377) [-1707.355] (-1711.830) * (-1712.537) (-1714.278) [-1709.780] (-1718.505) -- 0:00:04
976000 -- [-1710.777] (-1718.911) (-1707.752) (-1713.354) * (-1711.113) (-1716.139) (-1714.069) [-1710.120] -- 0:00:04
976500 -- [-1707.233] (-1713.949) (-1711.461) (-1705.906) * (-1711.817) (-1710.559) [-1706.997] (-1713.673) -- 0:00:04
977000 -- (-1710.506) (-1706.010) (-1708.749) [-1713.678] * (-1708.973) (-1715.245) (-1712.825) [-1706.995] -- 0:00:04
977500 -- (-1707.215) [-1708.203] (-1709.071) (-1713.000) * (-1707.268) (-1708.659) (-1715.676) [-1709.373] -- 0:00:04
978000 -- (-1707.482) (-1718.739) [-1708.102] (-1725.513) * (-1708.739) [-1704.822] (-1710.311) (-1711.121) -- 0:00:04
978500 -- [-1707.906] (-1715.272) (-1714.482) (-1717.143) * (-1716.842) (-1708.315) (-1710.898) [-1706.806] -- 0:00:04
979000 -- (-1718.379) (-1708.140) [-1709.668] (-1710.099) * (-1712.164) (-1708.523) (-1708.011) [-1708.592] -- 0:00:03
979500 -- (-1710.292) (-1719.812) [-1708.440] (-1713.816) * (-1714.879) (-1710.329) (-1711.199) [-1711.334] -- 0:00:03
980000 -- [-1710.206] (-1709.045) (-1710.504) (-1713.873) * (-1713.435) (-1715.514) [-1717.718] (-1711.722) -- 0:00:03
Average standard deviation of split frequencies: 0.005929
980500 -- [-1710.703] (-1721.684) (-1709.108) (-1716.738) * (-1710.784) (-1711.222) [-1709.450] (-1713.589) -- 0:00:03
981000 -- [-1708.692] (-1707.978) (-1708.992) (-1711.854) * [-1711.441] (-1714.255) (-1707.941) (-1720.773) -- 0:00:03
981500 -- (-1708.348) (-1713.637) (-1712.093) [-1707.175] * (-1709.144) (-1714.704) (-1715.132) [-1714.256] -- 0:00:03
982000 -- (-1708.783) (-1709.484) [-1708.846] (-1711.501) * (-1715.694) (-1722.720) [-1714.014] (-1711.910) -- 0:00:03
982500 -- (-1707.062) [-1714.647] (-1710.293) (-1719.645) * [-1709.662] (-1718.517) (-1710.633) (-1720.741) -- 0:00:03
983000 -- [-1709.211] (-1710.936) (-1706.762) (-1712.696) * (-1710.619) (-1706.951) [-1708.153] (-1721.929) -- 0:00:03
983500 -- (-1705.094) [-1716.677] (-1716.131) (-1716.344) * (-1707.266) [-1711.453] (-1715.868) (-1719.108) -- 0:00:03
984000 -- (-1717.718) [-1714.727] (-1712.071) (-1714.871) * (-1709.844) [-1708.523] (-1714.793) (-1708.053) -- 0:00:03
984500 -- (-1716.898) (-1708.283) (-1710.294) [-1709.794] * (-1712.824) [-1710.036] (-1718.559) (-1708.023) -- 0:00:02
985000 -- (-1706.952) (-1709.074) [-1710.494] (-1712.740) * (-1714.278) [-1705.572] (-1708.753) (-1714.314) -- 0:00:02
Average standard deviation of split frequencies: 0.006215
985500 -- (-1710.040) (-1711.411) [-1706.953] (-1711.605) * (-1707.525) (-1707.395) [-1704.908] (-1709.960) -- 0:00:02
986000 -- (-1712.969) (-1708.432) [-1707.063] (-1710.520) * (-1715.921) (-1708.744) (-1709.882) [-1715.182] -- 0:00:02
986500 -- (-1706.547) (-1708.818) [-1708.844] (-1707.578) * (-1724.947) [-1708.819] (-1710.077) (-1710.056) -- 0:00:02
987000 -- (-1707.164) (-1714.428) [-1707.074] (-1713.951) * (-1709.279) [-1705.849] (-1714.818) (-1716.361) -- 0:00:02
987500 -- (-1712.338) (-1711.737) [-1708.817] (-1715.735) * (-1711.559) (-1715.619) [-1713.790] (-1720.038) -- 0:00:02
988000 -- (-1711.920) (-1709.869) (-1710.874) [-1715.866] * (-1712.744) [-1704.851] (-1710.666) (-1712.770) -- 0:00:02
988500 -- (-1715.506) [-1712.791] (-1710.302) (-1715.532) * (-1707.872) [-1706.151] (-1706.681) (-1704.490) -- 0:00:02
989000 -- (-1715.153) (-1709.677) (-1717.171) [-1715.672] * (-1717.667) (-1712.905) [-1708.492] (-1708.213) -- 0:00:02
989500 -- (-1705.868) (-1713.690) (-1711.372) [-1713.479] * (-1708.071) (-1716.575) (-1713.373) [-1714.847] -- 0:00:01
990000 -- (-1706.331) [-1714.904] (-1708.197) (-1713.414) * (-1711.748) (-1710.984) (-1709.833) [-1713.209] -- 0:00:01
Average standard deviation of split frequencies: 0.005710
990500 -- [-1716.888] (-1711.381) (-1710.614) (-1713.745) * (-1716.379) (-1712.543) [-1708.163] (-1706.716) -- 0:00:01
991000 -- (-1713.184) (-1716.075) [-1710.044] (-1710.800) * (-1712.522) (-1709.444) [-1710.465] (-1716.228) -- 0:00:01
991500 -- [-1715.614] (-1712.086) (-1712.042) (-1717.834) * (-1711.381) [-1707.196] (-1714.702) (-1713.779) -- 0:00:01
992000 -- (-1711.872) (-1712.817) [-1712.525] (-1707.444) * [-1712.558] (-1706.747) (-1715.225) (-1713.536) -- 0:00:01
992500 -- (-1711.619) [-1709.058] (-1716.317) (-1711.462) * (-1717.583) (-1715.376) [-1711.144] (-1711.638) -- 0:00:01
993000 -- (-1714.983) (-1710.468) (-1706.740) [-1717.404] * (-1716.657) [-1709.694] (-1710.760) (-1706.638) -- 0:00:01
993500 -- [-1711.301] (-1706.057) (-1710.279) (-1710.443) * (-1719.373) (-1713.442) [-1712.184] (-1706.604) -- 0:00:01
994000 -- (-1717.906) (-1705.781) (-1713.164) [-1706.625] * [-1710.441] (-1711.987) (-1709.660) (-1707.156) -- 0:00:01
994500 -- (-1712.092) (-1712.029) [-1709.814] (-1712.281) * (-1715.078) (-1711.211) (-1710.115) [-1710.017] -- 0:00:01
995000 -- [-1706.785] (-1710.368) (-1713.528) (-1712.856) * (-1711.277) (-1714.706) (-1711.141) [-1706.863] -- 0:00:00
Average standard deviation of split frequencies: 0.005206
995500 -- [-1708.729] (-1706.763) (-1715.925) (-1712.264) * [-1713.694] (-1712.864) (-1712.174) (-1709.559) -- 0:00:00
996000 -- (-1706.195) (-1707.886) [-1709.420] (-1716.646) * [-1706.706] (-1717.170) (-1711.472) (-1715.469) -- 0:00:00
996500 -- (-1723.270) [-1715.813] (-1709.620) (-1706.673) * (-1717.299) [-1707.127] (-1709.731) (-1712.272) -- 0:00:00
997000 -- (-1713.314) [-1714.447] (-1714.643) (-1712.052) * [-1708.837] (-1715.976) (-1710.694) (-1710.161) -- 0:00:00
997500 -- (-1711.968) (-1708.286) (-1711.473) [-1712.554] * (-1716.593) (-1718.346) (-1707.622) [-1709.918] -- 0:00:00
998000 -- (-1709.350) [-1709.986] (-1710.792) (-1714.290) * (-1719.214) [-1711.331] (-1720.680) (-1715.114) -- 0:00:00
998500 -- (-1718.780) (-1708.689) [-1710.659] (-1713.480) * (-1722.250) (-1712.288) [-1711.099] (-1714.818) -- 0:00:00
999000 -- (-1725.009) [-1709.994] (-1708.294) (-1713.745) * [-1708.411] (-1714.106) (-1708.885) (-1710.729) -- 0:00:00
999500 -- [-1710.493] (-1708.552) (-1713.485) (-1720.223) * (-1708.261) (-1708.539) (-1709.583) [-1708.984] -- 0:00:00
1000000 -- (-1711.476) (-1706.068) [-1717.734] (-1715.925) * (-1707.583) (-1708.925) [-1710.442] (-1713.287) -- 0:00:00
Average standard deviation of split frequencies: 0.005967
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1711.475691 -- 15.390857
Chain 1 -- -1711.475691 -- 15.390857
Chain 2 -- -1706.068299 -- 14.460110
Chain 2 -- -1706.068299 -- 14.460110
Chain 3 -- -1717.734359 -- 14.625665
Chain 3 -- -1717.734359 -- 14.625665
Chain 4 -- -1715.925356 -- 15.660044
Chain 4 -- -1715.925356 -- 15.660044
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1707.582896 -- 14.803386
Chain 1 -- -1707.582900 -- 14.803386
Chain 2 -- -1708.925044 -- 10.048274
Chain 2 -- -1708.925046 -- 10.048274
Chain 3 -- -1710.441529 -- 16.651213
Chain 3 -- -1710.441529 -- 16.651213
Chain 4 -- -1713.287333 -- 3.368406
Chain 4 -- -1713.287332 -- 3.368406
Analysis completed in 3 mins 9 seconds
Analysis used 188.79 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1701.96
