--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:08:51 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1243/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -641.56 -645.72
2 -641.52 -645.34
--------------------------------------
TOTAL -641.54 -645.55
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.881049 0.087569 0.348831 1.452611 0.847222 1420.64 1423.36 1.000
r(A<->C){all} 0.148937 0.016735 0.000034 0.401195 0.112096 186.21 244.11 1.001
r(A<->G){all} 0.173601 0.021979 0.000002 0.469204 0.133880 318.39 415.09 1.011
r(A<->T){all} 0.161110 0.019125 0.000148 0.439119 0.124030 130.86 221.94 1.000
r(C<->G){all} 0.141711 0.016818 0.000277 0.410624 0.102258 142.53 151.54 1.000
r(C<->T){all} 0.220136 0.026866 0.000226 0.536899 0.183124 185.72 209.98 1.002
r(G<->T){all} 0.154504 0.017549 0.000054 0.407759 0.121540 228.99 246.78 1.000
pi(A){all} 0.182110 0.000320 0.149468 0.218763 0.181793 1004.19 1106.63 1.000
pi(C){all} 0.271323 0.000417 0.231832 0.310852 0.271094 1235.70 1325.16 1.000
pi(G){all} 0.313062 0.000481 0.273098 0.357953 0.313006 1120.39 1274.61 1.000
pi(T){all} 0.233506 0.000385 0.195785 0.272912 0.233181 1217.69 1222.43 1.000
alpha{1,2} 0.397669 0.215291 0.000310 1.268738 0.245467 1117.76 1218.02 1.002
alpha{3} 0.416522 0.225285 0.000112 1.357274 0.244786 837.71 1014.63 1.000
pinvar{all} 0.992706 0.000043 0.980603 0.999860 0.994409 882.42 993.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -631.327707
Model 2: PositiveSelection -626.431855
Model 0: one-ratio -630.696914
Model 7: beta -631.465318
Model 8: beta&w>1 -626.431854
Model 0 vs 1 1.2615860000000794
Model 2 vs 1 9.791703999999982
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 0.945 7.226 +- 2.746
Model 8 vs 7 10.066927999999962
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
1 L 0.522 3.938 +- 3.757
2 V 0.521 3.923 +- 3.754
3 A 0.521 3.923 +- 3.754
4 S 0.523 3.942 +- 3.758
5 C 0.523 3.940 +- 3.757
6 L 0.521 3.929 +- 3.755
7 P 0.521 3.929 +- 3.755
8 R 0.522 3.931 +- 3.756
9 K 0.521 3.927 +- 3.755
10 W 0.523 3.939 +- 3.757
11 E 0.523 3.943 +- 3.758
12 G 0.523 3.943 +- 3.758
13 L 0.521 3.929 +- 3.755
14 P 0.523 3.942 +- 3.758
15 D 0.522 3.931 +- 3.756
16 V 0.521 3.929 +- 3.755
17 C 0.523 3.940 +- 3.757
18 L 0.523 3.939 +- 3.757
19 A 0.523 3.939 +- 3.757
20 V 0.521 3.929 +- 3.755
21 R 0.521 3.925 +- 3.755
22 S 0.522 3.931 +- 3.756
23 R 0.521 3.926 +- 3.755
24 C 0.523 3.940 +- 3.757
25 W 0.523 3.939 +- 3.757
26 Y 0.522 3.931 +- 3.756
27 R 0.521 3.925 +- 3.755
28 F 0.521 3.929 +- 3.755
29 F 0.521 3.929 +- 3.755
30 V 0.521 3.923 +- 3.754
31 W 0.523 3.939 +- 3.757
32 H 0.523 3.940 +- 3.757
33 W 0.523 3.939 +- 3.757
34 S 0.523 3.939 +- 3.757
35 I 0.521 3.929 +- 3.755
36 N 0.522 3.932 +- 3.756
37 I 0.521 3.929 +- 3.755
38 K 0.523 3.943 +- 3.758
39 R 0.521 3.926 +- 3.755
40 G 0.521 3.927 +- 3.755
41 Q 0.524 3.948 +- 3.759
42 A 0.521 3.929 +- 3.755
43 Y 0.523 3.940 +- 3.757
44 S 0.523 3.942 +- 3.758
45 L 0.522 3.938 +- 3.757
46 P 0.521 3.924 +- 3.754
47 N 0.522 3.932 +- 3.756
48 R 0.521 3.925 +- 3.755
49 G 0.521 3.927 +- 3.755
50 M 0.520 3.919 +- 3.753
51 E 0.523 3.943 +- 3.758
52 L 0.523 3.939 +- 3.757
53 S 0.522 3.931 +- 3.756
54 G 0.521 3.927 +- 3.755
55 I 0.523 3.939 +- 3.757
56 C 0.523 3.940 +- 3.757
57 V 0.521 3.929 +- 3.755
58 L 0.522 3.938 +- 3.757
59 V 0.521 3.929 +- 3.755
60 N 0.522 3.932 +- 3.756
61 G 0.523 3.943 +- 3.758
62 Q 0.523 3.939 +- 3.757
63 Q 0.524 3.948 +- 3.759
64 G 0.521 3.927 +- 3.755
65 F 0.521 3.929 +- 3.755
66 A 0.521 3.923 +- 3.754
67 L 0.523 3.939 +- 3.757
68 C 0.523 3.940 +- 3.757
69 L 0.522 3.938 +- 3.757
70 A 0.521 3.929 +- 3.755
71 G 0.522 3.932 +- 3.756
72 S 0.523 3.942 +- 3.758
73 H 0.523 3.940 +- 3.757
74 L 0.523 3.939 +- 3.757
75 R 0.524 3.949 +- 3.759
76 L 0.522 3.938 +- 3.757
77 K 0.523 3.943 +- 3.758
78 R 0.521 3.925 +- 3.755
79 L 0.524 3.948 +- 3.759
80 S 0.521 3.924 +- 3.754
81 R 0.523 3.940 +- 3.757
82 G 0.521 3.927 +- 3.755
83 Y 0.522 3.931 +- 3.756
84 A 0.521 3.923 +- 3.754
85 I 0.521 3.930 +- 3.755
86 T 0.523 3.942 +- 3.758
87 L 0.522 3.938 +- 3.757
88 L 0.523 3.939 +- 3.757
89 T 0.523 3.939 +- 3.757
90 A 0.521 3.929 +- 3.755
91 A 0.521 3.929 +- 3.755
92 A 0.521 3.929 +- 3.755
93 D 0.522 3.931 +- 3.756
94 S 0.521 3.929 +- 3.755
95 E 0.521 3.925 +- 3.755
96 R 0.521 3.926 +- 3.755
97 F 0.521 3.929 +- 3.755
98 N 0.522 3.932 +- 3.756
99 A 0.521 3.923 +- 3.754
100 A 0.523 3.939 +- 3.757
101 A 0.521 3.923 +- 3.754
102 P 0.521 3.924 +- 3.754
103 I 0.521 3.929 +- 3.755
104 S 0.521 3.924 +- 3.754
105 Y 0.522 3.931 +- 3.756
106 T 0.521 3.923 +- 3.754
107 Q 0.524 3.948 +- 3.759
108 S 0.522 3.931 +- 3.756
109 E 0.521 3.925 +- 3.755
110 A 0.523 3.939 +- 3.757
111 S 0.521 3.924 +- 3.754
112 S 0.521 3.924 +- 3.754
113 C 0.523 3.940 +- 3.757
114 L 0.522 3.938 +- 3.757
115 M 0.520 3.919 +- 3.753
116 L 0.523 3.939 +- 3.757
117 H 0.522 3.932 +- 3.756
118 G 0.523 3.940 +- 3.757
119 E 0.521 3.925 +- 3.755
120 E 0.523 3.943 +- 3.758
121 K 0.523 3.943 +- 3.758
122 N 0.523 3.940 +- 3.757
123 P 0.523 3.939 +- 3.757
124 L 0.522 3.938 +- 3.757
125 A 0.523 3.939 +- 3.757
126 P 0.521 3.924 +- 3.754
127 S 0.522 3.931 +- 3.756
128 A 0.521 3.923 +- 3.754
129 K 0.521 3.927 +- 3.755
130 A 0.523 3.939 +- 3.757
131 H 0.522 3.932 +- 3.756
132 A 0.521 3.929 +- 3.755
133 F 0.521 3.929 +- 3.755
134 C 0.522 3.932 +- 3.756
135 A 0.521 3.923 +- 3.754
136 A 0.521 3.923 +- 3.754
137 L 0.523 3.939 +- 3.757
138 L 0.521 3.929 +- 3.755
139 T 0.521 3.923 +- 3.754
140 V 0.523 3.939 +- 3.757
141 G 0.523 3.943 +- 3.758
142 V 0.521 3.929 +- 3.755
143 R 0.522 3.931 +- 3.756
144 T 0.521 3.923 +- 3.754
145 G 0.522 3.932 +- 3.756
146 P 0.523 3.939 +- 3.757
147 C 0.523 3.940 +- 3.757
148 R 0.521 3.926 +- 3.755
149 H 0.523 3.940 +- 3.757
150 P 0.980* 7.211 +- 2.570
151 R 0.524 3.949 +- 3.759
152 R 0.524 3.949 +- 3.759
153 D 0.522 3.931 +- 3.756
>C1
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
RRD
>C2
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
RRD
>C3
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
RRD
>C4
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
RRD
>C5
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
RRD
>C6
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
RRD
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153
C1 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C2 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C3 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C4 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C5 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C6 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
**************************************************
C1 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C2 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C3 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C4 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C5 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C6 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
**************************************************
C1 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
C2 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
C3 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
C4 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
C5 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
C6 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
*************************************************
C1 RRD
C2 RRD
C3 RRD
C4 RRD
C5 RRD
C6 RRD
***
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 153 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 153 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4590]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4590]--->[4590]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.468 Mb, Max= 30.687 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C2 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C3 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C4 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C5 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
C6 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
**************************************************
C1 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C2 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C3 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C4 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C5 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
C6 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
**************************************************
C1 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
C2 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
C3 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
C4 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
C5 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
C6 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
*************************************************
C1 RRD
C2 RRD
C3 RRD
C4 RRD
C5 RRD
C6 RRD
***
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 99.35 C1 C3 99.35
TOP 2 0 99.35 C3 C1 99.35
BOT 0 3 99.35 C1 C4 99.35
TOP 3 0 99.35 C4 C1 99.35
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.35 C2 C3 99.35
TOP 2 1 99.35 C3 C2 99.35
BOT 1 3 99.35 C2 C4 99.35
TOP 3 1 99.35 C4 C2 99.35
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 99.35 C3 C5 99.35
TOP 4 2 99.35 C5 C3 99.35
BOT 2 5 99.35 C3 C6 99.35
TOP 5 2 99.35 C6 C3 99.35
BOT 3 4 99.35 C4 C5 99.35
TOP 4 3 99.35 C5 C4 99.35
BOT 3 5 99.35 C4 C6 99.35
TOP 5 3 99.35 C6 C4 99.35
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.74
AVG 1 C2 * 99.74
AVG 2 C3 * 99.48
AVG 3 C4 * 99.48
AVG 4 C5 * 99.74
AVG 5 C6 * 99.74
TOT TOT * 99.65
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
C2 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
C3 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
C4 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
C5 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
C6 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
**************************************************
C1 TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
C2 TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
C3 TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
C4 TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
C5 TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
C6 TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
**************************************************
C1 CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
C2 CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
C3 CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
C4 CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
C5 CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
C6 CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
**************************************************
C1 GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
C2 GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
C3 GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
C4 GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
C5 GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
C6 GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
**************************************************
C1 TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
C2 TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
C3 TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
C4 TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
C5 TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
C6 TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
**************************************************
C1 CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
C2 CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
C3 CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
C4 CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
C5 CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
C6 CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
**************************************************
C1 GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
C2 GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
C3 GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
C4 GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
C5 GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
C6 GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
**************************************************
C1 CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
C2 CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
C3 CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
C4 CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
C5 CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
C6 CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
**************************************************
C1 GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC
C2 GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC
C3 GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCTC
C4 GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCTC
C5 GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC
C6 GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC
************************************************ *
C1 CGACGAGAC
C2 CGACGAGAC
C3 CGACGAGAC
C4 CGACGAGAC
C5 CGACGAGAC
C6 CGACGAGAC
*********
>C1
TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC
CGACGAGAC
>C2
TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC
CGACGAGAC
>C3
TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCTC
CGACGAGAC
>C4
TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCTC
CGACGAGAC
>C5
TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC
CGACGAGAC
>C6
TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG
TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT
CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG
GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT
TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG
CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT
GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA
CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT
GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC
CGACGAGAC
>C1
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
RRD
>C2
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
RRD
>C3
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
RRD
>C4
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
RRD
>C5
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
RRD
>C6
LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
RRD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 459 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856836
Setting output file names to "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1416540220
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5752035642
Seed = 1868086926
Swapseed = 1579856836
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1033.971010 -- -24.965149
Chain 2 -- -1033.297593 -- -24.965149
Chain 3 -- -1033.934498 -- -24.965149
Chain 4 -- -1033.934498 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1033.297652 -- -24.965149
Chain 2 -- -1033.297593 -- -24.965149
Chain 3 -- -1033.934498 -- -24.965149
Chain 4 -- -1033.971010 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1033.971] (-1033.298) (-1033.934) (-1033.934) * [-1033.298] (-1033.298) (-1033.934) (-1033.971)
500 -- (-652.008) [-649.244] (-651.446) (-648.521) * [-646.838] (-647.921) (-640.940) (-656.091) -- 0:00:00
1000 -- [-646.775] (-648.347) (-649.417) (-649.352) * (-647.692) [-647.232] (-654.637) (-646.262) -- 0:00:00
1500 -- (-648.547) (-645.989) [-647.972] (-643.143) * [-648.725] (-648.360) (-644.830) (-644.767) -- 0:00:00
2000 -- (-648.426) (-645.905) (-642.210) [-650.526] * (-654.805) [-648.291] (-649.250) (-642.361) -- 0:00:00
2500 -- [-644.260] (-656.906) (-642.439) (-650.567) * [-646.240] (-655.074) (-644.375) (-646.430) -- 0:00:00
3000 -- (-646.588) (-646.328) (-652.085) [-649.413] * (-655.013) (-646.629) [-645.050] (-642.072) -- 0:00:00
3500 -- (-654.063) [-650.121] (-646.018) (-656.914) * (-655.043) (-650.697) [-647.493] (-647.924) -- 0:00:00
4000 -- [-643.673] (-641.412) (-649.315) (-646.827) * (-660.346) (-648.644) (-642.691) [-643.055] -- 0:00:00
4500 -- [-644.410] (-650.435) (-657.514) (-646.414) * [-646.629] (-645.196) (-647.133) (-655.547) -- 0:00:00
5000 -- [-647.195] (-645.346) (-641.950) (-644.828) * (-647.540) [-649.914] (-650.595) (-649.138) -- 0:00:00
Average standard deviation of split frequencies: 0.071425
5500 -- (-646.925) [-648.170] (-651.517) (-654.885) * (-646.599) [-641.156] (-650.164) (-650.490) -- 0:00:00
6000 -- (-647.233) (-646.014) (-652.735) [-645.615] * (-655.304) (-659.902) [-641.039] (-643.979) -- 0:00:00
6500 -- (-644.120) (-647.682) [-644.719] (-647.303) * (-654.566) (-643.310) (-644.594) [-646.645] -- 0:00:00
7000 -- (-644.521) [-647.831] (-650.561) (-653.442) * (-646.721) [-647.646] (-658.028) (-647.512) -- 0:00:00
7500 -- (-646.496) (-655.503) [-646.441] (-642.627) * [-643.025] (-648.078) (-643.756) (-645.428) -- 0:00:00
8000 -- (-645.678) (-655.970) (-646.935) [-647.006] * (-651.186) (-643.957) [-652.192] (-647.885) -- 0:00:00
8500 -- (-647.045) (-646.284) (-654.993) [-646.352] * (-655.960) [-639.184] (-650.769) (-642.868) -- 0:00:00
9000 -- (-650.320) (-647.021) [-649.414] (-650.008) * (-647.371) (-646.735) [-645.410] (-648.614) -- 0:00:00
9500 -- (-652.555) (-650.792) [-648.513] (-656.152) * (-650.652) (-640.545) (-650.283) [-648.146] -- 0:00:00
10000 -- (-646.360) (-646.586) (-642.366) [-648.278] * (-653.948) [-645.820] (-648.000) (-649.169) -- 0:01:39
Average standard deviation of split frequencies: 0.056247
10500 -- (-658.002) [-644.152] (-649.923) (-646.002) * (-651.669) (-647.685) [-640.353] (-645.377) -- 0:01:34
11000 -- [-643.189] (-646.265) (-649.790) (-650.099) * (-648.944) (-644.625) (-643.312) [-646.794] -- 0:01:29
11500 -- (-644.286) (-653.201) [-644.439] (-644.181) * (-646.773) (-644.582) [-649.506] (-651.940) -- 0:01:25
12000 -- (-648.868) (-644.710) (-654.839) [-643.096] * (-653.082) (-653.374) (-648.819) [-650.351] -- 0:01:22
12500 -- (-650.350) (-650.817) [-642.130] (-642.953) * [-641.061] (-648.221) (-666.542) (-650.926) -- 0:01:19
13000 -- [-644.798] (-650.691) (-662.057) (-642.888) * [-648.041] (-653.161) (-653.064) (-648.473) -- 0:01:15
13500 -- (-648.085) (-641.082) [-643.303] (-645.396) * (-651.934) [-640.827] (-646.666) (-653.071) -- 0:01:13
14000 -- (-646.100) (-648.671) (-641.523) [-639.292] * (-648.550) (-643.827) (-654.111) [-652.048] -- 0:01:10
14500 -- [-647.281] (-647.724) (-642.590) (-642.505) * [-643.019] (-642.488) (-655.541) (-654.696) -- 0:01:07
15000 -- (-646.218) (-648.941) [-646.832] (-645.476) * (-660.040) [-644.493] (-669.443) (-647.381) -- 0:01:05
Average standard deviation of split frequencies: 0.050087
15500 -- (-648.093) [-650.118] (-642.585) (-649.667) * (-653.708) (-643.413) (-650.649) [-645.504] -- 0:01:03
16000 -- (-644.887) (-648.666) (-642.979) [-651.337] * [-641.662] (-647.175) (-642.486) (-651.470) -- 0:01:01
16500 -- [-642.589] (-663.544) (-643.138) (-649.136) * [-648.354] (-642.052) (-645.876) (-645.989) -- 0:00:59
17000 -- [-643.926] (-655.590) (-641.644) (-653.274) * (-641.215) [-646.007] (-647.665) (-652.832) -- 0:00:57
17500 -- [-643.440] (-647.630) (-642.457) (-651.741) * (-651.104) (-647.429) [-645.744] (-646.964) -- 0:00:56
18000 -- (-645.783) (-648.432) (-643.081) [-639.966] * [-648.751] (-648.196) (-652.899) (-651.204) -- 0:00:54
18500 -- (-644.381) (-640.294) (-644.734) [-644.654] * (-647.825) [-639.450] (-657.616) (-651.837) -- 0:00:53
19000 -- (-649.161) (-642.661) [-643.554] (-654.506) * (-648.762) (-652.925) (-646.841) [-647.273] -- 0:00:51
19500 -- [-648.858] (-643.697) (-646.324) (-645.269) * (-647.499) (-645.795) (-648.166) [-652.562] -- 0:00:50
20000 -- [-643.827] (-643.069) (-643.546) (-653.427) * (-645.174) (-650.447) (-645.179) [-643.511] -- 0:00:49
Average standard deviation of split frequencies: 0.047693
20500 -- (-647.748) (-641.233) (-643.021) [-655.140] * [-646.201] (-645.418) (-654.854) (-658.565) -- 0:00:47
21000 -- (-651.087) (-642.527) (-641.143) [-642.141] * (-642.103) (-645.276) (-650.539) [-646.782] -- 0:00:46
21500 -- [-642.293] (-640.557) (-642.957) (-642.028) * (-650.078) (-648.218) (-643.040) [-653.167] -- 0:00:45
22000 -- (-648.267) (-644.707) (-641.955) [-639.385] * (-656.595) (-648.719) (-645.907) [-647.398] -- 0:00:44
22500 -- [-642.670] (-642.206) (-644.274) (-641.943) * (-646.842) (-659.502) (-651.026) [-644.149] -- 0:00:43
23000 -- [-641.683] (-644.641) (-641.509) (-642.386) * (-640.530) (-644.331) [-643.973] (-655.899) -- 0:00:42
23500 -- [-643.752] (-642.360) (-642.975) (-642.530) * (-641.103) [-643.035] (-653.302) (-650.744) -- 0:00:41
24000 -- (-646.255) (-641.726) [-642.013] (-644.662) * (-647.367) [-647.192] (-645.976) (-655.742) -- 0:00:40
24500 -- (-646.557) [-642.371] (-645.574) (-642.607) * (-647.701) (-644.887) [-641.755] (-646.677) -- 0:00:39
25000 -- [-646.044] (-644.773) (-643.522) (-641.380) * (-643.792) (-646.476) [-644.022] (-646.217) -- 0:00:39
Average standard deviation of split frequencies: 0.047800
25500 -- [-644.132] (-641.757) (-643.182) (-643.365) * (-645.020) (-651.463) [-651.066] (-653.746) -- 0:01:16
26000 -- (-641.858) (-642.410) [-643.377] (-641.767) * (-643.158) [-643.145] (-644.516) (-648.276) -- 0:01:14
26500 -- (-649.461) [-641.924] (-640.924) (-642.563) * (-641.783) [-643.075] (-643.028) (-654.802) -- 0:01:13
27000 -- [-648.840] (-643.856) (-644.029) (-644.132) * (-642.291) [-649.104] (-654.596) (-668.374) -- 0:01:12
27500 -- (-648.171) (-642.416) (-643.426) [-643.902] * (-642.528) [-640.677] (-645.012) (-650.712) -- 0:01:10
28000 -- [-644.850] (-642.219) (-644.091) (-645.278) * (-642.904) (-642.787) (-648.537) [-640.677] -- 0:01:09
28500 -- [-647.337] (-644.225) (-641.985) (-643.186) * (-642.319) (-643.861) [-653.542] (-644.148) -- 0:01:08
29000 -- (-645.692) (-640.306) [-646.776] (-643.530) * [-648.482] (-649.330) (-647.075) (-642.357) -- 0:01:06
29500 -- (-646.819) (-639.873) (-642.913) [-646.927] * (-646.527) (-658.770) (-663.528) [-641.329] -- 0:01:05
30000 -- (-644.344) (-644.802) (-642.918) [-643.783] * (-642.651) (-642.196) (-647.982) [-641.791] -- 0:01:04
Average standard deviation of split frequencies: 0.040526
30500 -- [-640.971] (-643.540) (-641.454) (-640.615) * (-645.909) (-652.296) (-650.991) [-644.112] -- 0:01:03
31000 -- (-644.674) (-644.248) [-641.989] (-644.057) * (-643.206) (-650.296) [-644.910] (-643.983) -- 0:01:02
31500 -- (-645.029) (-645.708) [-641.542] (-644.025) * [-643.343] (-649.481) (-643.625) (-643.357) -- 0:01:01
32000 -- (-648.788) [-642.926] (-643.418) (-642.392) * (-642.325) (-653.079) [-643.309] (-643.005) -- 0:01:00
32500 -- (-649.626) (-640.557) (-644.989) [-645.332] * (-639.963) (-640.965) [-642.325] (-645.171) -- 0:00:59
33000 -- [-651.264] (-642.426) (-644.369) (-641.942) * (-641.868) (-643.008) [-640.272] (-646.910) -- 0:00:58
33500 -- [-644.419] (-642.682) (-646.804) (-642.769) * (-647.519) (-644.004) [-641.121] (-642.597) -- 0:00:57