Likelihood of best state for "cold" chain of run 2 was -1702.01
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
56.9 % ( 41 %) Dirichlet(Revmat{all})
69.7 % ( 59 %) Slider(Revmat{all})
26.0 % ( 35 %) Dirichlet(Pi{all})
28.1 % ( 30 %) Slider(Pi{all})
64.2 % ( 34 %) Multiplier(Alpha{1,2})
50.3 % ( 33 %) Multiplier(Alpha{3})
67.6 % ( 38 %) Slider(Pinvar{all})
14.9 % ( 27 %) ExtSPR(Tau{all},V{all})
14.9 % ( 19 %) ExtTBR(Tau{all},V{all})
14.9 % ( 23 %) NNI(Tau{all},V{all})
18.7 % ( 24 %) ParsSPR(Tau{all},V{all})
26.4 % ( 17 %) Multiplier(V{all})
30.3 % ( 31 %) Nodeslider(V{all})
25.7 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
55.8 % ( 46 %) Dirichlet(Revmat{all})
69.9 % ( 60 %) Slider(Revmat{all})
26.1 % ( 26 %) Dirichlet(Pi{all})
27.9 % ( 29 %) Slider(Pi{all})
63.5 % ( 40 %) Multiplier(Alpha{1,2})
50.7 % ( 28 %) Multiplier(Alpha{3})
67.6 % ( 35 %) Slider(Pinvar{all})
14.5 % ( 21 %) ExtSPR(Tau{all},V{all})
14.5 % ( 12 %) ExtTBR(Tau{all},V{all})
14.6 % ( 14 %) NNI(Tau{all},V{all})
18.4 % ( 13 %) ParsSPR(Tau{all},V{all})
26.3 % ( 18 %) Multiplier(V{all})
30.4 % ( 27 %) Nodeslider(V{all})
26.0 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.83 0.68 0.56
2 | 166572 0.84 0.71
3 | 166946 166740 0.86
4 | 166817 166543 166382
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.69 0.56
2 | 165977 0.85 0.71
3 | 166837 166790 0.86
4 | 166792 167008 166596
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1709.18
| 2 2 1 |
| 2 2 2 211 1 |
| 2 1 1 1 |
| 11 1 2 2 1 11 22|
| 1 2 * 22 1 2 1 |
| 2 1 2* 2 2 1**12 21 1 1 |
| 2 2 1111 21 1 2 12 1 2*11 2 22 |
|1 1 1 1 2 * 2 1 1 1 |
|2 2 2 2 222 *1 2 2 |
| 1 2 1 2 2 11 |
| 1 2 1 1 2 1 2 2 2 |
| 21 1 1 |
| 2 2 |
| 1 |
| 2 1|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1712.21
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1707.51 -1717.27
2 -1707.53 -1716.27
--------------------------------------
TOTAL -1707.52 -1716.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.250284 0.001812 0.175794 0.334749 0.245365 1264.40 1266.40 1.000
r(A<->C){all} 0.050589 0.000590 0.007641 0.096738 0.047964 685.11 773.46 1.000
r(A<->G){all} 0.134176 0.001526 0.063370 0.214946 0.129489 750.82 762.41 1.000
r(A<->T){all} 0.098342 0.001641 0.028027 0.178055 0.093666 502.26 704.97 1.000
r(C<->G){all} 0.056909 0.000472 0.016484 0.101004 0.054295 1067.93 1090.11 1.000
r(C<->T){all} 0.549150 0.003753 0.434502 0.672232 0.548398 749.37 834.14 1.000
r(G<->T){all} 0.110833 0.001213 0.047554 0.181260 0.108426 831.97 839.64 1.000
pi(A){all} 0.218899 0.000200 0.193835 0.250215 0.218719 921.45 1067.86 1.000
pi(C){all} 0.289509 0.000230 0.258141 0.316866 0.289559 1188.79 1241.56 1.000
pi(G){all} 0.296254 0.000233 0.267775 0.328260 0.296253 1256.51 1285.55 1.000
pi(T){all} 0.195338 0.000174 0.169284 0.220775 0.195149 995.68 1069.76 1.000
alpha{1,2} 0.078933 0.003422 0.000121 0.187542 0.069087 1229.64 1365.32 1.000
alpha{3} 1.766941 0.549644 0.560301 3.230937 1.631806 1186.32 1218.60 1.000
pinvar{all} 0.381516 0.014608 0.139158 0.603162 0.394980 1125.19 1145.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
8 -- ..***
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2080 0.692871 0.008480 0.686875 0.698867 2
8 782 0.260493 0.009422 0.253831 0.267155 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.059054 0.000221 0.032085 0.087605 0.057633 1.000 2
length{all}[2] 0.003173 0.000006 0.000002 0.008148 0.002630 1.000 2
length{all}[3] 0.010295 0.000021 0.002262 0.019235 0.009594 1.000 2
length{all}[4] 0.054556 0.000218 0.029131 0.085154 0.052480 1.000 2
length{all}[5] 0.033244 0.000138 0.012408 0.055546 0.031841 1.000 2
length{all}[6] 0.082235 0.000515 0.042469 0.127550 0.079283 1.000 2
length{all}[7] 0.009454 0.000038 0.000029 0.020619 0.008471 1.000 2
length{all}[8] 0.004140 0.000010 0.000024 0.010260 0.003318 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005967
Maximum standard deviation of split frequencies = 0.009422
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------69----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/------------------------------- C1 (1)
|
| /----------------------------- C4 (4)
|------------------------------------------+
+ \------------------ C5 (5)
|
| /- C2 (2)
\----+
\----- C3 (3)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
90 % credible set contains 2 trees
95 % credible set contains 2 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 819
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
6 ambiguity characters in seq. 2
6 ambiguity characters in seq. 3
12 ambiguity characters in seq. 4
12 ambiguity characters in seq. 5
4 sites are removed. 92 93 272 273
Sequences read..
Counting site patterns.. 0:00
129 patterns at 269 / 269 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
125904 bytes for conP
17544 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 111
188856 bytes for conP, adjusted
0.107418 0.137674 0.117644 0.047021 0.019654 0.004744 0.021537 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1772.348585
Iterating by ming2
Initial: fx= 1772.348585
x= 0.10742 0.13767 0.11764 0.04702 0.01965 0.00474 0.02154 0.30000 1.30000
1 h-m-p 0.0000 0.0001 189.4319 +CCYC 1770.441721 3 0.0001 21 | 0/9
2 h-m-p 0.0000 0.0005 2389.5940 ++CCCCC 1738.087643 4 0.0002 43 | 0/9
3 h-m-p 0.0001 0.0004 539.1544 +YYYYCCCCC 1720.585276 8 0.0003 68 | 0/9
4 h-m-p 0.0000 0.0001 2014.8084 +YYCCCCC 1703.558089 6 0.0001 91 | 0/9
5 h-m-p 0.0020 0.0134 98.8351 YCYCCC 1700.790975 5 0.0009 111 | 0/9
6 h-m-p 0.0005 0.0051 194.5859 +CYCYYCYYYY 1628.486968 10 0.0046 136 | 0/9
7 h-m-p 0.0000 0.0001 1122.1606 YYCC 1628.064005 3 0.0000 152 | 0/9
8 h-m-p 0.0046 0.0230 2.8465 YC 1627.986279 1 0.0026 165 | 0/9
9 h-m-p 0.0009 0.0170 8.2547 +YCCC 1627.378442 3 0.0027 183 | 0/9
10 h-m-p 0.0015 0.0119 15.1556 ++ 1618.007256 m 0.0119 195 | 0/9
11 h-m-p 0.7280 3.6401 0.0674 YYCCC 1614.168460 4 1.0185 213 | 0/9
12 h-m-p 0.8308 5.5817 0.0826 YCCCC 1612.151089 4 2.1491 241 | 0/9
13 h-m-p 1.1438 5.7188 0.1093 YCCCC 1610.242687 4 2.2423 269 | 0/9
14 h-m-p 0.3607 1.8034 0.2151 +YCCC 1609.237123 3 0.9210 296 | 0/9
15 h-m-p 1.0456 5.2279 0.1261 YCYC 1608.204237 3 1.9561 321 | 0/9
16 h-m-p 1.5975 7.9873 0.0979 CCC 1607.987012 2 1.6278 346 | 0/9
17 h-m-p 1.6000 8.0000 0.0281 CYC 1607.900870 2 2.0051 370 | 0/9
18 h-m-p 0.9889 8.0000 0.0570 YCC 1607.864141 2 1.5704 394 | 0/9
19 h-m-p 1.6000 8.0000 0.0156 CC 1607.861833 1 1.3619 417 | 0/9
20 h-m-p 1.6000 8.0000 0.0011 C 1607.861642 0 1.9005 438 | 0/9
21 h-m-p 1.6000 8.0000 0.0002 C 1607.861631 0 1.4040 459 | 0/9
22 h-m-p 1.6000 8.0000 0.0002 C 1607.861631 0 1.3490 480 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 C 1607.861631 0 1.9742 501 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 C 1607.861631 0 0.5224 522 | 0/9
25 h-m-p 0.6457 8.0000 0.0000 C 1607.861631 0 0.1636 543 | 0/9
26 h-m-p 0.1768 8.0000 0.0000 -C 1607.861631 0 0.0110 565 | 0/9
27 h-m-p 0.0160 8.0000 0.0000 ------------Y 1607.861631 0 0.0000 598
Out..