34000 -- [-642.003] (-642.205) (-645.094) (-645.525) * (-647.883) [-640.249] (-642.649) (-643.224) -- 0:00:56
34500 -- [-642.850] (-643.764) (-643.864) (-645.209) * (-646.078) [-642.990] (-642.624) (-641.867) -- 0:00:55
35000 -- [-646.927] (-642.371) (-641.914) (-644.965) * (-646.670) [-645.045] (-644.302) (-642.158) -- 0:00:55
Average standard deviation of split frequencies: 0.040474
35500 -- (-648.161) (-643.096) [-642.766] (-640.625) * (-643.440) (-646.529) (-645.622) [-643.898] -- 0:00:54
36000 -- (-659.997) (-643.826) (-642.970) [-639.440] * (-642.235) (-643.972) (-646.117) [-643.226] -- 0:00:53
36500 -- (-644.755) [-642.574] (-641.593) (-642.844) * (-646.684) [-646.205] (-644.760) (-645.462) -- 0:00:52
37000 -- (-652.052) (-640.977) [-641.785] (-644.794) * [-643.627] (-655.272) (-643.383) (-642.930) -- 0:00:52
37500 -- [-642.661] (-641.758) (-641.977) (-648.154) * (-649.953) (-649.129) [-642.075] (-643.970) -- 0:00:51
38000 -- [-642.905] (-643.456) (-643.533) (-640.138) * [-646.962] (-644.591) (-642.290) (-644.815) -- 0:00:50
38500 -- [-643.507] (-643.215) (-642.240) (-642.189) * (-642.343) [-639.641] (-642.760) (-644.689) -- 0:00:49
39000 -- [-652.036] (-642.214) (-645.082) (-641.620) * (-642.581) (-645.916) (-641.456) [-643.277] -- 0:00:49
39500 -- [-648.242] (-646.657) (-642.266) (-642.961) * [-645.047] (-645.705) (-639.266) (-641.470) -- 0:00:48
40000 -- [-646.927] (-643.596) (-641.843) (-649.962) * (-642.370) [-643.694] (-641.962) (-645.783) -- 0:01:12
Average standard deviation of split frequencies: 0.025291
40500 -- [-645.395] (-643.600) (-643.041) (-642.243) * [-641.607] (-654.872) (-643.485) (-644.841) -- 0:01:11
41000 -- (-641.450) (-645.284) [-642.196] (-642.412) * (-642.632) [-644.403] (-642.269) (-641.448) -- 0:01:10
41500 -- (-643.277) (-639.746) (-642.682) [-643.337] * (-645.303) [-653.664] (-642.371) (-640.446) -- 0:01:09
42000 -- (-642.336) [-644.229] (-639.986) (-642.956) * (-643.880) (-648.620) (-643.571) [-641.901] -- 0:01:08
42500 -- (-646.709) (-641.733) [-643.919] (-643.410) * (-642.914) [-641.973] (-642.517) (-641.543) -- 0:01:07
43000 -- [-651.035] (-641.926) (-645.269) (-642.847) * (-641.761) (-665.719) [-643.364] (-642.392) -- 0:01:06
43500 -- (-648.752) [-642.053] (-643.644) (-643.719) * (-641.930) (-642.219) (-641.660) [-641.252] -- 0:01:05
44000 -- [-638.482] (-642.565) (-641.020) (-644.366) * (-642.374) (-641.025) [-643.757] (-642.289) -- 0:01:05
44500 -- (-647.956) (-640.135) (-643.835) [-642.719] * [-641.012] (-654.330) (-641.954) (-641.419) -- 0:01:04
45000 -- [-647.646] (-642.439) (-641.726) (-641.536) * [-642.667] (-650.966) (-641.821) (-642.145) -- 0:01:03
Average standard deviation of split frequencies: 0.028379
45500 -- (-645.753) [-642.595] (-641.047) (-643.050) * (-643.555) (-644.517) [-643.839] (-647.603) -- 0:01:02
46000 -- (-647.678) (-644.117) (-642.191) [-643.417] * (-642.785) (-656.204) (-644.120) [-643.082] -- 0:01:02
46500 -- [-644.775] (-641.435) (-643.665) (-642.919) * (-646.132) (-647.134) (-644.403) [-640.939] -- 0:01:01
47000 -- (-656.091) [-643.296] (-642.613) (-643.797) * (-642.546) (-643.403) [-642.253] (-642.819) -- 0:01:00
47500 -- (-644.414) (-642.794) [-644.110] (-644.903) * (-643.993) (-652.574) (-644.323) [-642.776] -- 0:01:00
48000 -- (-649.315) (-643.965) (-645.545) [-643.312] * (-644.603) (-645.635) (-641.265) [-641.577] -- 0:00:59
48500 -- (-649.258) (-642.955) [-642.162] (-646.501) * (-645.893) (-640.852) (-644.954) [-643.534] -- 0:00:58
49000 -- (-646.502) (-641.898) (-642.274) [-642.317] * [-643.697] (-642.583) (-640.916) (-647.657) -- 0:00:58
49500 -- (-655.087) (-642.354) [-643.865] (-644.583) * (-645.875) (-644.796) [-642.347] (-643.885) -- 0:00:57
50000 -- (-645.164) (-640.078) [-645.459] (-645.619) * (-645.873) (-645.109) (-641.984) [-643.460] -- 0:00:57
Average standard deviation of split frequencies: 0.035069
50500 -- (-651.782) [-641.601] (-642.209) (-642.323) * (-642.146) (-645.977) [-648.047] (-644.318) -- 0:00:56
51000 -- (-644.280) [-643.052] (-641.320) (-642.259) * (-643.445) (-648.103) [-641.293] (-646.700) -- 0:00:55
51500 -- (-644.597) (-642.252) (-641.572) [-640.694] * [-645.300] (-645.625) (-641.013) (-643.939) -- 0:00:55
52000 -- [-642.187] (-642.802) (-644.082) (-642.417) * (-645.345) [-647.887] (-643.649) (-643.151) -- 0:00:54
52500 -- [-641.379] (-640.444) (-639.848) (-642.232) * (-643.671) [-645.195] (-644.170) (-642.210) -- 0:00:54
53000 -- [-642.928] (-643.386) (-643.991) (-645.603) * (-644.021) [-647.790] (-640.376) (-640.377) -- 0:00:53
53500 -- (-641.732) (-643.877) [-641.719] (-643.487) * (-643.952) [-645.276] (-642.055) (-642.957) -- 0:00:53
54000 -- (-643.666) [-644.008] (-642.081) (-643.540) * (-642.415) (-651.236) [-643.538] (-644.175) -- 0:00:52
54500 -- (-638.815) (-642.118) [-642.252] (-642.478) * (-642.974) (-642.909) (-641.192) [-644.184] -- 0:01:09
55000 -- [-641.353] (-643.046) (-641.311) (-645.093) * (-643.704) (-646.169) [-643.953] (-641.426) -- 0:01:08
Average standard deviation of split frequencies: 0.033024
55500 -- (-642.829) (-641.527) [-642.255] (-647.455) * (-643.879) [-638.386] (-642.158) (-641.715) -- 0:01:08
56000 -- (-641.064) [-642.626] (-642.709) (-647.952) * (-643.899) (-642.744) (-645.270) [-640.054] -- 0:01:07
56500 -- [-643.033] (-642.621) (-643.466) (-643.870) * (-643.456) [-648.034] (-648.101) (-640.511) -- 0:01:06
57000 -- [-643.290] (-644.160) (-644.356) (-642.812) * (-641.565) [-648.090] (-646.639) (-644.204) -- 0:01:06
57500 -- (-641.256) (-641.647) [-639.789] (-641.034) * (-646.495) [-645.589] (-642.958) (-641.871) -- 0:01:05
58000 -- [-641.202] (-645.658) (-638.695) (-647.956) * (-642.597) [-637.696] (-640.634) (-638.550) -- 0:01:04
58500 -- [-643.111] (-642.448) (-642.659) (-643.163) * (-641.446) (-656.052) (-640.414) [-642.102] -- 0:01:04
59000 -- [-640.112] (-644.791) (-642.864) (-644.934) * [-639.970] (-645.311) (-640.917) (-640.510) -- 0:01:03
59500 -- (-645.735) (-642.774) (-642.127) [-640.910] * (-643.643) (-646.649) [-641.591] (-644.182) -- 0:01:03
60000 -- [-641.246] (-642.950) (-640.301) (-643.808) * (-644.020) [-640.945] (-639.680) (-643.378) -- 0:01:02
Average standard deviation of split frequencies: 0.033672
60500 -- (-645.597) (-640.667) [-643.632] (-645.161) * (-644.533) [-641.697] (-644.382) (-643.098) -- 0:01:02
61000 -- (-643.735) (-641.694) (-643.656) [-642.060] * [-643.510] (-647.055) (-642.085) (-642.462) -- 0:01:01
61500 -- (-645.923) (-641.554) [-642.636] (-644.339) * [-642.675] (-638.877) (-641.531) (-640.042) -- 0:01:01
62000 -- (-645.412) (-643.522) [-644.004] (-646.266) * (-643.911) [-645.209] (-641.647) (-639.752) -- 0:01:00
62500 -- (-643.742) [-644.118] (-639.844) (-646.756) * (-645.122) (-648.711) [-644.280] (-641.840) -- 0:01:00
63000 -- (-642.738) (-643.508) (-639.481) [-644.700] * (-643.000) [-647.491] (-641.501) (-641.834) -- 0:00:59
63500 -- (-643.735) (-641.585) [-641.696] (-643.230) * (-642.132) [-648.105] (-641.628) (-645.206) -- 0:00:58
64000 -- (-643.476) (-641.993) (-642.879) [-643.611] * (-641.121) [-643.040] (-642.967) (-642.567) -- 0:00:58
64500 -- (-642.516) [-641.527] (-645.082) (-642.267) * (-644.514) (-648.466) [-643.943] (-651.991) -- 0:00:58
65000 -- (-641.109) [-640.840] (-643.827) (-646.171) * (-647.148) [-645.523] (-642.666) (-646.361) -- 0:00:57
Average standard deviation of split frequencies: 0.029119
65500 -- (-642.482) (-643.708) (-641.442) [-642.246] * [-643.336] (-647.976) (-641.268) (-645.562) -- 0:00:57
66000 -- (-643.258) [-643.147] (-640.300) (-643.584) * (-644.681) (-644.712) [-640.378] (-646.687) -- 0:00:56
66500 -- (-644.909) [-641.643] (-639.688) (-643.050) * (-643.074) [-645.615] (-642.798) (-646.350) -- 0:00:56
67000 -- [-642.421] (-642.474) (-645.245) (-642.274) * (-642.753) (-645.661) [-643.291] (-645.948) -- 0:00:55
67500 -- [-643.728] (-641.750) (-644.420) (-642.303) * [-642.533] (-643.923) (-643.793) (-642.913) -- 0:00:55
68000 -- (-642.703) [-642.506] (-645.507) (-645.708) * (-644.043) [-646.196] (-644.344) (-643.027) -- 0:00:54
68500 -- (-642.554) (-642.331) [-641.753] (-645.580) * (-644.411) [-644.332] (-642.985) (-642.274) -- 0:00:54
69000 -- (-645.556) (-641.647) [-641.412] (-642.509) * (-648.310) (-656.384) [-641.032] (-645.242) -- 0:00:53
69500 -- (-642.232) [-643.134] (-643.318) (-644.706) * (-641.158) (-656.068) [-642.355] (-643.790) -- 0:01:06
70000 -- (-646.387) (-642.583) [-642.351] (-645.282) * (-643.322) (-656.958) (-644.569) [-644.928] -- 0:01:06
Average standard deviation of split frequencies: 0.031302
70500 -- (-642.727) (-642.682) [-641.054] (-643.220) * (-644.606) (-649.347) [-644.483] (-643.956) -- 0:01:05
71000 -- (-642.613) (-640.913) [-641.740] (-646.774) * (-647.212) [-641.962] (-644.448) (-643.854) -- 0:01:05
71500 -- (-641.565) (-642.501) (-641.483) [-642.451] * (-644.978) [-643.492] (-642.222) (-642.355) -- 0:01:04
72000 -- (-644.695) (-639.521) [-640.520] (-645.845) * (-644.445) [-637.293] (-643.674) (-642.923) -- 0:01:04
72500 -- [-644.058] (-643.771) (-642.833) (-648.196) * (-643.748) [-651.833] (-647.139) (-646.396) -- 0:01:03
73000 -- (-643.847) (-641.198) (-642.595) [-642.035] * (-640.487) [-645.311] (-644.820) (-643.910) -- 0:01:03
73500 -- (-642.560) (-642.850) (-642.136) [-644.292] * (-644.376) (-646.736) (-645.742) [-642.742] -- 0:01:03
74000 -- (-642.273) (-641.520) [-641.787] (-643.209) * [-640.415] (-646.076) (-643.864) (-646.015) -- 0:01:02
74500 -- [-644.855] (-644.789) (-642.360) (-641.673) * (-642.462) [-648.773] (-643.708) (-642.556) -- 0:01:02
75000 -- (-643.821) [-646.321] (-640.549) (-643.329) * [-642.426] (-649.553) (-642.523) (-642.575) -- 0:01:01
Average standard deviation of split frequencies: 0.034830
75500 -- (-643.513) (-643.235) (-644.480) [-642.105] * (-644.469) [-644.119] (-644.272) (-641.871) -- 0:01:01
76000 -- (-644.112) (-640.723) (-641.750) [-643.398] * (-647.167) (-641.608) (-642.598) [-642.182] -- 0:01:00
76500 -- [-642.282] (-646.404) (-643.331) (-642.489) * [-644.704] (-648.645) (-644.554) (-646.042) -- 0:01:00
77000 -- (-643.275) (-642.678) (-637.910) [-641.406] * (-642.030) (-642.093) (-643.951) [-646.696] -- 0:00:59
77500 -- (-643.238) (-644.932) (-641.403) [-641.377] * (-644.429) (-643.246) [-643.878] (-642.769) -- 0:00:59
78000 -- (-647.415) (-642.987) [-640.876] (-642.066) * [-641.174] (-647.453) (-643.121) (-645.060) -- 0:00:59
78500 -- (-642.730) (-644.922) [-642.255] (-647.493) * (-642.209) (-647.771) [-642.766] (-643.204) -- 0:00:58
79000 -- [-640.374] (-644.280) (-641.484) (-642.428) * (-641.883) [-647.389] (-642.356) (-643.019) -- 0:00:58
79500 -- (-645.429) (-644.092) (-644.674) [-642.026] * (-645.046) (-641.251) (-642.693) [-642.345] -- 0:00:57
80000 -- (-646.325) (-642.139) (-645.294) [-641.381] * (-646.188) [-644.743] (-642.485) (-644.107) -- 0:00:57
Average standard deviation of split frequencies: 0.032816
80500 -- (-643.537) (-643.378) [-641.897] (-642.770) * [-641.392] (-644.883) (-642.964) (-645.515) -- 0:00:57
81000 -- [-640.849] (-644.107) (-640.385) (-644.376) * (-641.876) [-645.311] (-642.681) (-643.234) -- 0:00:56
81500 -- (-639.903) (-643.242) [-644.866] (-642.293) * [-643.813] (-659.156) (-644.850) (-642.244) -- 0:00:56
82000 -- [-640.543] (-640.572) (-642.086) (-642.365) * [-642.460] (-643.954) (-644.972) (-642.403) -- 0:00:55
82500 -- (-643.654) [-644.009] (-639.067) (-642.973) * (-643.621) [-643.011] (-647.283) (-642.421) -- 0:00:55
83000 -- (-642.733) [-643.789] (-639.247) (-643.117) * (-643.258) (-653.103) (-643.366) [-641.666] -- 0:00:55
83500 -- (-641.671) [-643.328] (-641.616) (-641.310) * (-642.928) [-645.719] (-648.734) (-645.722) -- 0:00:54
84000 -- [-640.533] (-645.669) (-641.330) (-645.615) * [-642.806] (-653.453) (-643.806) (-643.214) -- 0:00:54
84500 -- [-644.095] (-644.474) (-644.558) (-643.366) * (-645.753) [-644.513] (-645.177) (-640.674) -- 0:00:54
85000 -- (-645.316) (-645.595) [-642.167] (-647.249) * (-644.479) [-643.485] (-641.708) (-644.816) -- 0:01:04
Average standard deviation of split frequencies: 0.031714
85500 -- (-644.669) (-647.965) (-642.695) [-643.086] * [-645.824] (-649.697) (-642.914) (-644.030) -- 0:01:04
86000 -- (-641.494) (-642.598) [-642.751] (-643.350) * (-645.555) (-643.509) (-642.863) [-641.854] -- 0:01:03
86500 -- (-645.958) [-642.890] (-644.415) (-641.369) * (-644.682) (-654.075) [-644.456] (-640.713) -- 0:01:03
87000 -- (-643.817) (-641.991) (-643.686) [-642.366] * (-643.346) (-655.913) [-641.611] (-643.671) -- 0:01:02
87500 -- (-642.079) (-642.889) (-645.814) [-642.945] * (-642.653) (-655.848) [-645.822] (-642.833) -- 0:01:02
88000 -- (-642.885) (-642.525) [-643.009] (-642.841) * (-642.669) (-647.526) (-646.112) [-644.298] -- 0:01:02
88500 -- [-644.361] (-643.446) (-641.556) (-641.232) * (-642.706) [-648.190] (-644.353) (-644.899) -- 0:01:01
89000 -- (-641.560) [-643.015] (-641.024) (-644.007) * (-643.253) [-643.209] (-646.248) (-645.653) -- 0:01:01
89500 -- (-642.630) (-643.998) (-640.016) [-643.914] * (-643.226) [-643.991] (-645.584) (-644.496) -- 0:01:01
90000 -- (-643.057) [-644.065] (-642.151) (-643.250) * (-646.699) [-647.094] (-643.107) (-642.774) -- 0:01:00
Average standard deviation of split frequencies: 0.035095
90500 -- [-641.960] (-643.226) (-643.998) (-642.391) * (-650.458) [-651.504] (-643.747) (-646.126) -- 0:01:00
91000 -- (-642.215) (-643.612) (-641.892) [-642.242] * [-643.511] (-649.140) (-642.540) (-643.738) -- 0:00:59
91500 -- (-641.824) [-642.688] (-643.582) (-642.474) * (-641.718) (-644.288) (-645.907) [-643.341] -- 0:00:59
92000 -- (-641.795) [-646.216] (-642.025) (-644.377) * (-642.562) [-649.922] (-643.352) (-641.669) -- 0:00:59
92500 -- (-642.837) [-642.907] (-640.679) (-647.020) * [-642.621] (-652.717) (-647.039) (-642.208) -- 0:00:58
93000 -- (-642.261) (-645.517) [-639.295] (-645.992) * (-644.772) [-641.004] (-645.524) (-642.017) -- 0:00:58
93500 -- (-642.764) [-643.388] (-641.786) (-643.964) * (-644.783) [-648.790] (-643.552) (-643.223) -- 0:00:58
94000 -- [-642.360] (-642.516) (-641.684) (-646.351) * (-642.211) [-645.766] (-640.030) (-642.056) -- 0:00:57
94500 -- (-643.147) (-645.214) [-644.492] (-648.161) * (-640.618) (-653.972) [-643.160] (-642.601) -- 0:00:57
95000 -- (-643.482) [-642.585] (-644.626) (-644.604) * (-644.300) [-642.062] (-645.355) (-648.907) -- 0:00:57
Average standard deviation of split frequencies: 0.034662
95500 -- [-640.848] (-642.590) (-644.844) (-644.356) * (-644.577) (-643.224) (-650.354) [-642.853] -- 0:00:56
96000 -- (-642.163) (-646.975) (-643.216) [-639.508] * [-645.705] (-641.943) (-642.335) (-641.598) -- 0:00:56
96500 -- (-642.199) [-641.920] (-641.086) (-644.450) * [-641.609] (-642.369) (-644.294) (-643.575) -- 0:00:56
97000 -- (-642.536) [-642.507] (-646.328) (-642.085) * [-642.365] (-642.789) (-640.891) (-642.411) -- 0:00:55
97500 -- [-642.842] (-650.447) (-646.998) (-640.495) * (-641.754) (-644.978) [-640.408] (-642.215) -- 0:00:55
98000 -- (-642.273) (-645.217) [-642.360] (-648.732) * (-647.131) (-644.663) (-642.508) [-641.056] -- 0:00:55
98500 -- (-642.809) (-644.926) (-642.384) [-647.843] * (-644.759) (-641.456) [-640.483] (-643.601) -- 0:00:54
99000 -- (-643.645) (-643.363) [-642.972] (-643.032) * [-642.936] (-641.631) (-642.354) (-642.928) -- 0:00:54
99500 -- [-642.465] (-645.166) (-642.941) (-644.462) * [-646.254] (-644.841) (-642.933) (-641.587) -- 0:00:54
100000 -- (-642.461) [-643.219] (-641.774) (-646.958) * (-643.108) (-644.020) [-642.478] (-642.135) -- 0:00:54
Average standard deviation of split frequencies: 0.029658
100500 -- (-645.869) (-644.299) [-640.514] (-644.722) * (-643.669) [-642.560] (-643.699) (-640.394) -- 0:01:02
101000 -- [-642.820] (-642.330) (-643.663) (-642.148) * (-646.125) (-641.587) (-640.551) [-643.184] -- 0:01:02
101500 -- (-646.883) (-644.269) [-644.555] (-641.742) * (-642.817) (-641.380) [-642.284] (-642.369) -- 0:01:01
102000 -- (-647.963) (-643.074) [-641.548] (-641.140) * (-641.226) (-641.393) (-644.170) [-641.459] -- 0:01:01
102500 -- (-645.206) (-642.506) [-642.465] (-643.762) * (-644.768) (-644.520) [-644.449] (-645.750) -- 0:01:01
103000 -- (-642.298) [-641.592] (-642.632) (-643.331) * (-643.081) (-641.958) [-644.695] (-642.691) -- 0:01:00
103500 -- (-642.587) [-642.985] (-648.045) (-643.664) * (-643.449) (-642.833) (-640.740) [-639.902] -- 0:01:00
104000 -- (-642.014) (-644.099) [-642.607] (-646.771) * (-642.226) (-642.218) (-645.384) [-641.762] -- 0:01:00
104500 -- [-648.836] (-645.187) (-643.175) (-644.467) * [-641.627] (-642.837) (-643.735) (-642.203) -- 0:00:59
105000 -- (-647.291) (-643.447) (-644.397) [-642.093] * (-643.909) (-644.855) (-642.677) [-640.523] -- 0:00:59
Average standard deviation of split frequencies: 0.025448
105500 -- (-639.526) (-643.282) (-644.857) [-643.120] * (-643.782) (-642.851) [-641.053] (-644.759) -- 0:00:59
106000 -- (-645.118) [-641.605] (-646.218) (-643.658) * (-642.689) (-643.148) [-641.631] (-646.296) -- 0:00:59
106500 -- (-646.325) [-642.381] (-643.509) (-643.688) * (-642.793) (-646.282) [-644.688] (-643.862) -- 0:00:58
107000 -- (-642.961) [-642.728] (-645.059) (-642.665) * (-643.775) (-642.101) (-642.459) [-638.965] -- 0:00:58
107500 -- (-641.320) [-644.504] (-640.536) (-647.654) * [-642.751] (-641.520) (-642.991) (-642.740) -- 0:00:58
108000 -- [-641.988] (-644.241) (-644.927) (-643.041) * [-643.210] (-645.583) (-645.586) (-640.185) -- 0:00:57
108500 -- (-641.934) [-642.796] (-644.907) (-642.507) * (-641.658) (-644.740) (-643.060) [-640.810] -- 0:00:57
109000 -- [-642.244] (-641.955) (-642.268) (-642.547) * [-641.947] (-643.502) (-644.203) (-641.238) -- 0:00:57
109500 -- [-641.658] (-642.264) (-642.491) (-642.361) * (-644.131) (-642.950) [-642.679] (-640.436) -- 0:00:56
110000 -- (-643.434) (-643.435) [-646.245] (-643.993) * (-643.333) [-641.859] (-645.568) (-645.659) -- 0:00:56
Average standard deviation of split frequencies: 0.026268
110500 -- (-641.444) (-643.318) [-643.775] (-641.962) * (-642.486) (-641.666) (-643.227) [-638.918] -- 0:00:56
111000 -- (-643.686) (-643.491) (-641.260) [-641.617] * (-643.390) (-644.785) [-642.256] (-643.003) -- 0:00:56
111500 -- (-643.245) [-644.502] (-642.247) (-642.783) * (-646.839) [-644.505] (-644.627) (-639.425) -- 0:00:55
112000 -- [-639.735] (-641.978) (-643.330) (-643.606) * [-644.407] (-643.226) (-643.304) (-643.283) -- 0:00:55
112500 -- (-644.097) (-645.290) [-641.823] (-644.360) * [-643.368] (-643.126) (-646.355) (-640.573) -- 0:00:55
113000 -- (-646.725) (-642.440) (-644.801) [-644.905] * [-642.471] (-640.274) (-644.646) (-644.912) -- 0:00:54
113500 -- (-644.692) [-646.580] (-642.515) (-647.063) * (-642.914) (-640.577) (-643.345) [-638.992] -- 0:00:54
114000 -- (-645.248) (-642.296) [-641.386] (-644.912) * (-641.478) [-640.542] (-646.108) (-639.327) -- 0:00:54
114500 -- (-643.324) [-642.725] (-640.849) (-648.617) * (-645.746) [-641.027] (-644.004) (-640.876) -- 0:00:54
115000 -- (-643.837) (-643.194) [-641.135] (-645.743) * (-642.022) (-645.882) (-645.021) [-642.606] -- 0:00:53
Average standard deviation of split frequencies: 0.027544
115500 -- (-641.744) (-643.737) [-640.609] (-646.746) * (-641.926) (-641.181) (-644.962) [-641.744] -- 0:00:53
116000 -- [-642.236] (-645.891) (-641.366) (-644.556) * (-645.257) (-643.210) (-642.552) [-641.877] -- 0:00:53
116500 -- (-641.736) (-643.792) [-640.114] (-644.925) * (-642.624) (-641.723) [-643.316] (-641.738) -- 0:01:00
117000 -- (-642.367) [-642.178] (-645.635) (-643.248) * (-643.969) [-642.808] (-643.768) (-642.713) -- 0:01:00
117500 -- (-642.474) (-643.215) [-644.922] (-643.417) * (-642.955) (-646.766) (-643.131) [-643.081] -- 0:01:00
118000 -- (-642.390) (-643.117) (-643.235) [-642.582] * (-641.332) (-646.942) [-642.775] (-640.353) -- 0:00:59
118500 -- [-641.747] (-643.340) (-644.213) (-643.693) * (-644.525) [-643.433] (-642.299) (-648.966) -- 0:00:59
119000 -- (-642.319) (-646.262) [-639.379] (-640.613) * [-644.669] (-646.054) (-641.554) (-644.127) -- 0:00:59
119500 -- [-642.606] (-644.207) (-640.974) (-644.264) * (-646.786) (-642.697) [-642.334] (-643.751) -- 0:00:58
120000 -- (-641.785) (-647.673) [-641.646] (-640.935) * (-642.338) (-644.064) (-644.540) [-643.731] -- 0:00:58
Average standard deviation of split frequencies: 0.024742
120500 -- (-640.081) (-646.104) (-644.753) [-643.517] * (-641.678) [-644.574] (-644.701) (-646.106) -- 0:00:58
121000 -- (-643.610) [-644.379] (-641.469) (-643.303) * [-642.147] (-644.639) (-649.709) (-644.375) -- 0:00:58
121500 -- (-642.193) (-642.085) [-639.443] (-644.559) * (-645.327) [-639.951] (-645.207) (-641.706) -- 0:00:57
122000 -- (-643.934) [-642.733] (-642.136) (-644.778) * [-643.556] (-643.124) (-644.409) (-639.075) -- 0:00:57
122500 -- (-646.098) (-643.289) (-646.717) [-641.442] * (-642.072) [-643.503] (-642.147) (-641.683) -- 0:00:57
123000 -- [-642.330] (-642.561) (-643.362) (-643.572) * [-641.681] (-643.214) (-642.724) (-641.896) -- 0:00:57
123500 -- (-644.430) (-646.131) [-643.240] (-643.891) * (-643.705) (-644.115) [-645.257] (-642.748) -- 0:00:56
124000 -- (-641.630) (-643.009) (-642.387) [-641.085] * [-642.688] (-642.978) (-644.033) (-645.030) -- 0:00:56
124500 -- (-642.323) [-642.194] (-646.515) (-641.916) * (-644.022) (-644.828) (-643.529) [-642.636] -- 0:00:56
125000 -- (-643.674) (-643.176) (-645.998) [-641.209] * (-642.148) (-642.850) [-642.752] (-640.207) -- 0:00:56
Average standard deviation of split frequencies: 0.023328
125500 -- [-642.248] (-641.726) (-646.046) (-641.574) * (-647.902) (-644.506) [-643.155] (-643.206) -- 0:00:55
126000 -- (-644.847) [-643.491] (-643.627) (-644.492) * (-642.388) (-647.764) [-643.045] (-641.923) -- 0:00:55
126500 -- (-642.392) (-644.539) (-639.999) [-643.239] * (-641.780) [-642.841] (-642.256) (-643.744) -- 0:00:55
127000 -- [-641.253] (-641.460) (-643.398) (-642.067) * (-642.318) (-648.040) (-641.663) [-643.602] -- 0:00:54
127500 -- (-645.633) (-642.348) (-643.216) [-644.477] * (-642.918) (-643.760) (-641.595) [-644.345] -- 0:00:54
128000 -- [-646.586] (-645.926) (-644.023) (-648.175) * (-641.857) (-644.155) (-642.706) [-642.759] -- 0:00:54
128500 -- (-648.401) (-640.909) (-644.159) [-644.554] * (-642.861) (-643.430) [-640.642] (-644.147) -- 0:00:54
129000 -- [-644.271] (-642.202) (-647.830) (-642.312) * (-645.339) (-642.525) [-643.872] (-645.057) -- 0:00:54
129500 -- (-644.562) [-640.689] (-645.042) (-643.856) * [-644.766] (-642.336) (-646.231) (-643.370) -- 0:00:53
130000 -- (-643.354) (-642.737) (-640.293) [-644.720] * (-644.529) (-643.390) [-645.931] (-641.230) -- 0:00:53
Average standard deviation of split frequencies: 0.024452
130500 -- (-644.263) (-642.915) [-642.794] (-644.258) * (-645.634) (-642.363) (-643.673) [-644.757] -- 0:00:53
131000 -- (-642.367) [-642.927] (-644.284) (-646.072) * (-643.033) (-644.192) [-644.087] (-644.412) -- 0:00:53
131500 -- [-642.174] (-638.690) (-641.984) (-643.794) * [-640.276] (-642.664) (-646.870) (-643.225) -- 0:00:52
132000 -- (-646.277) (-643.599) [-642.608] (-642.847) * (-644.579) [-642.330] (-641.587) (-644.132) -- 0:00:52
132500 -- (-643.728) (-643.846) (-642.542) [-641.987] * (-641.486) (-647.639) (-643.036) [-642.983] -- 0:00:58
133000 -- (-642.405) (-640.800) [-644.857] (-641.187) * [-644.272] (-641.983) (-642.604) (-644.966) -- 0:00:58
133500 -- (-644.657) [-644.058] (-643.009) (-645.372) * (-642.420) [-641.865] (-644.242) (-643.220) -- 0:00:58