lnL = -1607.861631
599 lfun, 599 eigenQcodon, 4193 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 111
0.107418 0.137674 0.117644 0.047021 0.019654 0.004744 0.021537 2.491324 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 4.874423
np = 10
lnL0 = -1662.337080
Iterating by ming2
Initial: fx= 1662.337080
x= 0.10742 0.13767 0.11764 0.04702 0.01965 0.00474 0.02154 2.49132 0.57321 0.49224
1 h-m-p 0.0000 0.0001 89.2990 +YCYCCC 1662.030732 5 0.0001 24 | 0/10
2 h-m-p 0.0000 0.0019 399.3673 ++CYCCC 1659.774788 4 0.0002 47 | 0/10
3 h-m-p 0.0002 0.0008 287.7617 +YYYCCCC 1652.150709 6 0.0006 70 | 0/10
4 h-m-p 0.0000 0.0001 2212.8986 ++ 1641.482380 m 0.0001 83 | 0/10
5 h-m-p -0.0000 -0.0000 15108.7290
h-m-p: -7.70279946e-22 -3.85139973e-21 1.51087290e+04 1641.482380
.. | 0/10
6 h-m-p 0.0000 0.0001 1682.7557 YCYCCC 1632.243064 5 0.0000 114 | 0/10
7 h-m-p 0.0000 0.0001 236.4398 +YYCYCCC 1628.014532 6 0.0001 137 | 0/10
8 h-m-p 0.0000 0.0001 3875.4828 +CCCCC 1613.690458 4 0.0000 159 | 0/10
9 h-m-p 0.0001 0.0003 318.6494 +YYCCCC 1606.835532 5 0.0002 181 | 0/10
10 h-m-p 0.0005 0.0025 52.3122 CCCC 1605.942466 3 0.0007 200 | 0/10
11 h-m-p 0.0022 0.0112 13.5222 CCC 1605.902179 2 0.0005 217 | 0/10
12 h-m-p 0.0005 0.0209 11.9586 CC 1605.865136 1 0.0007 232 | 0/10
13 h-m-p 0.0037 0.1427 2.3434 YC 1605.845956 1 0.0029 246 | 0/10
14 h-m-p 0.0040 0.4521 1.6777 +++YYYYYYYC 1602.090742 7 0.2553 269 | 0/10
15 h-m-p 0.0012 0.0059 30.7148 YYC 1601.923380 2 0.0009 284 | 0/10
16 h-m-p 0.0462 2.4507 0.6061 +YCCC 1600.904339 3 0.4612 303 | 0/10
17 h-m-p 0.5038 4.8437 0.5549 YYC 1600.793745 2 0.3963 328 | 0/10
18 h-m-p 1.6000 8.0000 0.0656 YCC 1600.686469 2 1.1713 354 | 0/10
19 h-m-p 1.6000 8.0000 0.0106 CCC 1600.548495 2 1.9322 381 | 0/10
20 h-m-p 1.1359 7.4295 0.0180 CCC 1600.452432 2 1.5832 408 | 0/10
21 h-m-p 1.6000 8.0000 0.0127 YCC 1600.426780 2 1.2191 434 | 0/10
22 h-m-p 1.6000 8.0000 0.0015 CC 1600.423466 1 2.1028 459 | 0/10
23 h-m-p 1.6000 8.0000 0.0020 YC 1600.422705 1 1.1614 483 | 0/10
24 h-m-p 1.6000 8.0000 0.0008 YC 1600.422649 1 0.8071 507 | 0/10
25 h-m-p 1.6000 8.0000 0.0002 C 1600.422646 0 0.6055 530 | 0/10
26 h-m-p 1.6000 8.0000 0.0000 Y 1600.422646 0 0.8716 553 | 0/10
27 h-m-p 1.6000 8.0000 0.0000 ------Y 1600.422646 0 0.0001 582
Out..
lnL = -1600.422646
583 lfun, 1749 eigenQcodon, 8162 P(t)
Time used: 0:05
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 111
initial w for M2:NSpselection reset.
0.107418 0.137674 0.117644 0.047021 0.019654 0.004744 0.021537 2.547064 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.699183
np = 12
lnL0 = -1674.566653
Iterating by ming2
Initial: fx= 1674.566653
x= 0.10742 0.13767 0.11764 0.04702 0.01965 0.00474 0.02154 2.54706 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0003 100.0304 ++YYYC 1673.778545 3 0.0002 22 | 0/12
2 h-m-p 0.0000 0.0016 540.2129 CYCCC 1673.319871 4 0.0000 44 | 0/12
3 h-m-p 0.0001 0.0013 111.0246 +YCYCCCC 1671.065939 6 0.0006 70 | 0/12
4 h-m-p 0.0001 0.0003 370.5489 +YYYCC 1667.744547 4 0.0003 91 | 0/12
5 h-m-p 0.0000 0.0001 1673.2586 ++ 1655.542779 m 0.0001 106 | 0/12
6 h-m-p -0.0000 -0.0000 89.0350
h-m-p: -2.28839002e-20 -1.14419501e-19 8.90349950e+01 1655.542779
.. | 0/12
7 h-m-p 0.0000 0.0016 851.5553 +CYCCC 1650.834230 4 0.0000 141 | 0/12
8 h-m-p 0.0003 0.0015 109.8714 ++ 1641.218035 m 0.0015 156 | 1/12
9 h-m-p 0.0013 0.0063 54.7116 YCYCCC 1640.795876 5 0.0006 179 | 1/12
10 h-m-p 0.0001 0.0008 478.8226 +YCYCCC 1636.297271 5 0.0005 203 | 1/12
11 h-m-p 0.0005 0.0045 460.3084 YCCC 1628.654519 3 0.0010 223 | 1/12
12 h-m-p 0.0003 0.0013 782.4226 YCCC 1623.186519 3 0.0004 243 | 1/12
13 h-m-p 0.0016 0.0078 86.8800 YCYCCCC 1617.745163 6 0.0036 268 | 0/12
14 h-m-p 0.0011 0.0057 162.7844 YCYCCC 1616.602852 5 0.0001 291 | 0/12
15 h-m-p 0.0026 0.0364 7.5549 CCC 1616.568826 2 0.0009 310 | 0/12
16 h-m-p 0.0023 0.4379 2.7834 +++CCYCCC 1607.945494 5 0.3089 338 | 0/12
17 h-m-p 0.1643 0.8214 1.1220 +CCC 1603.391965 2 0.5973 358 | 0/12
18 h-m-p 0.0086 0.0432 3.9076 ++ 1602.629088 m 0.0432 373 | 1/12
19 h-m-p 0.0356 2.1498 1.2950 ++CCCC 1601.401514 3 0.6397 396 | 1/12
20 h-m-p 0.6250 6.4683 1.3254 YCCCC 1600.967897 4 0.3969 418 | 1/12
21 h-m-p 1.6000 8.0000 0.1671 CYC 1600.653129 2 1.6207 436 | 1/12
22 h-m-p 0.6485 3.2424 0.1719 CCCC 1600.445799 3 0.9510 468 | 1/12
23 h-m-p 1.6000 8.0000 0.0487 YC 1600.431026 1 0.7368 495 | 1/12
24 h-m-p 1.1184 8.0000 0.0321 YC 1600.424713 1 0.6586 522 | 1/12
25 h-m-p 1.6000 8.0000 0.0075 CC 1600.423015 1 1.9022 550 | 1/12
26 h-m-p 1.6000 8.0000 0.0025 C 1600.422680 0 1.5809 576 | 1/12
27 h-m-p 1.6000 8.0000 0.0009 C 1600.422647 0 1.7829 602 | 1/12
28 h-m-p 1.6000 8.0000 0.0003 Y 1600.422646 0 1.2230 628 | 1/12
29 h-m-p 1.6000 8.0000 0.0000 Y 1600.422646 0 1.2025 654 | 1/12
30 h-m-p 1.6000 8.0000 0.0000 C 1600.422646 0 1.4812 680 | 1/12
31 h-m-p 1.6000 8.0000 0.0000 -------Y 1600.422646 0 0.0000 713
Out..