134000 -- (-642.933) [-645.806] (-642.471) (-644.585) * (-642.341) [-641.574] (-642.883) (-643.996) -- 0:00:58
134500 -- (-642.760) (-644.045) [-641.723] (-644.098) * (-644.121) [-641.867] (-646.525) (-647.078) -- 0:00:57
135000 -- (-643.810) (-643.357) [-642.342] (-639.860) * (-644.202) (-644.677) (-644.832) [-642.722] -- 0:00:57
Average standard deviation of split frequencies: 0.023448
135500 -- (-644.058) [-645.655] (-642.473) (-644.757) * (-644.606) [-645.517] (-642.389) (-643.678) -- 0:00:57
136000 -- (-641.687) (-642.152) [-646.192] (-643.388) * (-645.267) (-645.446) (-644.907) [-641.741] -- 0:00:57
136500 -- (-644.955) (-642.719) [-643.557] (-645.507) * (-643.963) (-644.445) [-642.815] (-641.810) -- 0:00:56
137000 -- (-643.887) (-641.660) (-642.440) [-640.454] * (-647.414) (-647.728) (-642.717) [-647.326] -- 0:00:56
137500 -- (-642.663) [-643.249] (-642.218) (-644.841) * (-644.408) (-642.752) (-644.512) [-646.645] -- 0:00:56
138000 -- (-642.739) (-643.944) (-645.872) [-641.320] * [-644.434] (-641.967) (-643.462) (-640.973) -- 0:00:56
138500 -- (-642.677) (-643.661) (-644.628) [-643.252] * (-641.321) [-641.984] (-646.804) (-641.864) -- 0:00:55
139000 -- [-642.251] (-644.490) (-642.371) (-641.788) * (-643.060) (-643.573) (-642.289) [-641.228] -- 0:00:55
139500 -- [-644.049] (-641.053) (-642.960) (-642.555) * (-639.802) [-641.646] (-643.359) (-642.453) -- 0:00:55
140000 -- [-642.207] (-644.024) (-641.178) (-641.885) * (-640.124) (-642.093) (-644.755) [-640.423] -- 0:00:55
Average standard deviation of split frequencies: 0.021487
140500 -- (-643.231) [-641.745] (-642.872) (-644.563) * (-643.495) (-645.678) (-643.757) [-641.573] -- 0:00:55
141000 -- [-642.940] (-642.941) (-644.910) (-642.508) * (-644.662) (-641.591) (-647.712) [-645.821] -- 0:00:54
141500 -- [-640.695] (-639.909) (-641.508) (-643.347) * (-642.824) (-645.616) (-643.195) [-643.430] -- 0:00:54
142000 -- (-644.462) [-639.983] (-646.260) (-642.372) * (-649.120) [-646.129] (-645.291) (-641.987) -- 0:00:54
142500 -- (-644.241) (-644.988) (-642.517) [-640.936] * [-640.245] (-643.116) (-641.248) (-640.247) -- 0:00:54
143000 -- (-643.389) (-642.479) (-643.443) [-641.805] * (-641.442) (-641.809) [-642.129] (-641.284) -- 0:00:53
143500 -- (-643.734) (-642.556) [-639.972] (-640.265) * (-641.335) [-640.339] (-642.514) (-645.359) -- 0:00:53
144000 -- (-642.102) [-641.138] (-644.400) (-643.707) * [-640.344] (-643.059) (-643.081) (-647.358) -- 0:00:53
144500 -- (-644.497) [-641.544] (-650.969) (-642.213) * (-641.599) (-645.342) (-644.748) [-640.747] -- 0:00:53
145000 -- [-642.112] (-642.198) (-642.845) (-640.724) * (-643.649) [-642.627] (-644.297) (-642.955) -- 0:00:53
Average standard deviation of split frequencies: 0.022602
145500 -- [-642.666] (-640.582) (-642.588) (-642.065) * (-643.819) [-643.320] (-642.368) (-643.136) -- 0:00:52
146000 -- [-641.547] (-641.803) (-642.931) (-645.806) * (-643.166) [-641.465] (-642.422) (-642.256) -- 0:00:52
146500 -- (-642.002) [-641.819] (-641.949) (-643.612) * (-640.876) [-646.997] (-643.750) (-643.517) -- 0:00:52
147000 -- [-642.251] (-641.444) (-642.216) (-643.665) * [-644.670] (-643.142) (-643.194) (-642.659) -- 0:00:52
147500 -- [-642.479] (-642.899) (-644.362) (-642.187) * [-643.442] (-641.225) (-643.633) (-642.517) -- 0:00:52
148000 -- (-644.149) (-647.789) [-642.399] (-643.730) * (-642.534) (-643.333) [-648.698] (-641.604) -- 0:00:57
148500 -- (-643.826) (-641.992) [-643.256] (-648.109) * [-641.955] (-645.745) (-642.137) (-641.546) -- 0:00:57
149000 -- (-644.998) (-641.674) (-641.226) [-644.179] * (-641.520) (-640.882) [-645.999] (-642.717) -- 0:00:57
149500 -- (-643.133) (-640.724) (-641.398) [-644.770] * (-644.719) (-644.174) [-644.549] (-642.000) -- 0:00:56
150000 -- (-646.460) [-642.780] (-642.799) (-644.377) * (-642.062) (-644.822) [-642.942] (-643.307) -- 0:00:56
Average standard deviation of split frequencies: 0.023384
150500 -- (-649.334) (-647.709) (-640.896) [-642.428] * (-643.008) (-645.464) (-643.070) [-641.017] -- 0:00:56
151000 -- (-646.368) (-645.046) [-642.460] (-642.844) * (-644.948) (-644.958) [-643.735] (-643.208) -- 0:00:56
151500 -- (-639.624) (-644.669) [-644.068] (-643.838) * (-645.671) (-648.807) (-641.716) [-640.559] -- 0:00:56
152000 -- (-641.263) [-642.370] (-642.785) (-643.658) * (-644.250) (-644.574) [-643.914] (-643.619) -- 0:00:55
152500 -- (-641.532) [-642.497] (-644.150) (-642.272) * (-643.047) (-641.480) (-645.776) [-643.017] -- 0:00:55
153000 -- (-645.510) (-638.876) [-642.451] (-642.335) * (-643.026) (-642.955) [-648.271] (-642.669) -- 0:00:55
153500 -- [-643.111] (-642.429) (-645.542) (-642.012) * (-641.587) [-641.038] (-645.956) (-642.103) -- 0:00:55
154000 -- [-644.630] (-641.695) (-641.925) (-642.018) * [-641.178] (-646.862) (-644.192) (-640.628) -- 0:00:54
154500 -- (-644.284) (-643.999) (-644.072) [-646.691] * (-646.782) [-642.765] (-642.975) (-641.005) -- 0:00:54
155000 -- (-642.524) (-642.038) [-646.163] (-642.821) * [-642.858] (-642.922) (-645.141) (-639.890) -- 0:00:54
Average standard deviation of split frequencies: 0.022664
155500 -- (-645.028) (-644.208) (-642.459) [-638.614] * (-644.257) (-648.569) (-642.144) [-640.952] -- 0:00:54
156000 -- [-645.669] (-644.072) (-647.057) (-641.642) * [-643.813] (-647.008) (-642.099) (-638.038) -- 0:00:54
156500 -- (-642.449) (-645.032) [-641.941] (-641.851) * (-649.232) (-645.595) (-643.435) [-648.021] -- 0:00:53
157000 -- (-639.159) (-644.234) [-643.552] (-643.162) * (-644.774) (-652.474) (-643.450) [-642.379] -- 0:00:53
157500 -- [-640.243] (-642.839) (-649.838) (-642.598) * (-647.990) (-644.598) (-641.509) [-645.084] -- 0:00:53
158000 -- (-640.698) [-643.368] (-643.298) (-643.716) * [-646.525] (-643.667) (-649.689) (-644.483) -- 0:00:53
158500 -- (-646.183) (-644.387) (-643.901) [-641.186] * (-642.532) (-641.561) [-641.999] (-642.783) -- 0:00:53
159000 -- (-643.866) (-644.047) (-644.365) [-641.237] * (-643.120) (-643.853) [-643.294] (-643.834) -- 0:00:52
159500 -- (-645.141) (-640.912) [-641.523] (-642.912) * (-642.010) (-649.274) [-644.942] (-641.192) -- 0:00:52
160000 -- [-641.438] (-642.771) (-644.379) (-643.687) * (-642.955) [-642.960] (-645.380) (-641.575) -- 0:00:52
Average standard deviation of split frequencies: 0.021190
160500 -- (-643.099) [-642.337] (-646.454) (-638.486) * (-642.302) (-642.175) [-641.775] (-639.874) -- 0:00:52
161000 -- (-641.229) [-646.583] (-643.137) (-645.027) * [-642.554] (-644.382) (-641.529) (-642.974) -- 0:00:52
161500 -- (-644.844) (-643.673) [-640.042] (-648.682) * (-642.924) [-643.466] (-645.655) (-641.069) -- 0:00:51
162000 -- (-642.732) (-644.335) (-643.052) [-640.955] * (-641.497) (-645.727) (-643.017) [-640.543] -- 0:00:51
162500 -- (-642.319) [-643.238] (-644.141) (-643.407) * (-642.493) (-643.135) [-642.671] (-643.229) -- 0:00:51
163000 -- (-641.231) (-644.260) (-644.344) [-640.754] * [-642.549] (-644.222) (-642.855) (-641.149) -- 0:00:51
163500 -- (-642.261) [-645.442] (-644.108) (-641.352) * (-642.468) (-644.184) (-641.848) [-638.012] -- 0:00:51
164000 -- (-643.527) [-645.525] (-641.887) (-643.971) * (-642.059) (-643.505) (-644.484) [-641.777] -- 0:00:56
164500 -- (-644.120) (-644.010) (-642.008) [-641.728] * (-645.192) (-642.849) (-643.499) [-639.829] -- 0:00:55
165000 -- (-644.439) (-642.834) [-639.824] (-641.898) * (-642.436) [-642.554] (-642.672) (-638.979) -- 0:00:55
Average standard deviation of split frequencies: 0.020036
165500 -- (-643.778) (-641.785) [-641.096] (-641.154) * (-644.968) (-643.941) (-644.486) [-640.848] -- 0:00:55
166000 -- [-641.737] (-643.124) (-642.217) (-643.651) * (-645.807) (-641.345) [-639.871] (-640.362) -- 0:00:55
166500 -- [-642.664] (-643.548) (-644.944) (-643.533) * (-645.051) (-641.731) (-642.649) [-641.004] -- 0:00:55
167000 -- (-646.110) [-645.539] (-643.441) (-643.207) * (-643.780) [-641.117] (-643.242) (-641.433) -- 0:00:54
167500 -- (-645.810) (-643.681) (-642.860) [-643.826] * [-641.486] (-643.231) (-644.491) (-642.701) -- 0:00:54
168000 -- (-643.076) (-644.155) [-642.232] (-641.746) * (-644.766) (-641.315) (-642.095) [-642.147] -- 0:00:54
168500 -- (-641.371) [-643.912] (-642.285) (-643.141) * (-645.793) [-640.074] (-641.646) (-644.545) -- 0:00:54
169000 -- (-643.234) (-641.132) (-641.620) [-642.023] * (-643.955) [-643.233] (-642.188) (-640.272) -- 0:00:54
169500 -- [-642.226] (-642.858) (-642.577) (-640.837) * (-642.177) (-645.023) [-641.213] (-641.465) -- 0:00:53
170000 -- (-641.212) [-644.956] (-644.642) (-643.765) * [-643.586] (-644.521) (-642.311) (-640.014) -- 0:00:53
Average standard deviation of split frequencies: 0.019028
170500 -- (-642.010) (-644.289) (-640.304) [-640.932] * (-642.323) [-644.957] (-644.316) (-640.651) -- 0:00:53
171000 -- (-639.684) [-641.308] (-642.506) (-641.112) * (-642.060) [-642.774] (-642.788) (-639.829) -- 0:00:53
171500 -- [-641.868] (-645.926) (-642.712) (-644.492) * (-642.392) (-642.478) (-651.566) [-640.855] -- 0:00:53
172000 -- [-641.206] (-643.618) (-642.297) (-641.965) * [-645.539] (-644.139) (-640.969) (-641.626) -- 0:00:52
172500 -- (-642.441) (-642.419) [-641.672] (-641.693) * [-642.863] (-642.536) (-641.806) (-641.505) -- 0:00:52
173000 -- (-644.631) (-645.521) (-641.999) [-641.497] * (-648.283) [-641.311] (-642.763) (-643.191) -- 0:00:52
173500 -- (-642.238) (-644.055) (-644.298) [-643.151] * (-644.702) [-641.921] (-642.774) (-641.036) -- 0:00:52
174000 -- (-644.478) [-639.498] (-640.989) (-642.173) * [-643.311] (-642.142) (-641.111) (-642.024) -- 0:00:52
174500 -- [-640.853] (-645.841) (-641.640) (-645.906) * [-641.465] (-645.365) (-642.458) (-642.991) -- 0:00:52
175000 -- (-644.478) [-643.878] (-640.407) (-644.658) * (-641.401) [-641.911] (-642.203) (-642.801) -- 0:00:51
Average standard deviation of split frequencies: 0.018303
175500 -- (-645.328) (-642.731) [-641.863] (-641.430) * (-642.824) [-642.036] (-644.313) (-645.340) -- 0:00:51
176000 -- (-642.730) (-643.118) (-642.143) [-641.617] * (-643.361) [-646.687] (-643.076) (-641.950) -- 0:00:51
176500 -- (-641.840) (-643.243) [-647.097] (-640.765) * [-644.670] (-643.373) (-642.196) (-644.425) -- 0:00:51
177000 -- (-643.758) (-639.809) [-640.693] (-641.719) * (-641.499) (-644.327) [-643.910] (-641.337) -- 0:00:51
177500 -- (-642.823) [-644.199] (-641.692) (-642.405) * (-642.322) (-642.837) (-646.488) [-640.284] -- 0:00:50
178000 -- (-641.870) (-642.193) [-640.407] (-641.359) * [-643.270] (-642.662) (-642.853) (-642.595) -- 0:00:50
178500 -- (-644.380) [-640.960] (-644.723) (-647.055) * (-644.848) (-643.093) (-642.449) [-638.988] -- 0:00:50
179000 -- [-642.456] (-641.580) (-643.386) (-641.553) * [-642.300] (-643.473) (-645.014) (-640.684) -- 0:00:50
179500 -- (-643.776) [-643.553] (-643.841) (-646.277) * (-642.181) (-641.893) (-644.281) [-641.728] -- 0:00:54
180000 -- [-642.474] (-646.458) (-647.141) (-646.284) * (-645.100) (-641.608) (-643.645) [-643.965] -- 0:00:54
Average standard deviation of split frequencies: 0.016116
180500 -- (-645.593) (-643.586) [-644.245] (-645.237) * (-644.122) [-640.544] (-643.218) (-642.720) -- 0:00:54
181000 -- (-646.337) [-643.785] (-645.225) (-645.028) * (-641.830) (-644.687) (-642.822) [-641.776] -- 0:00:54
181500 -- [-642.717] (-644.771) (-642.717) (-643.599) * [-641.814] (-642.729) (-642.244) (-642.849) -- 0:00:54
182000 -- (-643.332) (-641.964) (-643.335) [-644.098] * [-642.308] (-643.025) (-643.711) (-642.720) -- 0:00:53
182500 -- [-643.630] (-647.180) (-643.234) (-643.565) * (-642.529) (-642.125) [-643.866] (-646.777) -- 0:00:53
183000 -- (-641.722) (-644.243) (-644.688) [-642.504] * (-642.339) (-641.243) [-642.755] (-643.835) -- 0:00:53
183500 -- [-639.883] (-642.674) (-646.655) (-642.389) * (-644.483) (-644.932) [-642.328] (-641.517) -- 0:00:53
184000 -- [-640.667] (-642.131) (-641.686) (-645.327) * (-647.888) (-646.523) (-642.902) [-642.030] -- 0:00:53
184500 -- [-644.994] (-641.951) (-643.449) (-643.583) * (-644.081) (-644.277) (-643.165) [-644.180] -- 0:00:53
185000 -- (-643.873) (-642.321) (-643.089) [-643.072] * (-642.292) (-644.602) [-643.134] (-645.060) -- 0:00:52
Average standard deviation of split frequencies: 0.017319
185500 -- (-644.413) [-643.668] (-642.619) (-642.252) * (-641.799) (-642.625) (-641.179) [-643.333] -- 0:00:52
186000 -- (-642.605) [-641.675] (-645.992) (-642.011) * (-643.085) [-641.817] (-642.243) (-643.445) -- 0:00:52
186500 -- [-641.406] (-642.911) (-644.027) (-642.081) * (-648.221) (-645.306) [-641.113] (-644.833) -- 0:00:52
187000 -- (-643.816) [-642.055] (-641.443) (-641.852) * (-643.618) [-643.358] (-642.139) (-642.103) -- 0:00:52
187500 -- (-645.179) [-641.798] (-641.408) (-642.430) * (-646.058) (-643.153) (-644.492) [-640.976] -- 0:00:52
188000 -- (-644.548) (-641.578) [-642.345] (-643.059) * (-642.731) (-641.555) (-644.891) [-643.516] -- 0:00:51
188500 -- [-643.937] (-642.793) (-642.764) (-643.689) * (-645.163) [-644.062] (-645.175) (-643.696) -- 0:00:51
189000 -- (-644.383) (-644.330) [-641.936] (-642.721) * (-645.345) [-643.874] (-644.446) (-654.467) -- 0:00:51
189500 -- (-641.706) [-641.430] (-641.897) (-644.544) * (-643.548) (-643.223) [-644.046] (-639.961) -- 0:00:51
190000 -- (-644.806) (-641.917) [-641.063] (-642.282) * [-642.529] (-643.093) (-644.352) (-642.319) -- 0:00:51
Average standard deviation of split frequencies: 0.018034
190500 -- (-641.550) [-642.688] (-641.536) (-642.171) * [-644.795] (-645.561) (-644.578) (-642.019) -- 0:00:50
191000 -- (-642.211) [-644.380] (-643.268) (-645.038) * (-641.361) (-642.809) (-642.835) [-643.589] -- 0:00:50
191500 -- (-642.117) (-644.101) [-643.182] (-643.124) * [-643.027] (-643.820) (-641.825) (-642.911) -- 0:00:50
192000 -- (-644.589) (-644.327) [-641.895] (-641.938) * (-645.639) (-644.808) [-643.105] (-646.387) -- 0:00:50
192500 -- (-644.959) (-645.996) [-643.055] (-642.904) * [-642.317] (-645.062) (-642.815) (-644.450) -- 0:00:50
193000 -- (-646.451) (-645.508) [-642.360] (-643.980) * (-644.600) (-647.434) (-642.957) [-641.453] -- 0:00:50
193500 -- [-645.055] (-643.237) (-642.522) (-645.023) * (-642.836) (-643.158) (-641.114) [-640.648] -- 0:00:50
194000 -- (-645.296) [-639.496] (-645.246) (-642.897) * (-641.736) (-643.326) [-642.027] (-642.378) -- 0:00:49
194500 -- (-642.685) (-642.632) (-642.658) [-641.723] * (-642.538) (-644.899) [-643.671] (-642.507) -- 0:00:49
195000 -- (-642.752) [-641.261] (-642.067) (-644.783) * (-641.901) (-646.422) (-642.846) [-642.247] -- 0:00:49
Average standard deviation of split frequencies: 0.016270
195500 -- (-641.674) (-648.905) (-643.005) [-641.922] * (-644.782) (-642.062) (-643.583) [-642.436] -- 0:00:53
196000 -- (-641.958) (-645.590) [-643.451] (-643.508) * [-641.692] (-643.341) (-642.007) (-642.204) -- 0:00:53
196500 -- (-645.131) (-644.115) (-645.569) [-642.653] * (-641.423) [-643.693] (-642.818) (-642.605) -- 0:00:53
197000 -- (-643.893) (-641.474) [-640.764] (-643.791) * (-642.936) [-642.840] (-649.957) (-644.219) -- 0:00:52
197500 -- [-642.512] (-641.102) (-643.573) (-643.126) * (-644.773) (-643.223) (-647.578) [-642.395] -- 0:00:52
198000 -- (-642.948) (-643.188) [-644.383] (-643.100) * (-642.120) [-644.814] (-645.689) (-644.858) -- 0:00:52
198500 -- [-644.368] (-644.358) (-643.005) (-644.134) * (-643.472) [-644.931] (-650.028) (-646.337) -- 0:00:52
199000 -- (-643.806) (-641.542) (-642.618) [-642.000] * (-645.869) (-643.342) (-651.841) [-642.431] -- 0:00:52
199500 -- [-642.971] (-646.995) (-642.224) (-643.250) * (-642.136) (-641.538) (-646.737) [-641.016] -- 0:00:52
200000 -- (-642.132) (-643.197) [-642.244] (-643.441) * (-645.946) (-646.931) (-643.554) [-640.005] -- 0:00:51
Average standard deviation of split frequencies: 0.016306
200500 -- (-642.539) (-642.156) (-642.205) [-643.852] * (-643.499) (-643.751) [-643.014] (-642.373) -- 0:00:51
201000 -- [-644.367] (-642.375) (-642.264) (-644.196) * (-641.381) [-642.853] (-643.939) (-641.595) -- 0:00:51
201500 -- [-643.670] (-642.229) (-643.201) (-646.012) * (-642.124) [-643.381] (-642.894) (-642.221) -- 0:00:51
202000 -- (-642.754) (-644.027) (-641.726) [-641.947] * (-643.140) [-641.721] (-643.658) (-642.421) -- 0:00:51
202500 -- (-644.872) (-644.989) [-644.375] (-640.718) * (-646.322) (-642.251) (-642.358) [-645.631] -- 0:00:51
203000 -- [-644.673] (-642.958) (-654.050) (-643.501) * (-644.943) (-640.935) [-643.489] (-644.980) -- 0:00:51
203500 -- (-645.172) (-645.662) [-643.008] (-646.448) * (-641.678) (-642.602) [-644.910] (-644.285) -- 0:00:50
204000 -- (-643.672) [-642.124] (-641.801) (-645.789) * (-645.442) (-644.380) [-641.856] (-642.157) -- 0:00:50
204500 -- (-643.240) (-642.623) [-643.267] (-642.592) * (-642.407) (-643.449) [-645.263] (-644.825) -- 0:00:50
205000 -- (-641.739) (-642.170) [-642.852] (-644.911) * (-643.471) (-643.526) [-642.077] (-644.308) -- 0:00:50
Average standard deviation of split frequencies: 0.016146
205500 -- (-643.952) (-643.279) [-643.209] (-650.682) * (-644.288) (-647.970) [-641.114] (-643.398) -- 0:00:50
206000 -- [-641.981] (-646.735) (-643.011) (-648.578) * (-648.684) [-644.906] (-641.107) (-640.159) -- 0:00:50
206500 -- (-642.847) [-645.285] (-645.170) (-644.788) * (-643.287) (-643.465) [-640.669] (-640.871) -- 0:00:49
207000 -- (-645.161) (-642.239) [-641.904] (-644.891) * (-641.687) (-644.078) [-643.499] (-642.160) -- 0:00:49
207500 -- [-642.632] (-645.783) (-644.723) (-642.957) * (-641.779) (-644.468) (-649.508) [-642.510] -- 0:00:49
208000 -- (-643.067) (-644.892) [-648.738] (-645.276) * [-644.499] (-645.743) (-644.627) (-646.054) -- 0:00:49
208500 -- [-643.448] (-640.819) (-644.051) (-642.482) * (-642.734) [-644.598] (-643.280) (-643.659) -- 0:00:49
209000 -- (-646.704) (-642.118) (-644.767) [-648.420] * [-647.368] (-641.891) (-641.867) (-642.357) -- 0:00:49
209500 -- (-644.047) (-640.847) [-642.914] (-644.300) * (-642.794) [-641.498] (-639.186) (-643.670) -- 0:00:49
210000 -- [-644.197] (-645.492) (-645.326) (-645.043) * [-646.681] (-641.739) (-639.052) (-645.139) -- 0:00:48
Average standard deviation of split frequencies: 0.016285
210500 -- (-643.621) [-640.138] (-643.551) (-642.038) * (-642.764) [-642.822] (-638.892) (-640.202) -- 0:00:48
211000 -- (-642.485) [-642.441] (-644.827) (-647.158) * (-645.307) [-645.551] (-642.665) (-641.928) -- 0:00:52
211500 -- [-642.378] (-642.409) (-643.205) (-641.694) * (-643.790) (-643.356) (-642.581) [-643.624] -- 0:00:52
212000 -- (-642.143) [-642.713] (-644.456) (-644.170) * (-653.518) (-646.318) [-640.389] (-639.229) -- 0:00:52
212500 -- [-644.238] (-642.081) (-641.894) (-644.105) * (-647.430) (-642.555) [-643.777] (-643.220) -- 0:00:51
213000 -- (-642.792) (-641.547) [-643.150] (-645.062) * (-643.489) (-642.860) [-643.311] (-642.226) -- 0:00:51
213500 -- [-643.972] (-643.823) (-642.311) (-641.703) * (-646.954) [-643.136] (-641.682) (-643.011) -- 0:00:51
214000 -- [-642.875] (-645.075) (-643.731) (-642.879) * [-640.792] (-640.960) (-645.366) (-643.858) -- 0:00:51
214500 -- [-642.843] (-645.307) (-639.965) (-642.756) * (-643.724) (-642.098) (-647.255) [-643.246] -- 0:00:51
215000 -- (-643.329) (-644.355) [-641.756] (-642.324) * (-645.981) (-641.571) [-642.434] (-643.118) -- 0:00:51
Average standard deviation of split frequencies: 0.017074
215500 -- [-642.624] (-640.096) (-641.594) (-642.141) * (-645.377) [-643.575] (-643.102) (-644.739) -- 0:00:50
216000 -- (-642.767) (-642.209) [-642.183] (-643.376) * (-642.595) (-645.244) (-643.183) [-641.557] -- 0:00:50
216500 -- (-645.028) (-642.132) [-642.577] (-644.008) * [-641.620] (-642.399) (-641.263) (-642.497) -- 0:00:50
217000 -- (-648.645) [-639.522] (-641.557) (-641.996) * [-641.666] (-643.341) (-643.175) (-641.875) -- 0:00:50
217500 -- (-644.532) (-642.554) [-642.223] (-641.441) * (-641.718) (-643.785) (-639.222) [-641.987] -- 0:00:50
218000 -- (-643.702) (-643.411) [-641.803] (-641.832) * [-641.821] (-642.778) (-643.397) (-643.762) -- 0:00:50
218500 -- (-642.880) (-642.898) (-643.220) [-641.910] * (-640.924) (-642.934) [-641.232] (-643.897) -- 0:00:50
219000 -- (-643.476) (-644.584) [-643.713] (-642.861) * [-641.895] (-644.223) (-643.222) (-643.728) -- 0:00:49
219500 -- (-644.272) (-644.536) (-642.837) [-641.205] * (-645.885) (-642.308) (-643.319) [-641.790] -- 0:00:49
220000 -- [-642.755] (-645.278) (-645.034) (-640.706) * (-640.412) (-641.454) [-641.934] (-644.343) -- 0:00:49
Average standard deviation of split frequencies: 0.018472
220500 -- [-642.519] (-642.607) (-643.094) (-643.181) * (-642.618) (-640.685) [-644.152] (-644.065) -- 0:00:49
221000 -- (-648.302) [-644.675] (-646.583) (-643.863) * (-641.967) (-642.889) (-642.547) [-643.804] -- 0:00:49
221500 -- (-643.021) (-642.545) (-648.037) [-642.234] * [-639.652] (-642.305) (-643.675) (-646.146) -- 0:00:49
222000 -- [-642.093] (-648.107) (-640.396) (-642.518) * [-641.165] (-641.594) (-641.584) (-643.622) -- 0:00:49
222500 -- (-642.556) (-644.778) (-642.543) [-642.621] * (-641.804) (-646.112) (-640.311) [-644.054] -- 0:00:48
223000 -- [-642.135] (-643.638) (-643.682) (-640.808) * (-641.706) [-644.021] (-647.114) (-642.667) -- 0:00:48
223500 -- [-645.267] (-643.458) (-642.721) (-643.085) * (-645.101) (-643.004) (-647.045) [-641.544] -- 0:00:48
224000 -- (-643.967) (-642.024) [-643.658] (-641.293) * [-638.094] (-645.129) (-651.473) (-643.864) -- 0:00:48
224500 -- (-644.936) (-642.524) [-642.070] (-643.268) * (-642.991) (-644.585) [-644.122] (-642.906) -- 0:00:48
225000 -- (-644.703) [-646.359] (-642.851) (-644.090) * (-640.230) [-644.223] (-642.952) (-642.938) -- 0:00:48
Average standard deviation of split frequencies: 0.018773
225500 -- (-643.855) [-644.789] (-643.640) (-641.762) * [-642.722] (-643.170) (-639.106) (-643.476) -- 0:00:48
226000 -- [-643.249] (-643.652) (-643.334) (-643.080) * (-642.725) (-642.218) (-640.662) [-642.003] -- 0:00:47
226500 -- (-642.439) (-642.925) (-645.936) [-639.544] * (-642.805) (-644.659) [-642.219] (-641.906) -- 0:00:47
227000 -- (-645.734) (-642.094) [-641.822] (-641.726) * (-639.967) (-641.860) [-644.424] (-639.325) -- 0:00:51
227500 -- (-643.244) [-642.969] (-645.259) (-639.893) * (-642.427) (-640.830) [-641.718] (-640.436) -- 0:00:50
228000 -- (-640.838) (-642.072) (-641.237) [-642.948] * [-638.487] (-643.398) (-640.342) (-640.094) -- 0:00:50
228500 -- (-640.863) (-642.499) (-644.424) [-641.568] * (-644.146) (-643.160) (-641.517) [-642.485] -- 0:00:50
229000 -- (-645.497) (-645.913) (-644.107) [-644.131] * (-644.202) (-641.866) (-646.118) [-643.018] -- 0:00:50
229500 -- [-642.783] (-642.644) (-645.075) (-643.515) * [-642.509] (-644.758) (-645.070) (-640.194) -- 0:00:50
230000 -- (-648.203) [-644.301] (-642.567) (-642.443) * [-645.661] (-646.317) (-645.315) (-641.474) -- 0:00:50
Average standard deviation of split frequencies: 0.017371
230500 -- (-644.600) [-644.883] (-644.677) (-644.599) * (-642.398) (-642.202) (-646.044) [-640.013] -- 0:00:50
231000 -- (-640.955) (-643.487) [-643.938] (-643.293) * [-641.633] (-642.921) (-645.239) (-639.329) -- 0:00:49
231500 -- (-641.523) (-643.904) [-641.418] (-643.031) * (-643.174) (-642.683) (-641.632) [-641.687] -- 0:00:49
232000 -- (-643.713) [-642.521] (-642.929) (-642.804) * (-643.145) [-644.612] (-642.966) (-644.157) -- 0:00:49
232500 -- (-643.597) [-639.154] (-643.364) (-643.981) * (-646.934) (-649.632) [-639.540] (-645.689) -- 0:00:49
233000 -- (-644.460) (-641.962) (-644.298) [-642.624] * (-642.607) (-643.067) (-641.736) [-641.220] -- 0:00:49