lnL = -1600.422646
714 lfun, 2856 eigenQcodon, 14994 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1610.259878 S = -1537.925100 -63.456845
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 129 patterns 0:10
did 20 / 129 patterns 0:10
did 30 / 129 patterns 0:11
did 40 / 129 patterns 0:11
did 50 / 129 patterns 0:11
did 60 / 129 patterns 0:11
did 70 / 129 patterns 0:11
did 80 / 129 patterns 0:11
did 90 / 129 patterns 0:11
did 100 / 129 patterns 0:11
did 110 / 129 patterns 0:11
did 120 / 129 patterns 0:11
did 129 / 129 patterns 0:11
Time used: 0:11
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 111
0.107418 0.137674 0.117644 0.047021 0.019654 0.004744 0.021537 2.547055 0.331355 0.382499 0.043477 0.108536 0.181731
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 13.390053
np = 13
lnL0 = -1607.210922
Iterating by ming2
Initial: fx= 1607.210922
x= 0.10742 0.13767 0.11764 0.04702 0.01965 0.00474 0.02154 2.54706 0.33136 0.38250 0.04348 0.10854 0.18173
1 h-m-p 0.0000 0.0002 83.3701 +YCYCCC 1606.836414 5 0.0001 27 | 0/13
2 h-m-p 0.0000 0.0001 485.4097 +CCC 1605.814272 2 0.0001 48 | 0/13
3 h-m-p 0.0000 0.0002 130.4912 ++ 1604.599005 m 0.0002 64 | 1/13
4 h-m-p 0.0004 0.0038 33.8978 +YYC 1604.075423 2 0.0016 83 | 1/13
5 h-m-p 0.0001 0.0005 148.8478 +YCCC 1603.294093 3 0.0004 105 | 1/13
6 h-m-p 0.0000 0.0000 228.9500 ++ 1603.178539 m 0.0000 121 | 2/13
7 h-m-p 0.0002 0.0116 27.3431 +CC 1603.028638 1 0.0009 140 | 2/13
8 h-m-p 0.0016 0.0081 8.7586 CCC 1602.967273 2 0.0015 160 | 2/13
9 h-m-p 0.0040 0.1245 3.1584 CCC 1602.875660 2 0.0053 180 | 2/13
10 h-m-p 0.0025 0.0368 6.8106 +YYCC 1602.443095 3 0.0078 201 | 2/13
11 h-m-p 0.0267 1.0699 1.9960 ++YCCC 1601.435710 3 0.2961 224 | 1/13
12 h-m-p 0.0284 0.1419 15.5869 -YC 1601.428894 1 0.0010 242 | 1/13
13 h-m-p 0.0027 0.0340 5.5160 ++ 1600.958434 m 0.0340 258 | 2/13
14 h-m-p 1.2596 8.0000 0.1490 CCCC 1600.037232 3 1.1900 280 | 2/13
15 h-m-p 0.6407 8.0000 0.2767 CCC 1599.912938 2 0.7594 311 | 2/13
16 h-m-p 0.9121 8.0000 0.2304 YCC 1599.870787 2 0.5526 341 | 2/13
17 h-m-p 1.6000 8.0000 0.0693 YCC 1599.841503 2 0.8882 371 | 2/13
18 h-m-p 1.6000 8.0000 0.0327 CC 1599.827121 1 1.5193 400 | 2/13
19 h-m-p 1.6000 8.0000 0.0144 YC 1599.825227 1 1.2277 428 | 2/13
20 h-m-p 1.6000 8.0000 0.0034 YC 1599.824942 1 1.0653 456 | 2/13
21 h-m-p 1.3672 8.0000 0.0027 C 1599.824881 0 1.6325 483 | 2/13
22 h-m-p 1.6000 8.0000 0.0007 Y 1599.824880 0 1.0202 510 | 2/13
23 h-m-p 1.6000 8.0000 0.0001 Y 1599.824880 0 1.0859 537 | 2/13
24 h-m-p 1.6000 8.0000 0.0000 C 1599.824880 0 0.5560 564 | 2/13
25 h-m-p 0.8857 8.0000 0.0000 -C 1599.824880 0 0.0466 592 | 2/13
26 h-m-p 0.0503 8.0000 0.0000 ---Y 1599.824880 0 0.0002 622
Out..
lnL = -1599.824880
623 lfun, 2492 eigenQcodon, 13083 P(t)
Time used: 0:16
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 111
0.107418 0.137674 0.117644 0.047021 0.019654 0.004744 0.021537 2.493918 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.616616
np = 10
lnL0 = -1621.727448
Iterating by ming2
Initial: fx= 1621.727448
x= 0.10742 0.13767 0.11764 0.04702 0.01965 0.00474 0.02154 2.49392 0.66567 1.54913
1 h-m-p 0.0000 0.0002 81.1660 ++YCYC 1621.326201 3 0.0001 21 | 0/10
2 h-m-p 0.0000 0.0029 434.5550 YCCC 1620.806488 3 0.0000 39 | 0/10
3 h-m-p 0.0002 0.0010 89.1241 YCCCC 1619.917703 4 0.0004 59 | 0/10
4 h-m-p 0.0002 0.0009 174.2788 ++ 1615.390433 m 0.0009 72 | 0/10
5 h-m-p 0.0000 0.0000 3411.2409
h-m-p: 3.08469542e-21 1.54234771e-20 3.41124093e+03 1615.390433
.. | 0/10
6 h-m-p 0.0000 0.0002 427.8203 +CCC 1613.319450 2 0.0000 100 | 0/10
7 h-m-p 0.0002 0.0027 70.9231 CYCC 1612.816699 3 0.0003 118 | 0/10
8 h-m-p 0.0001 0.0004 332.6243 +YYCCC 1610.762073 4 0.0002 138 | 0/10
9 h-m-p 0.0002 0.0011 143.7623 YCYCCC 1608.730964 5 0.0005 159 | 0/10
10 h-m-p 0.0001 0.0008 502.7346 CYCCC 1605.241562 4 0.0003 179 | 0/10
11 h-m-p 0.0001 0.0007 349.2402 CYCCCC 1603.272104 5 0.0002 201 | 0/10
12 h-m-p 0.0025 0.0126 19.3810 CYC 1603.172020 2 0.0006 217 | 0/10
13 h-m-p 0.0022 0.0543 5.3364 CCC 1603.129862 2 0.0025 234 | 0/10
14 h-m-p 0.0009 0.2547 15.3836 +++YC 1601.588721 1 0.0393 251 | 0/10
15 h-m-p 0.5042 2.5210 0.3769 CCCC 1601.156522 3 0.8097 270 | 0/10
16 h-m-p 0.5431 4.1899 0.5620 CCC 1600.915550 2 0.5572 297 | 0/10
17 h-m-p 1.3576 8.0000 0.2307 CCC 1600.744332 2 1.3418 324 | 0/10
18 h-m-p 0.5718 3.2028 0.5412 YCYCCC 1600.072880 5 1.6482 356 | 0/10
19 h-m-p 0.7243 3.6216 0.1828 YYYC 1600.008800 3 0.6516 382 | 0/10
20 h-m-p 0.3950 1.9752 0.2506 YYC 1599.972871 2 0.3225 407 | 0/10
21 h-m-p 1.6000 8.0000 0.0434 YC 1599.970516 1 0.3164 431 | 0/10
22 h-m-p 0.9232 8.0000 0.0149 C 1599.969248 0 0.9232 454 | 0/10
23 h-m-p 1.6000 8.0000 0.0023 C 1599.968966 0 1.2886 477 | 0/10
24 h-m-p 1.6000 8.0000 0.0014 C 1599.968864 0 2.0906 500 | 0/10
25 h-m-p 1.6000 8.0000 0.0013 Y 1599.968856 0 1.2612 523 | 0/10
26 h-m-p 1.6000 8.0000 0.0001 Y 1599.968856 0 0.8638 546 | 0/10
27 h-m-p 1.6000 8.0000 0.0000 C 1599.968856 0 1.3199 569 | 0/10
28 h-m-p 1.6000 8.0000 0.0000 Y 1599.968856 0 0.4000 592 | 0/10
29 h-m-p 0.6034 8.0000 0.0000 ---------Y 1599.968856 0 0.0000 624
Out..
lnL = -1599.968856
625 lfun, 6875 eigenQcodon, 43750 P(t)
Time used: 0:32
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 111
initial w for M8:NSbetaw>1 reset.