233500 -- [-642.347] (-642.223) (-647.869) (-641.858) * (-641.446) (-643.121) (-642.717) [-641.721] -- 0:00:49
234000 -- [-643.500] (-642.600) (-639.600) (-643.351) * [-640.712] (-643.485) (-639.943) (-640.329) -- 0:00:49
234500 -- (-643.409) [-640.340] (-642.401) (-642.082) * (-645.084) [-640.902] (-639.981) (-639.623) -- 0:00:48
235000 -- (-640.528) (-641.766) [-642.801] (-644.816) * (-644.316) (-647.167) (-643.494) [-641.345] -- 0:00:48
Average standard deviation of split frequencies: 0.015980
235500 -- (-642.080) (-642.945) (-644.788) [-642.157] * [-639.216] (-645.513) (-643.757) (-644.150) -- 0:00:48
236000 -- [-643.901] (-642.464) (-640.097) (-643.444) * (-644.037) (-644.806) (-645.888) [-638.922] -- 0:00:48
236500 -- (-641.777) (-645.009) (-639.777) [-642.236] * (-643.565) (-643.149) [-644.794] (-644.239) -- 0:00:48
237000 -- (-645.201) [-645.824] (-643.498) (-646.858) * (-642.996) (-643.259) [-641.890] (-646.278) -- 0:00:48
237500 -- (-643.094) (-639.968) [-645.124] (-647.687) * (-644.146) [-643.858] (-642.532) (-643.745) -- 0:00:48
238000 -- (-642.651) (-639.412) [-639.383] (-643.292) * [-643.135] (-643.044) (-647.095) (-642.644) -- 0:00:48
238500 -- [-641.240] (-643.387) (-646.780) (-643.562) * (-641.397) (-643.375) [-641.376] (-640.811) -- 0:00:47
239000 -- (-643.583) (-642.147) (-646.192) [-645.134] * (-641.997) (-642.763) (-643.490) [-640.014] -- 0:00:47
239500 -- (-644.132) (-641.787) [-642.139] (-646.916) * (-643.914) (-643.666) (-644.554) [-641.329] -- 0:00:47
240000 -- (-642.370) [-641.726] (-642.360) (-641.963) * [-643.963] (-642.025) (-645.814) (-641.791) -- 0:00:47
Average standard deviation of split frequencies: 0.016758
240500 -- (-646.687) (-642.772) [-642.303] (-643.663) * (-642.634) (-643.013) (-642.228) [-639.802] -- 0:00:47
241000 -- (-644.419) [-641.567] (-642.385) (-644.263) * (-642.808) (-646.494) (-640.307) [-641.594] -- 0:00:47
241500 -- (-644.081) (-641.821) (-644.606) [-642.584] * (-641.886) (-643.679) [-642.284] (-647.643) -- 0:00:47
242000 -- (-644.033) [-642.630] (-642.012) (-643.549) * [-641.908] (-643.735) (-642.077) (-643.611) -- 0:00:46
242500 -- (-645.197) (-642.109) [-641.464] (-644.444) * (-641.588) (-643.017) [-643.113] (-644.554) -- 0:00:46
243000 -- (-642.862) (-642.525) [-642.484] (-641.941) * [-639.408] (-642.123) (-642.431) (-647.068) -- 0:00:49
243500 -- (-645.475) (-642.395) (-642.628) [-642.122] * (-641.417) [-642.955] (-643.194) (-644.409) -- 0:00:49
244000 -- (-643.148) [-642.978] (-642.139) (-641.506) * (-641.616) [-642.196] (-641.964) (-639.905) -- 0:00:49
244500 -- (-646.370) (-644.579) [-642.754] (-641.412) * (-639.772) [-641.745] (-639.907) (-640.604) -- 0:00:49
245000 -- (-642.754) (-642.234) [-641.914] (-640.167) * (-641.138) [-643.252] (-643.301) (-645.976) -- 0:00:49
Average standard deviation of split frequencies: 0.016608
245500 -- (-641.570) (-644.026) [-640.750] (-641.898) * [-646.740] (-643.798) (-644.316) (-643.581) -- 0:00:49
246000 -- (-643.434) (-642.327) [-641.910] (-641.840) * (-645.468) (-644.549) (-642.689) [-648.985] -- 0:00:49
246500 -- [-643.715] (-642.320) (-642.638) (-642.464) * (-643.181) (-645.611) (-643.207) [-646.068] -- 0:00:48
247000 -- (-643.161) (-641.001) [-643.647] (-642.460) * (-645.786) (-647.476) [-639.901] (-646.595) -- 0:00:48
247500 -- (-642.727) (-641.760) [-641.887] (-641.822) * [-642.531] (-643.382) (-644.929) (-649.862) -- 0:00:48
248000 -- [-643.279] (-641.373) (-642.629) (-642.020) * (-642.720) [-642.111] (-650.553) (-646.458) -- 0:00:48
248500 -- (-642.793) [-642.397] (-642.104) (-642.262) * [-641.286] (-644.056) (-646.335) (-643.196) -- 0:00:48
249000 -- (-645.875) [-640.058] (-643.551) (-641.364) * (-642.043) (-641.820) [-641.120] (-642.699) -- 0:00:48
249500 -- [-642.401] (-642.375) (-645.543) (-645.773) * (-645.018) (-642.218) (-640.904) [-642.185] -- 0:00:48
250000 -- (-643.357) (-645.299) (-641.505) [-643.479] * (-641.867) [-643.119] (-644.242) (-644.736) -- 0:00:48
Average standard deviation of split frequencies: 0.015567
250500 -- (-643.998) [-642.184] (-639.091) (-644.353) * [-642.156] (-642.736) (-641.495) (-644.008) -- 0:00:47
251000 -- [-640.410] (-642.343) (-645.528) (-642.135) * [-642.358] (-643.558) (-642.419) (-645.923) -- 0:00:47
251500 -- (-641.722) [-649.004] (-643.715) (-642.404) * (-641.530) (-641.970) [-640.495] (-643.256) -- 0:00:47
252000 -- (-641.906) (-643.068) (-641.610) [-642.073] * [-640.887] (-643.343) (-641.312) (-644.809) -- 0:00:47
252500 -- (-644.623) (-643.200) [-641.551] (-642.549) * (-641.346) (-644.663) (-643.240) [-646.090] -- 0:00:47
253000 -- (-644.140) (-648.163) (-640.836) [-647.656] * (-641.453) (-643.324) (-642.198) [-643.138] -- 0:00:47
253500 -- (-645.095) (-643.146) (-644.182) [-641.637] * (-640.594) [-643.363] (-641.820) (-641.847) -- 0:00:47
254000 -- (-650.423) (-643.314) [-641.446] (-642.107) * [-641.820] (-643.393) (-642.960) (-640.788) -- 0:00:46
254500 -- (-643.391) (-643.741) [-641.513] (-642.856) * [-641.367] (-642.384) (-644.161) (-640.589) -- 0:00:46
255000 -- (-646.487) [-641.328] (-642.614) (-645.583) * [-641.041] (-642.553) (-645.952) (-642.475) -- 0:00:46
Average standard deviation of split frequencies: 0.014731
255500 -- (-647.435) (-644.293) [-642.883] (-641.638) * [-640.120] (-646.266) (-644.634) (-642.197) -- 0:00:46
256000 -- (-641.928) [-641.342] (-641.965) (-644.557) * [-641.296] (-648.140) (-642.879) (-644.417) -- 0:00:46
256500 -- (-643.006) (-642.840) [-644.330] (-642.170) * [-639.978] (-645.660) (-643.677) (-644.000) -- 0:00:46
257000 -- (-643.524) [-641.704] (-641.796) (-646.806) * (-643.613) [-641.618] (-642.813) (-644.249) -- 0:00:46
257500 -- [-642.549] (-642.291) (-642.528) (-642.972) * (-642.371) (-644.602) [-644.483] (-641.361) -- 0:00:46
258000 -- (-641.660) [-645.712] (-640.466) (-641.812) * (-643.360) (-643.371) [-639.693] (-643.169) -- 0:00:46
258500 -- (-643.605) (-641.105) [-643.885] (-646.632) * (-642.544) (-644.386) [-643.463] (-641.952) -- 0:00:45
259000 -- (-641.995) (-642.107) (-643.545) [-642.054] * (-638.710) (-642.283) [-642.554] (-641.640) -- 0:00:48
259500 -- [-644.302] (-641.933) (-642.011) (-643.131) * (-640.501) (-642.274) (-641.292) [-642.059] -- 0:00:48
260000 -- [-643.329] (-644.106) (-645.067) (-642.224) * [-640.738] (-642.785) (-644.099) (-643.321) -- 0:00:48
Average standard deviation of split frequencies: 0.013764
260500 -- [-643.843] (-642.050) (-643.214) (-639.585) * [-640.587] (-643.239) (-642.653) (-645.042) -- 0:00:48
261000 -- (-643.290) (-642.862) [-646.661] (-642.373) * [-640.722] (-643.151) (-642.389) (-642.165) -- 0:00:48
261500 -- [-642.365] (-645.210) (-641.883) (-648.479) * [-643.839] (-642.037) (-645.281) (-642.857) -- 0:00:48
262000 -- [-639.684] (-644.338) (-642.917) (-647.657) * (-640.682) (-645.522) [-643.027] (-644.275) -- 0:00:47
262500 -- [-641.526] (-641.606) (-641.505) (-645.934) * [-639.546] (-646.256) (-642.607) (-642.700) -- 0:00:47
263000 -- [-640.734] (-644.011) (-642.710) (-642.462) * (-643.482) (-643.097) (-640.395) [-642.734] -- 0:00:47
263500 -- (-644.027) (-645.521) (-641.406) [-640.791] * [-642.762] (-642.070) (-647.575) (-642.710) -- 0:00:47
264000 -- [-644.272] (-641.089) (-640.934) (-640.803) * (-643.181) (-643.556) [-645.305] (-642.114) -- 0:00:47
264500 -- (-644.117) (-642.176) (-642.657) [-639.231] * (-641.617) (-644.461) (-641.571) [-642.766] -- 0:00:47
265000 -- (-643.154) (-642.770) [-641.771] (-642.796) * (-640.474) [-645.271] (-642.392) (-640.713) -- 0:00:47
Average standard deviation of split frequencies: 0.014374
265500 -- (-642.308) (-643.407) (-643.311) [-642.856] * (-641.307) (-642.385) (-641.980) [-644.050] -- 0:00:47
266000 -- [-647.918] (-648.040) (-642.019) (-646.351) * (-642.253) (-643.825) [-642.026] (-648.528) -- 0:00:46
266500 -- (-641.493) (-643.641) (-641.835) [-641.752] * (-641.471) (-642.768) [-642.124] (-643.105) -- 0:00:46
267000 -- (-643.717) (-644.744) (-640.905) [-642.147] * (-643.366) [-641.465] (-644.553) (-646.046) -- 0:00:46
267500 -- [-640.951] (-644.935) (-643.498) (-641.219) * (-640.658) (-644.632) (-643.984) [-640.261] -- 0:00:46
268000 -- (-641.725) (-642.787) [-645.066] (-641.685) * [-642.489] (-645.120) (-639.236) (-643.083) -- 0:00:46
268500 -- (-643.570) (-642.342) (-641.912) [-640.698] * (-643.306) [-644.178] (-643.197) (-642.458) -- 0:00:46
269000 -- (-643.454) (-644.008) (-642.851) [-644.434] * (-643.722) (-645.225) (-646.141) [-643.172] -- 0:00:46
269500 -- (-642.322) (-645.161) [-643.004] (-643.259) * (-643.808) (-642.013) (-645.765) [-642.904] -- 0:00:46
270000 -- (-642.236) (-641.044) (-642.417) [-638.378] * (-644.999) (-641.959) (-642.025) [-643.329] -- 0:00:45
Average standard deviation of split frequencies: 0.014417
270500 -- [-642.444] (-641.420) (-643.669) (-641.846) * (-640.460) (-646.091) (-641.936) [-645.430] -- 0:00:45
271000 -- (-644.935) [-642.369] (-642.497) (-639.374) * (-644.065) (-643.402) [-641.561] (-644.497) -- 0:00:45
271500 -- [-645.381] (-641.867) (-640.357) (-641.332) * (-640.766) (-641.006) (-642.693) [-643.308] -- 0:00:45
272000 -- [-642.114] (-640.345) (-640.650) (-644.633) * (-642.399) (-641.498) [-640.352] (-642.627) -- 0:00:45
272500 -- (-643.458) [-642.968] (-640.279) (-642.774) * (-642.935) [-646.704] (-645.556) (-640.872) -- 0:00:45
273000 -- (-641.825) (-642.899) [-644.231] (-643.072) * (-642.650) (-644.669) [-645.307] (-641.796) -- 0:00:45
273500 -- (-641.549) (-648.536) (-642.898) [-641.407] * [-641.554] (-640.417) (-642.695) (-638.765) -- 0:00:47
274000 -- [-644.223] (-642.300) (-642.634) (-644.657) * (-642.068) (-643.256) [-640.616] (-643.225) -- 0:00:47
274500 -- (-639.504) [-643.721] (-640.733) (-650.022) * (-642.850) (-643.050) [-640.642] (-640.697) -- 0:00:47
275000 -- (-647.376) [-640.918] (-639.610) (-641.885) * (-643.521) (-641.542) (-644.186) [-640.390] -- 0:00:47
Average standard deviation of split frequencies: 0.013569
275500 -- (-641.294) (-643.416) [-639.798] (-643.689) * [-642.436] (-642.965) (-639.339) (-643.738) -- 0:00:47
276000 -- (-642.166) (-644.083) (-641.158) [-643.329] * (-644.261) (-642.196) (-640.661) [-641.862] -- 0:00:47
276500 -- (-642.583) [-643.167] (-641.463) (-643.104) * (-642.086) [-645.634] (-644.551) (-642.599) -- 0:00:47
277000 -- (-642.047) (-644.113) [-642.683] (-642.336) * (-645.607) (-643.658) (-640.069) [-641.472] -- 0:00:46
277500 -- [-643.354] (-644.258) (-641.041) (-641.449) * [-641.921] (-643.320) (-642.092) (-643.935) -- 0:00:46
278000 -- [-644.570] (-647.153) (-641.750) (-642.895) * (-646.099) (-644.652) (-645.896) [-642.832] -- 0:00:46
278500 -- (-643.289) (-640.810) [-643.335] (-640.185) * (-647.974) (-644.242) (-645.329) [-640.370] -- 0:00:46
279000 -- (-644.407) (-641.368) (-641.750) [-642.088] * (-643.131) (-644.124) (-644.739) [-641.783] -- 0:00:46
279500 -- (-643.606) (-643.801) (-642.014) [-643.765] * (-647.051) (-642.857) [-646.769] (-640.294) -- 0:00:46
280000 -- (-644.303) [-639.670] (-642.146) (-643.661) * (-643.574) (-643.615) (-643.693) [-640.392] -- 0:00:46
Average standard deviation of split frequencies: 0.013530
280500 -- (-642.078) (-643.126) (-641.515) [-641.364] * (-643.789) (-643.202) [-645.559] (-644.445) -- 0:00:46
281000 -- [-642.540] (-639.065) (-641.886) (-643.144) * (-647.739) (-642.221) (-643.399) [-642.641] -- 0:00:46
281500 -- (-645.079) (-641.784) [-639.197] (-643.628) * (-645.695) (-642.602) (-641.141) [-644.523] -- 0:00:45
282000 -- (-645.983) [-642.725] (-644.194) (-643.945) * [-642.999] (-640.435) (-642.032) (-644.034) -- 0:00:45
282500 -- [-641.820] (-644.818) (-642.999) (-642.118) * [-644.367] (-641.684) (-642.667) (-643.338) -- 0:00:45