0.107418 0.137674 0.117644 0.047021 0.019654 0.004744 0.021537 2.502783 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.222911
np = 12
lnL0 = -1624.627654
Iterating by ming2
Initial: fx= 1624.627654
x= 0.10742 0.13767 0.11764 0.04702 0.01965 0.00474 0.02154 2.50278 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0007 190.5132 +++YCCC 1614.867231 3 0.0006 25 | 0/12
2 h-m-p 0.0000 0.0001 217.3780 ++ 1612.188269 m 0.0001 40 | 1/12
3 h-m-p 0.0000 0.0000 2058.1453 YCYCCC 1609.590538 5 0.0000 63 | 1/12
4 h-m-p 0.0001 0.0003 163.0772 +CCYC 1607.462807 3 0.0003 84 | 1/12
5 h-m-p 0.0001 0.0007 329.8992 YCYCCC 1603.076604 5 0.0003 107 | 1/12
6 h-m-p 0.0005 0.0023 97.3615 CYCCCC 1601.098282 5 0.0007 131 | 1/12
7 h-m-p 0.0019 0.0096 22.6389 CCC 1600.946012 2 0.0006 150 | 0/12
8 h-m-p 0.0004 0.0115 31.0610 YCCC 1600.883943 3 0.0002 170 | 0/12
9 h-m-p 0.0013 0.0369 4.6299 YC 1600.873436 1 0.0009 186 | 0/12
10 h-m-p 0.0019 0.2610 2.0703 YC 1600.861499 1 0.0041 202 | 0/12
11 h-m-p 0.0008 0.0803 10.1455 ++CCCC 1600.618702 3 0.0185 225 | 0/12
12 h-m-p 0.5529 2.7643 0.2926 CCCC 1600.321218 3 0.8163 246 | 0/12
13 h-m-p 0.6415 4.4325 0.3724 CCC 1600.265144 2 0.5716 277 | 0/12
14 h-m-p 0.5326 2.6632 0.3079 +YC 1600.171731 1 1.4053 306 | 0/12
15 h-m-p 0.1619 0.8095 0.4985 ++ 1600.060827 m 0.8095 333 | 1/12
16 h-m-p 0.2186 1.4728 0.7538 CCCC 1600.005938 3 0.2707 366 | 1/12
17 h-m-p 1.6000 8.0000 0.0284 YCC 1599.985585 2 1.0307 395 | 1/12
18 h-m-p 1.2401 8.0000 0.0236 YC 1599.983896 1 0.9102 422 | 1/12
19 h-m-p 1.6000 8.0000 0.0113 YC 1599.982605 1 1.1530 449 | 1/12
20 h-m-p 1.6000 8.0000 0.0011 +YC 1599.979806 1 5.2665 477 | 1/12
21 h-m-p 0.1436 2.7201 0.0398 +++ 1599.971116 m 2.7201 504 | 2/12
22 h-m-p 1.6000 8.0000 0.0655 -YC 1599.969604 1 0.1781 532 | 2/12
23 h-m-p 1.6000 8.0000 0.0033 YC 1599.968872 1 0.9372 558 | 2/12
24 h-m-p 1.6000 8.0000 0.0009 Y 1599.968863 0 1.0315 583 | 2/12
25 h-m-p 1.6000 8.0000 0.0003 Y 1599.968863 0 0.9642 608 | 2/12
26 h-m-p 1.6000 8.0000 0.0000 Y 1599.968863 0 0.9191 633 | 2/12
27 h-m-p 1.6000 8.0000 0.0000 -C 1599.968863 0 0.1163 659 | 2/12
28 h-m-p 0.1281 8.0000 0.0000 C 1599.968863 0 0.0320 684 | 2/12
29 h-m-p 0.0348 8.0000 0.0000 -----Y 1599.968863 0 0.0000 714
Out..
lnL = -1599.968863
715 lfun, 8580 eigenQcodon, 55055 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1611.624416 S = -1538.320483 -65.111397
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 129 patterns 0:52
did 20 / 129 patterns 0:52
did 30 / 129 patterns 0:52
did 40 / 129 patterns 0:52
did 50 / 129 patterns 0:53
did 60 / 129 patterns 0:53
did 70 / 129 patterns 0:53
did 80 / 129 patterns 0:53
did 90 / 129 patterns 0:53
did 100 / 129 patterns 0:54
did 110 / 129 patterns 0:54
did 120 / 129 patterns 0:54
did 129 / 129 patterns 0:54
Time used: 0:54
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=273
D_melanogaster_7B2-PA MLFRSQSVYMMVAMLVVALSGYQVQSYSAKDILADVLMTDLLNRMDKDMQ
D_sechellia_7B2-PA MLFRSQIVHMMVAMLVVASSGYQVQSYSSKDIFADALLTDLLNRMDNDMQ
D_simulans_7B2-PA MLFRSQSVHMMVAMLVAASSCYQVQSYSSKDIFADALLTDLLNRMDNDMQ
D_yakuba_7B2-PA MLFCSQNVYMMVAMLVVALSGYQVQSYGSKDILADALLTDLLNRMDNDMQ
D_erecta_7B2-PA MLFRSQSVHMMVAMLVVASSGYQVQSYGSKDILADVLLTDLLNRMDNDMQ
*** ** *:*******.* * ******.:***:**.*:********:***
D_melanogaster_7B2-PA VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
D_sechellia_7B2-PA VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
D_simulans_7B2-PA VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP
D_yakuba_7B2-PA VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSG--SGAASHP
D_erecta_7B2-PA VGYYDVGNEAAADSKDNVDLVSRSEYARLCEGGSDCILQSG--SGAASHP
************.*****************:********** *******
D_melanogaster_7B2-PA SLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
D_sechellia_7B2-PA SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
D_simulans_7B2-PA SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC
D_yakuba_7B2-PA SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIAKNDAGLPAYCNPPNPC
D_erecta_7B2-PA SLRDHEFVQHSSLWGHQFISGGMGEGPNRYPAIVKNDAGLPAYCNPPNPC
****.**:***********************:*.****************
D_melanogaster_7B2-PA PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
D_sechellia_7B2-PA PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
D_simulans_7B2-PA PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
D_yakuba_7B2-PA PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
D_erecta_7B2-PA PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD
**************************************************
D_melanogaster_7B2-PA VGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVMPDPRLDDAVI
D_sechellia_7B2-PA VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
D_simulans_7B2-PA VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM
D_yakuba_7B2-PA TGSEKGDLNSAVEQYILQMGQENSLNNVNSLVKKGGYPVMPDPRLDDAVM
D_erecta_7B2-PA TGAEKGDLHSAVEQYILQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVL
.*.:****:*******:**************.**.**************:
D_melanogaster_7B2-PA NPFLQGDRLPIAAKKGNLLFH--
D_sechellia_7B2-PA NPFLQGDRLPIAAKKGNLLFH--
D_simulans_7B2-PA NPFLQGDRLPIAAKKGNLLFH--
D_yakuba_7B2-PA NPFLQGDRLPIAAKKGNLLFHoo
D_erecta_7B2-PA NPFLQGDRLPIAAKKGNLLFHoo
*********************
>D_melanogaster_7B2-PA ATGTTGTTCCGTTCGCAAAGTGTGTACATGATGGTGGCGATGCTCGTGGT CGCCTTGAGTGGCTACCAGGTGCAGTCCTATAGCGCCAAGGATATTCTTG CCGATGTCTTGATGACGGATCTGCTGAATCGCATGGACAAAGACATGCAG GTGGGCTATTACGACGTGGGCAACGAGGCAGCCGCTGGCTCCAAGGACAA CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCATCCT TCGCTGCGGGATGACGAGTTTCTGCAGCACAGTTCGCTGTGGGGTCACCA GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACAGGTATCCCACTATAG TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC CCTGAGGGCTACGACATGGAGACGCAAGGCGGCAGCTGCATTGTCGACTT CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGTA CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCTGAT GTGGGCGGCGACAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT GCAGATGGGCCAGGAGAACAGCCTGAACAACGTTAACAGCCTGGCTAAGA AGGCCGGATATCCTGTGATGCCCGATCCTCGGCTGGACGACGCGGTCATA AACCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA CCTTTTATTCCAC------ >D_sechellia_7B2-PA ATGTTGTTCCGTTCGCAAATTGTGCACATGATGGTGGCGATGCTCGTGGT CGCCTCGAGTGGCTACCAGGTGCAGTCCTATAGCTCCAAGGATATTTTTG CCGATGCCTTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG GTGGGCTACTACGACGTGGGCAACGAGGCAGCCGCTGGCTCCAAGGACAA CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCACCCT TCGCTGCGGGACCACGAGTTCCTGCAGCACAGCTCGCTGTGGGGTCACCA GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACCGGTATCCCACCATAG TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC CCCGAGGGCTACGACATGGAGACCCAAGGCGGCAGCTGCATTGTGGACTT CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGCA CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT GTCGGTGCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT GCAGATGGGCCAGGAGAACAGCCTGAACAACGTTAACAGCCTGGTTAAAA AGGCCGGATACCCTGTGATGCCCGATCCTCGCCTGGACGACGCGGTCATG AATCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA CCTTCTATTCCAC------ >D_simulans_7B2-PA ATGTTGTTCCGTTCGCAAAGTGTGCACATGATGGTGGCGATGCTCGTGGC CGCCTCGAGCTGCTACCAGGTGCAGTCCTATAGCTCCAAGGATATTTTTG CCGATGCCTTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG GTGGGCTACTACGACGTGGGCAACGAAGCAGCCGCTGGCTCCAAGGACAA CGTGGACCTGGTCTCCCGGTCGGAGTACGCGAGGCTGTGTGACGGCGGAA GCGACTGCATCCTGCAATCGGGCTCGGCATCGGGAGCTGCCTCCCACCCT TCGCTGCGGGACCACGAGTTCCTGCAGCACAGCTCGCTGTGGGGTCACCA GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAACCGGTATCCCACCATAG TGAAGAACGACGCCGGCCTGCCTGCCTACTGCAACCCTCCTAATCCCTGC CCCGAGGGCTACGACATGGAGACCCAAGGCGGCAGCTGCATTGTGGACTT CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCCGCTCAGGACTGCA CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT GTCGGTGCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCAT GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTCAAAA AGGCCGGATACCCTGTGATGCCCGATCCTCGCCTGGACGACGCGGTCATG AATCCGTTCCTCCAGGGCGACCGCTTGCCCATAGCCGCCAAGAAGGGCAA CCTTCTATTCCAC------ >D_yakuba_7B2-PA ATGTTGTTCTGTTCGCAAAATGTGTACATGATGGTTGCGATGCTTGTGGT CGCCTTAAGTGGCTACCAGGTTCAGTCCTATGGCTCCAAGGATATTTTGG CCGATGCCCTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG GTAGGCTACTACGATGTTGGCAACGAGGCAGCTGCTGGCTCCAAGGACAA TGTGGACCTGGTCTCCCGATCGGAATACGCGAGGCTGTGTGATGGGGGAA GCGACTGCATCTTGCAATCGGGA------TCGGGAGCAGCCTCCCATCCT TCGTTGAGGGACCACGAGTTCCTGCAGCACAGCTCCCTGTGGGGTCACCA GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAATAGGTATCCTACCATAG CGAAGAATGACGCCGGTCTGCCTGCATACTGCAACCCTCCAAACCCTTGC CCCGAGGGCTATGACATGGAGACCCAAGGTGGCAGCTGCATCGTGGACTT CGAAAACACGGCCATCTTCAGCCGGGAGTTCCAGGCTGCACAGGACTGCA CCTGCGATAACGAACATATGTTCGACTGCTCGGAACAAGATAGTGCCGAT ACCGGCTCCGAGAAGGGTGACCTGAACTCCGCCGTGGAGCAGTACATCCT GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTTAAGA AGGGCGGGTACCCAGTGATGCCCGATCCTCGTCTGGATGACGCGGTTATG AACCCGTTTCTCCAGGGCGATCGCTTGCCCATAGCCGCCAAAAAGGGCAA CCTTCTATTCCAC------ >D_erecta_7B2-PA ATGTTGTTCCGTTCGCAAAGTGTGCACATGATGGTTGCGATGCTGGTGGT GGCCTCAAGTGGCTACCAGGTGCAGTCCTATGGCTCCAAGGATATTTTGG CCGATGTCCTGCTGACGGATCTGCTCAATCGCATGGACAACGACATGCAG GTGGGCTACTACGACGTGGGCAACGAGGCAGCTGCTGACTCCAAGGACAA TGTGGACCTGGTCTCCCGATCGGAGTACGCGAGGCTGTGTGAGGGGGGAA GCGACTGCATCTTGCAATCGGGA------TCGGGAGCAGCCTCCCATCCT TCGTTGAGGGACCACGAGTTCGTGCAGCACAGCTCGCTGTGGGGTCACCA GTTCATCTCCGGCGGAATGGGAGAGGGTCCCAATAGGTATCCTGCCATAG TGAAGAACGACGCCGGTCTGCCAGCCTACTGCAACCCTCCTAATCCATGC CCCGAGGGCTATGACATGGAGACCCAAGGTGGCAGCTGCATCGTAGACTT CGAAAACACGGCCATCTTTAGCCGGGAGTTCCAGGCCGCACAGGACTGCA CCTGCGACAACGAGCATATGTTCGACTGCTCGGAACAGGATAGTGCCGAT ACCGGCGCCGAGAAGGGTGACCTGCACTCCGCCGTGGAGCAGTACATCCT GCAGATGGGCCAGGAGAACAGCCTGAACAACGTGAACAGCCTGGTGAAGA AGGCCGGATATCCAGTGATGCCCGATCCTCGCCTGGATGACGCGGTTTTG AACCCGTTCCTCCAGGGCGATCGCTTGCCTATAGCCGCCAAGAAGGGCAA CCTTCTATTCCAC------
>D_melanogaster_7B2-PA MLFRSQSVYMMVAMLVVALSGYQVQSYSAKDILADVLMTDLLNRMDKDMQ VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP SLRDDEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD VGGDKGDLNSAVEQYIMQMGQENSLNNVNSLAKKAGYPVMPDPRLDDAVI NPFLQGDRLPIAAKKGNLLFH >D_sechellia_7B2-PA MLFRSQIVHMMVAMLVVASSGYQVQSYSSKDIFADALLTDLLNRMDNDMQ VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM NPFLQGDRLPIAAKKGNLLFH >D_simulans_7B2-PA MLFRSQSVHMMVAMLVAASSCYQVQSYSSKDIFADALLTDLLNRMDNDMQ VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSGSASGAASHP SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIVKNDAGLPAYCNPPNPC PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD VGAEKGDLNSAVEQYIMQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVM NPFLQGDRLPIAAKKGNLLFH >D_yakuba_7B2-PA MLFCSQNVYMMVAMLVVALSGYQVQSYGSKDILADALLTDLLNRMDNDMQ VGYYDVGNEAAAGSKDNVDLVSRSEYARLCDGGSDCILQSG--SGAASHP SLRDHEFLQHSSLWGHQFISGGMGEGPNRYPTIAKNDAGLPAYCNPPNPC PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD TGSEKGDLNSAVEQYILQMGQENSLNNVNSLVKKGGYPVMPDPRLDDAVM NPFLQGDRLPIAAKKGNLLFH >D_erecta_7B2-PA MLFRSQSVHMMVAMLVVASSGYQVQSYGSKDILADVLLTDLLNRMDNDMQ VGYYDVGNEAAADSKDNVDLVSRSEYARLCEGGSDCILQSG--SGAASHP SLRDHEFVQHSSLWGHQFISGGMGEGPNRYPAIVKNDAGLPAYCNPPNPC PEGYDMETQGGSCIVDFENTAIFSREFQAAQDCTCDNEHMFDCSEQDSAD TGAEKGDLHSAVEQYILQMGQENSLNNVNSLVKKAGYPVMPDPRLDDAVL NPFLQGDRLPIAAKKGNLLFH
#NEXUS
[ID: 8194431641]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_7B2-PA
D_sechellia_7B2-PA
D_simulans_7B2-PA
D_yakuba_7B2-PA
D_erecta_7B2-PA
;
end;
begin trees;
translate
1 D_melanogaster_7B2-PA,
2 D_sechellia_7B2-PA,
3 D_simulans_7B2-PA,
4 D_yakuba_7B2-PA,
5 D_erecta_7B2-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.05763285,(4:0.05247974,5:0.03184146)1.000:0.07928307,(2:0.002629884,3:0.009594101)0.693:0.008470955);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.05763285,(4:0.05247974,5:0.03184146):0.07928307,(2:0.002629884,3:0.009594101):0.008470955);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1707.51 -1717.27
2 -1707.53 -1716.27
--------------------------------------
TOTAL -1707.52 -1716.89
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/1/7B2-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.250284 0.001812 0.175794 0.334749 0.245365 1264.40 1266.40 1.000
r(A<->C){all} 0.050589 0.000590 0.007641 0.096738 0.047964 685.11 773.46 1.000
r(A<->G){all} 0.134176 0.001526 0.063370 0.214946 0.129489 750.82 762.41 1.000
r(A<->T){all} 0.098342 0.001641 0.028027 0.178055 0.093666 502.26 704.97 1.000
r(C<->G){all} 0.056909 0.000472 0.016484 0.101004 0.054295 1067.93 1090.11 1.000
r(C<->T){all} 0.549150 0.003753 0.434502 0.672232 0.548398 749.37 834.14 1.000
r(G<->T){all} 0.110833 0.001213 0.047554 0.181260 0.108426 831.97 839.64 1.000
pi(A){all} 0.218899 0.000200 0.193835 0.250215 0.218719 921.45 1067.86 1.000
pi(C){all} 0.289509 0.000230 0.258141 0.316866 0.289559 1188.79 1241.56 1.000
pi(G){all} 0.296254 0.000233 0.267775 0.328260 0.296253 1256.51 1285.55 1.000
pi(T){all} 0.195338 0.000174 0.169284 0.220775 0.195149 995.68 1069.76 1.000
alpha{1,2} 0.078933 0.003422 0.000121 0.187542 0.069087 1229.64 1365.32 1.000
alpha{3} 1.766941 0.549644 0.560301 3.230937 1.631806 1186.32 1218.60 1.000
pinvar{all} 0.381516 0.014608 0.139158 0.603162 0.394980 1125.19 1145.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/1/7B2-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 269
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 | Ser TCT 0 0 0 0 0 | Tyr TAT 4 2 2 3 4 | Cys TGT 2 1 1 2 1
TTC 8 9 9 8 8 | TCC 6 7 7 9 7 | TAC 7 8 8 8 6 | TGC 6 7 8 7 7
Leu TTA 1 0 0 1 0 | TCA 0 0 0 0 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 4 3 3 5 6 | TCG 7 8 8 6 7 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 1 1 2 1 | Pro CCT 7 6 6 6 6 | His CAT 2 1 1 2 2 | Arg CGT 1 1 1 1 1
CTC 2 3 3 2 2 | CCC 5 6 6 4 3 | CAC 3 6 6 4 6 | CGC 2 3 3 2 3
CTA 0 1 1 1 1 | CCA 0 0 0 2 3 | Gln CAA 3 3 3 4 3 | CGA 0 0 0 1 1
CTG 13 13 13 13 13 | CCG 1 1 1 1 1 | CAG 12 12 12 11 12 | CGG 4 4 4 1 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 2 3 2 1 1 | Thr ACT 1 0 0 0 0 | Asn AAT 2 3 3 5 4 | Ser AGT 4 2 2 2 3
ATC 4 4 4 5 5 | ACC 1 3 3 4 3 | AAC 14 14 14 13 12 | AGC 6 7 8 6 6
ATA 3 2 2 2 2 | ACA 0 0 0 0 0 | Lys AAA 1 1 1 1 0 | Arg AGA 0 0 0 0 0
Met ATG 13 13 13 12 11 | ACG 3 2 2 2 2 | AAG 8 7 7 7 8 | AGG 2 1 1 3 3
----------------------------------------------------------------------------------------------------------------------
Val GTT 1 2 0 5 2 | Ala GCT 5 3 3 3 2 | Asp GAT 7 6 6 11 8 | Gly GGT 3 4 4 5 5
GTC 5 4 4 2 2 | GCC 13 15 16 10 14 | GAC 19 18 18 13 16 | GGC 16 14 13 13 11
GTA 0 0 0 1 1 | GCA 1 1 1 4 3 | Glu GAA 2 2 3 4 2 | GGA 5 5 5 5 6
GTG 11 11 12 7 13 | GCG 3 3 3 4 3 | GAG 10 11 10 9 12 | GGG 0 0 0 2 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_7B2-PA
position 1: T:0.17472 C:0.21190 A:0.23792 G:0.37546
position 2: T:0.26022 C:0.19703 A:0.34944 G:0.19331
position 3: T:0.16357 C:0.43494 A:0.05948 G:0.34201
Average T:0.19950 C:0.28129 A:0.21561 G:0.30359
#2: D_sechellia_7B2-PA
position 1: T:0.17472 C:0.22677 A:0.23048 G:0.36803
position 2: T:0.26022 C:0.20446 A:0.34944 G:0.18587
position 3: T:0.13383 C:0.47584 A:0.05576 G:0.33457
Average T:0.18959 C:0.30235 A:0.21190 G:0.29616
#3: D_simulans_7B2-PA
position 1: T:0.17844 C:0.22677 A:0.23048 G:0.36431
position 2: T:0.25279 C:0.20818 A:0.34944 G:0.18959
position 3: T:0.12268 C:0.48327 A:0.05948 G:0.33457
Average T:0.18463 C:0.30607 A:0.21314 G:0.29616
#4: D_yakuba_7B2-PA
position 1: T:0.18959 C:0.21190 A:0.23420 G:0.36431
position 2: T:0.25279 C:0.20446 A:0.35316 G:0.18959
position 3: T:0.18216 C:0.40892 A:0.09665 G:0.31227
Average T:0.20818 C:0.27509 A:0.22800 G:0.28872
#5: D_erecta_7B2-PA
position 1: T:0.18216 C:0.21933 A:0.22305 G:0.37546
position 2: T:0.25651 C:0.20446 A:0.35316 G:0.18587
position 3: T:0.15242 C:0.41264 A:0.08550 G:0.34944
Average T:0.19703 C:0.27881 A:0.22057 G:0.30359
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 5 | Ser S TCT 0 | Tyr Y TAT 15 | Cys C TGT 7
TTC 42 | TCC 36 | TAC 37 | TGC 35
Leu L TTA 2 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 21 | TCG 36 | TAG 0 | Trp W TGG 5
------------------------------------------------------------------------------
Leu L CTT 7 | Pro P CCT 31 | His H CAT 8 | Arg R CGT 5
CTC 12 | CCC 24 | CAC 25 | CGC 13
CTA 4 | CCA 5 | Gln Q CAA 16 | CGA 2
CTG 65 | CCG 5 | CAG 59 | CGG 14
------------------------------------------------------------------------------
Ile I ATT 9 | Thr T ACT 1 | Asn N AAT 17 | Ser S AGT 13
ATC 22 | ACC 14 | AAC 67 | AGC 33
ATA 11 | ACA 0 | Lys K AAA 4 | Arg R AGA 0
Met M ATG 62 | ACG 11 | AAG 37 | AGG 10
------------------------------------------------------------------------------
Val V GTT 10 | Ala A GCT 16 | Asp D GAT 38 | Gly G GGT 21
GTC 17 | GCC 68 | GAC 84 | GGC 67
GTA 2 | GCA 10 | Glu E GAA 13 | GGA 26
GTG 54 | GCG 16 | GAG 52 | GGG 3
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17993 C:0.21933 A:0.23123 G:0.36952
position 2: T:0.25651 C:0.20372 A:0.35093 G:0.18885
position 3: T:0.15093 C:0.44312 A:0.07138 G:0.33457
Average T:0.19579 C:0.28872 A:0.21784 G:0.29765
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_7B2-PA
D_sechellia_7B2-PA 0.1770 (0.0211 0.1191)
D_simulans_7B2-PA 0.1558 (0.0227 0.1458) 0.2154 (0.0048 0.0223)
D_yakuba_7B2-PA 0.0719 (0.0313 0.4347) 0.0568 (0.0194 0.3424) 0.0629 (0.0227 0.3612)
D_erecta_7B2-PA 0.1087 (0.0338 0.3112) 0.0865 (0.0211 0.2440) 0.0901 (0.0227 0.2524) 0.1377 (0.0227 0.1651)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 111
lnL(ntime: 7 np: 9): -1607.861631 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.117418 0.145604 0.108120 0.062476 0.016064 0.004230 0.023194 2.491324 0.086953
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.47711
(1: 0.117418, (4: 0.108120, 5: 0.062476): 0.145604, (2: 0.004230, 3: 0.023194): 0.016064);
(D_melanogaster_7B2-PA: 0.117418, (D_yakuba_7B2-PA: 0.108120, D_erecta_7B2-PA: 0.062476): 0.145604, (D_sechellia_7B2-PA: 0.004230, D_simulans_7B2-PA: 0.023194): 0.016064);
Detailed output identifying parameters
kappa (ts/tv) = 2.49132
omega (dN/dS) = 0.08695
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.117 653.6 153.4 0.0870 0.0131 0.1502 8.5 23.0
6..7 0.146 653.6 153.4 0.0870 0.0162 0.1863 10.6 28.6
7..4 0.108 653.6 153.4 0.0870 0.0120 0.1383 7.9 21.2
7..5 0.062 653.6 153.4 0.0870 0.0070 0.0799 4.5 12.3
6..8 0.016 653.6 153.4 0.0870 0.0018 0.0206 1.2 3.2
8..2 0.004 653.6 153.4 0.0870 0.0005 0.0054 0.3 0.8
8..3 0.023 653.6 153.4 0.0870 0.0026 0.0297 1.7 4.6
tree length for dN: 0.0531
tree length for dS: 0.6104
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 111
lnL(ntime: 7 np: 10): -1600.422646 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.122345 0.154242 0.113721 0.062709 0.016027 0.004253 0.023451 2.547064 0.921024 0.031341
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.49675
(1: 0.122345, (4: 0.113721, 5: 0.062709): 0.154242, (2: 0.004253, 3: 0.023451): 0.016027);
(D_melanogaster_7B2-PA: 0.122345, (D_yakuba_7B2-PA: 0.113721, D_erecta_7B2-PA: 0.062709): 0.154242, (D_sechellia_7B2-PA: 0.004253, D_simulans_7B2-PA: 0.023451): 0.016027);
Detailed output identifying parameters
kappa (ts/tv) = 2.54706
dN/dS (w) for site classes (K=2)
p: 0.92102 0.07898
w: 0.03134 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.122 653.1 153.9 0.1078 0.0158 0.1467 10.3 22.6
6..7 0.154 653.1 153.9 0.1078 0.0199 0.1849 13.0 28.5
7..4 0.114 653.1 153.9 0.1078 0.0147 0.1364 9.6 21.0
7..5 0.063 653.1 153.9 0.1078 0.0081 0.0752 5.3 11.6
6..8 0.016 653.1 153.9 0.1078 0.0021 0.0192 1.4 3.0
8..2 0.004 653.1 153.9 0.1078 0.0005 0.0051 0.4 0.8
8..3 0.023 653.1 153.9 0.1078 0.0030 0.0281 2.0 4.3
Time used: 0:05
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 111
lnL(ntime: 7 np: 12): -1600.422646 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.122345 0.154241 0.113720 0.062709 0.016027 0.004253 0.023451 2.547055 0.921024 0.025725 0.031341 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.49675
(1: 0.122345, (4: 0.113720, 5: 0.062709): 0.154241, (2: 0.004253, 3: 0.023451): 0.016027);
(D_melanogaster_7B2-PA: 0.122345, (D_yakuba_7B2-PA: 0.113720, D_erecta_7B2-PA: 0.062709): 0.154241, (D_sechellia_7B2-PA: 0.004253, D_simulans_7B2-PA: 0.023451): 0.016027);
Detailed output identifying parameters
kappa (ts/tv) = 2.54706
dN/dS (w) for site classes (K=3)
p: 0.92102 0.02572 0.05325
w: 0.03134 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.122 653.1 153.9 0.1078 0.0158 0.1467 10.3 22.6
6..7 0.154 653.1 153.9 0.1078 0.0199 0.1849 13.0 28.5
7..4 0.114 653.1 153.9 0.1078 0.0147 0.1364 9.6 21.0
7..5 0.063 653.1 153.9 0.1078 0.0081 0.0752 5.3 11.6
6..8 0.016 653.1 153.9 0.1078 0.0021 0.0192 1.4 3.0
8..2 0.004 653.1 153.9 0.1078 0.0005 0.0051 0.4 0.8
8..3 0.023 653.1 153.9 0.1078 0.0030 0.0281 2.0 4.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_7B2-PA)
Pr(w>1) post mean +- SE for w
7 S 0.608 1.526 +- 0.847
19 L 0.651 1.602 +- 0.901
33 L 0.603 1.515 +- 0.852
248 I 0.500 1.343 +- 0.776
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.724 0.195 0.051 0.017 0.006 0.003 0.002 0.001 0.001 0.000
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.007 0.992
sum of density on p0-p1 = 1.000000
Time used: 0:11
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 111
lnL(ntime: 7 np: 13): -1599.824880 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.120465 0.151530 0.112258 0.061132 0.015652 0.004241 0.023291 2.493918 0.576179 0.221523 0.000001 0.000001 0.471964
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.48857
(1: 0.120465, (4: 0.112258, 5: 0.061132): 0.151530, (2: 0.004241, 3: 0.023291): 0.015652);
(D_melanogaster_7B2-PA: 0.120465, (D_yakuba_7B2-PA: 0.112258, D_erecta_7B2-PA: 0.061132): 0.151530, (D_sechellia_7B2-PA: 0.004241, D_simulans_7B2-PA: 0.023291): 0.015652);
Detailed output identifying parameters
kappa (ts/tv) = 2.49392
dN/dS (w) for site classes (K=3)
p: 0.57618 0.22152 0.20230
w: 0.00000 0.00000 0.47196
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.120 653.6 153.4 0.0955 0.0143 0.1501 9.4 23.0
6..7 0.152 653.6 153.4 0.0955 0.0180 0.1889 11.8 29.0
7..4 0.112 653.6 153.4 0.0955 0.0134 0.1399 8.7 21.5
7..5 0.061 653.6 153.4 0.0955 0.0073 0.0762 4.8 11.7
6..8 0.016 653.6 153.4 0.0955 0.0019 0.0195 1.2 3.0
8..2 0.004 653.6 153.4 0.0955 0.0005 0.0053 0.3 0.8
8..3 0.023 653.6 153.4 0.0955 0.0028 0.0290 1.8 4.5
Naive Empirical Bayes (NEB) analysis
Time used: 0:16
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 111
lnL(ntime: 7 np: 10): -1599.968856 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.120980 0.152168 0.112483 0.061664 0.015706 0.004243 0.023332 2.502783 0.088720 0.799384
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.49058
(1: 0.120980, (4: 0.112483, 5: 0.061664): 0.152168, (2: 0.004243, 3: 0.023332): 0.015706);
(D_melanogaster_7B2-PA: 0.120980, (D_yakuba_7B2-PA: 0.112483, D_erecta_7B2-PA: 0.061664): 0.152168, (D_sechellia_7B2-PA: 0.004243, D_simulans_7B2-PA: 0.023332): 0.015706);
Detailed output identifying parameters
kappa (ts/tv) = 2.50278
Parameters in M7 (beta):
p = 0.08872 q = 0.79938
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00001 0.00018 0.00170 0.01116 0.05555 0.22025 0.68170
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.121 653.5 153.5 0.0971 0.0146 0.1500 9.5 23.0
6..7 0.152 653.5 153.5 0.0971 0.0183 0.1887 12.0 29.0
7..4 0.112 653.5 153.5 0.0971 0.0135 0.1395 8.8 21.4
7..5 0.062 653.5 153.5 0.0971 0.0074 0.0765 4.8 11.7
6..8 0.016 653.5 153.5 0.0971 0.0019 0.0195 1.2 3.0
8..2 0.004 653.5 153.5 0.0971 0.0005 0.0053 0.3 0.8
8..3 0.023 653.5 153.5 0.0971 0.0028 0.0289 1.8 4.4
Time used: 0:32
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 111
lnL(ntime: 7 np: 12): -1599.968863 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.120980 0.152168 0.112483 0.061665 0.015706 0.004243 0.023333 2.502784 0.999990 0.088720 0.799459 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.49058
(1: 0.120980, (4: 0.112483, 5: 0.061665): 0.152168, (2: 0.004243, 3: 0.023333): 0.015706);
(D_melanogaster_7B2-PA: 0.120980, (D_yakuba_7B2-PA: 0.112483, D_erecta_7B2-PA: 0.061665): 0.152168, (D_sechellia_7B2-PA: 0.004243, D_simulans_7B2-PA: 0.023333): 0.015706);
Detailed output identifying parameters
kappa (ts/tv) = 2.50278
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.08872 q = 0.79946
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00001 0.00018 0.00170 0.01116 0.05554 0.22022 0.68165 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.121 653.5 153.5 0.0971 0.0146 0.1500 9.5 23.0
6..7 0.152 653.5 153.5 0.0971 0.0183 0.1887 12.0 29.0
7..4 0.112 653.5 153.5 0.0971 0.0135 0.1395 8.8 21.4
7..5 0.062 653.5 153.5 0.0971 0.0074 0.0765 4.8 11.7
6..8 0.016 653.5 153.5 0.0971 0.0019 0.0195 1.2 3.0
8..2 0.004 653.5 153.5 0.0971 0.0005 0.0053 0.3 0.8
8..3 0.023 653.5 153.5 0.0971 0.0028 0.0289 1.8 4.4
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_7B2-PA)
Pr(w>1) post mean +- SE for w
7 S 0.718 1.368 +- 0.743
19 L 0.763 1.433 +- 0.740
33 L 0.712 1.357 +- 0.748
201 G 0.534 1.092 +- 0.741
248 I 0.582 1.164 +- 0.747
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.005 0.028 0.082 0.170 0.288 0.426
ws: 0.842 0.126 0.023 0.006 0.002 0.001 0.000 0.000 0.000 0.000
Time used: 0:54
Model 1: NearlyNeutral -1600.422646 Model 2: PositiveSelection -1600.422646 Model 0: one-ratio -1607.861631 Model 3: discrete -1599.82488 Model 7: beta -1599.968856 Model 8: beta&w>1 -1599.968863 Model 0 vs 1 14.877970000000005 Model 2 vs 1 0.0 Model 8 vs 7 1.4000000192027073E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