283000 -- [-642.115] (-641.639) (-643.641) (-642.968) * [-640.212] (-644.824) (-645.082) (-644.598) -- 0:00:45
283500 -- (-642.740) (-642.382) [-643.586] (-643.208) * (-640.288) (-643.756) [-641.580] (-644.098) -- 0:00:45
284000 -- [-641.644] (-640.189) (-643.481) (-644.128) * (-644.716) [-641.865] (-643.242) (-645.868) -- 0:00:45
284500 -- (-643.797) [-641.474] (-640.598) (-643.263) * (-642.213) (-647.123) [-642.377] (-644.998) -- 0:00:45
285000 -- (-645.197) (-642.827) [-641.290] (-641.419) * (-642.349) [-642.200] (-641.628) (-646.712) -- 0:00:45
Average standard deviation of split frequencies: 0.015109
285500 -- [-647.306] (-642.640) (-642.807) (-643.654) * [-642.759] (-643.872) (-642.636) (-646.485) -- 0:00:45
286000 -- (-641.039) (-642.420) [-643.631] (-644.241) * (-643.875) [-641.844] (-642.261) (-647.260) -- 0:00:44
286500 -- [-642.685] (-644.151) (-642.427) (-641.880) * (-644.574) (-642.400) [-640.939] (-646.486) -- 0:00:44
287000 -- (-642.008) [-641.780] (-640.887) (-647.528) * (-642.562) (-647.292) [-639.854] (-646.238) -- 0:00:44
287500 -- (-643.011) (-643.129) (-642.319) [-641.957] * (-643.561) (-645.224) [-640.580] (-644.263) -- 0:00:44
288000 -- (-644.229) (-641.693) [-643.376] (-644.653) * (-645.310) (-647.435) [-643.727] (-642.235) -- 0:00:44
288500 -- (-644.541) [-640.806] (-645.991) (-642.293) * (-645.236) (-640.287) [-642.354] (-642.857) -- 0:00:44
289000 -- (-643.364) [-639.917] (-641.393) (-642.700) * (-642.831) (-644.183) [-639.976] (-646.031) -- 0:00:44
289500 -- [-645.692] (-646.331) (-639.888) (-647.140) * (-645.518) (-644.059) [-640.505] (-645.429) -- 0:00:46
290000 -- [-642.685] (-641.375) (-641.544) (-644.226) * [-640.237] (-641.615) (-648.314) (-645.119) -- 0:00:46
Average standard deviation of split frequencies: 0.015137
290500 -- (-648.288) (-643.807) (-640.530) [-642.428] * [-646.814] (-640.411) (-643.088) (-643.225) -- 0:00:46
291000 -- [-643.060] (-643.668) (-641.532) (-642.317) * (-647.292) (-641.257) [-641.207] (-644.570) -- 0:00:46
291500 -- (-643.614) (-643.796) [-644.846] (-645.526) * (-646.947) [-645.685] (-641.244) (-640.784) -- 0:00:46
292000 -- [-643.504] (-642.313) (-645.289) (-643.064) * (-643.067) (-641.251) [-644.314] (-642.412) -- 0:00:46
292500 -- (-645.914) (-641.615) (-647.933) [-643.647] * (-642.069) [-645.154] (-641.783) (-643.749) -- 0:00:45
293000 -- (-642.540) [-642.779] (-642.040) (-642.274) * [-641.751] (-643.941) (-646.453) (-643.454) -- 0:00:45
293500 -- (-643.613) [-642.064] (-639.289) (-643.468) * [-641.851] (-644.751) (-646.369) (-643.156) -- 0:00:45
294000 -- (-642.869) (-641.767) (-641.602) [-644.093] * [-644.023] (-640.145) (-645.346) (-646.110) -- 0:00:45
294500 -- (-642.492) [-644.811] (-641.749) (-642.352) * (-642.057) (-643.510) [-643.697] (-643.139) -- 0:00:45
295000 -- [-644.036] (-646.013) (-640.178) (-644.613) * (-643.194) (-643.972) [-643.383] (-642.258) -- 0:00:45
Average standard deviation of split frequencies: 0.014422
295500 -- (-642.990) (-642.498) [-642.141] (-642.117) * (-641.671) (-648.038) (-641.394) [-640.755] -- 0:00:45
296000 -- [-640.578] (-641.136) (-643.535) (-644.473) * (-644.353) [-643.240] (-641.719) (-646.896) -- 0:00:45
296500 -- [-642.442] (-643.976) (-644.688) (-644.873) * [-642.851] (-645.304) (-641.942) (-642.406) -- 0:00:45
297000 -- (-643.866) [-647.425] (-642.103) (-643.506) * (-642.131) [-642.747] (-643.323) (-643.414) -- 0:00:44
297500 -- (-643.662) (-641.659) (-647.070) [-642.633] * (-643.313) (-643.213) [-640.889] (-643.840) -- 0:00:44
298000 -- (-648.838) [-643.870] (-642.544) (-642.680) * (-644.210) (-644.601) [-642.650] (-641.359) -- 0:00:44
298500 -- (-646.879) [-644.170] (-641.244) (-644.257) * [-641.467] (-644.307) (-642.529) (-641.800) -- 0:00:44
299000 -- (-645.067) (-647.417) [-642.391] (-646.495) * (-641.427) (-646.666) [-640.824] (-644.817) -- 0:00:44
299500 -- (-644.144) [-642.470] (-645.924) (-644.527) * [-644.812] (-645.335) (-641.699) (-640.741) -- 0:00:44
300000 -- [-645.434] (-641.712) (-646.242) (-642.976) * (-641.848) [-644.390] (-643.334) (-646.659) -- 0:00:44
Average standard deviation of split frequencies: 0.013588
300500 -- [-642.752] (-644.572) (-640.629) (-642.244) * (-647.182) (-643.950) [-641.432] (-643.539) -- 0:00:44
301000 -- (-640.149) (-644.495) [-642.026] (-645.290) * [-644.151] (-643.259) (-645.632) (-644.496) -- 0:00:44
301500 -- [-642.068] (-642.619) (-645.100) (-644.036) * (-648.068) (-643.368) (-641.232) [-644.377] -- 0:00:44
302000 -- (-647.308) (-641.272) (-640.021) [-644.298] * (-644.426) (-641.674) (-645.078) [-644.437] -- 0:00:43
302500 -- (-643.624) [-642.803] (-641.914) (-645.497) * (-646.533) (-641.789) (-646.752) [-642.678] -- 0:00:43
303000 -- (-644.349) (-641.880) (-641.383) [-643.016] * (-642.016) [-646.270] (-646.270) (-642.276) -- 0:00:43
303500 -- [-641.959] (-642.372) (-642.362) (-642.825) * [-644.437] (-646.354) (-644.936) (-642.598) -- 0:00:43
304000 -- (-641.894) (-641.358) [-643.332] (-645.000) * (-646.673) (-643.515) (-641.218) [-644.567] -- 0:00:43
304500 -- (-643.515) [-643.665] (-641.329) (-642.193) * (-642.821) (-645.850) (-643.614) [-642.099] -- 0:00:43
305000 -- (-642.097) (-640.717) [-648.838] (-643.696) * [-642.436] (-645.868) (-642.543) (-643.910) -- 0:00:45
Average standard deviation of split frequencies: 0.014721
305500 -- (-643.358) (-639.193) (-643.693) [-642.348] * (-644.059) (-643.918) (-642.894) [-640.724] -- 0:00:45
306000 -- (-643.944) [-641.772] (-641.422) (-642.301) * (-640.259) (-641.645) [-643.470] (-644.135) -- 0:00:45
306500 -- (-642.165) (-642.573) (-640.162) [-643.159] * (-647.308) (-646.414) [-643.387] (-642.685) -- 0:00:45
307000 -- (-643.419) (-643.405) [-642.290] (-641.943) * [-640.375] (-643.309) (-644.130) (-641.088) -- 0:00:45
307500 -- (-643.513) (-643.874) (-643.756) [-642.544] * (-644.053) (-643.867) (-642.594) [-642.793] -- 0:00:45
308000 -- (-644.062) (-646.648) [-641.101] (-642.517) * (-641.669) (-640.682) (-641.319) [-642.540] -- 0:00:44
308500 -- (-643.540) (-641.529) (-642.101) [-642.972] * [-641.847] (-642.745) (-642.114) (-644.083) -- 0:00:44
309000 -- (-643.282) (-639.001) (-642.265) [-644.270] * [-640.155] (-644.950) (-646.156) (-640.357) -- 0:00:44
309500 -- (-643.993) (-641.831) [-641.442] (-644.125) * (-642.534) (-640.992) [-642.377] (-645.009) -- 0:00:44
310000 -- (-642.780) [-642.727] (-642.858) (-642.204) * (-641.855) (-642.456) [-642.646] (-643.324) -- 0:00:44
Average standard deviation of split frequencies: 0.014837
310500 -- (-643.187) (-642.496) [-645.449] (-645.258) * (-644.694) (-640.843) (-641.979) [-643.330] -- 0:00:44
311000 -- (-647.083) (-643.667) [-644.371] (-642.640) * (-643.588) [-642.331] (-643.006) (-644.574) -- 0:00:44
311500 -- (-642.579) [-640.612] (-640.737) (-642.241) * [-642.037] (-643.823) (-645.820) (-642.377) -- 0:00:44
312000 -- [-642.910] (-642.990) (-641.808) (-642.349) * [-642.080] (-645.600) (-644.680) (-643.693) -- 0:00:44
312500 -- (-642.489) (-642.077) (-642.599) [-642.495] * (-643.277) (-644.672) (-644.458) [-640.448] -- 0:00:44
313000 -- (-641.549) (-642.668) [-642.878] (-642.047) * (-645.940) [-642.666] (-644.896) (-643.301) -- 0:00:43
313500 -- (-642.858) [-642.150] (-642.693) (-642.961) * (-646.137) (-643.621) (-643.443) [-644.234] -- 0:00:43
314000 -- [-642.410] (-648.738) (-640.462) (-644.032) * (-644.623) [-640.353] (-646.520) (-642.393) -- 0:00:43
314500 -- (-643.292) [-641.028] (-645.002) (-643.723) * (-644.046) [-644.508] (-641.533) (-643.297) -- 0:00:43
315000 -- (-643.300) (-643.770) (-644.535) [-643.350] * (-644.025) [-643.818] (-641.555) (-641.847) -- 0:00:43
Average standard deviation of split frequencies: 0.014835
315500 -- (-641.660) (-642.288) [-639.883] (-641.805) * (-645.216) (-643.027) [-641.765] (-642.099) -- 0:00:43
316000 -- (-643.730) [-640.768] (-645.946) (-640.745) * (-642.587) (-644.744) [-642.069] (-639.694) -- 0:00:43
316500 -- (-642.281) (-644.985) (-641.668) [-643.973] * (-642.615) (-641.497) [-640.238] (-641.415) -- 0:00:43
317000 -- (-642.562) (-642.363) [-641.695] (-641.278) * (-643.537) [-641.492] (-642.217) (-643.805) -- 0:00:43
317500 -- (-642.330) (-642.652) (-640.217) [-644.076] * (-643.181) [-639.578] (-647.433) (-641.930) -- 0:00:42
318000 -- (-642.068) (-641.581) (-642.272) [-640.440] * (-648.030) (-643.219) (-642.348) [-640.898] -- 0:00:42
318500 -- (-644.523) (-641.861) [-641.913] (-640.351) * (-641.450) (-642.535) (-644.015) [-644.429] -- 0:00:42
319000 -- (-643.868) (-641.397) [-643.580] (-641.309) * (-643.540) (-644.853) [-644.448] (-647.433) -- 0:00:42
319500 -- (-645.639) (-643.258) (-644.329) [-643.371] * (-646.348) (-642.222) [-643.902] (-646.670) -- 0:00:42
320000 -- (-641.639) (-642.156) [-642.095] (-641.660) * [-641.926] (-642.811) (-642.069) (-643.350) -- 0:00:42
Average standard deviation of split frequencies: 0.014537
320500 -- [-643.698] (-642.175) (-646.658) (-639.446) * (-644.121) [-644.828] (-643.230) (-640.629) -- 0:00:42
321000 -- (-641.968) (-645.737) [-642.073] (-642.066) * (-642.387) [-641.748] (-643.494) (-640.360) -- 0:00:44
321500 -- [-639.893] (-639.470) (-641.736) (-640.970) * (-642.075) (-639.922) (-643.321) [-647.123] -- 0:00:44
322000 -- (-641.826) (-646.207) (-641.508) [-643.402] * [-642.995] (-641.243) (-646.306) (-639.910) -- 0:00:44
322500 -- (-644.843) (-644.282) [-640.178] (-642.639) * (-639.207) (-643.248) (-642.648) [-640.629] -- 0:00:44
323000 -- [-641.694] (-649.581) (-641.963) (-644.791) * (-641.150) (-643.261) [-640.906] (-640.285) -- 0:00:44
323500 -- [-643.578] (-642.645) (-642.767) (-644.682) * (-644.404) [-644.658] (-642.252) (-643.906) -- 0:00:43
324000 -- [-643.047] (-646.039) (-641.043) (-643.674) * [-641.794] (-642.260) (-642.009) (-647.176) -- 0:00:43
324500 -- (-641.785) (-641.366) [-641.935] (-644.825) * [-639.792] (-644.490) (-644.585) (-646.788) -- 0:00:43
325000 -- [-641.032] (-642.562) (-642.259) (-642.423) * (-642.107) [-642.668] (-639.272) (-644.445) -- 0:00:43
Average standard deviation of split frequencies: 0.013851
325500 -- (-642.157) (-644.599) (-641.523) [-643.272] * (-642.189) [-642.891] (-645.797) (-641.686) -- 0:00:43
326000 -- (-643.487) [-643.180] (-641.964) (-646.894) * (-641.675) (-641.826) [-643.374] (-643.574) -- 0:00:43
326500 -- (-642.984) (-645.578) [-641.963] (-641.589) * (-641.730) [-640.875] (-643.637) (-642.253) -- 0:00:43
327000 -- (-642.436) (-641.716) (-645.514) [-642.013] * (-642.058) (-643.279) (-646.585) [-644.121] -- 0:00:43
327500 -- (-644.131) (-641.415) (-642.225) [-640.723] * (-644.780) (-648.434) (-644.110) [-646.449] -- 0:00:43
328000 -- (-644.297) [-642.908] (-643.530) (-642.393) * (-641.278) (-642.862) (-643.464) [-640.472] -- 0:00:43
328500 -- (-639.805) (-642.260) [-642.233] (-641.026) * (-646.016) [-642.112] (-640.371) (-642.944) -- 0:00:42
329000 -- [-638.834] (-642.402) (-645.590) (-643.815) * (-643.495) (-641.802) [-639.901] (-641.841) -- 0:00:42
329500 -- [-639.363] (-643.429) (-639.489) (-641.954) * (-645.296) (-642.461) [-640.069] (-643.144) -- 0:00:42
330000 -- (-640.103) [-644.712] (-641.286) (-643.697) * (-641.825) [-646.268] (-641.020) (-646.878) -- 0:00:42
Average standard deviation of split frequencies: 0.013881
330500 -- [-643.728] (-640.638) (-639.897) (-643.603) * (-644.824) (-647.768) (-645.016) [-642.004] -- 0:00:42
331000 -- (-641.655) [-642.776] (-645.532) (-643.224) * (-641.915) [-646.220] (-641.470) (-643.349) -- 0:00:42
331500 -- (-642.904) (-645.853) (-646.185) [-642.412] * (-642.627) (-648.951) [-641.847] (-643.748) -- 0:00:42
332000 -- (-643.742) (-642.065) [-641.827] (-640.667) * (-642.747) (-642.600) [-640.175] (-639.017) -- 0:00:42
332500 -- [-640.222] (-644.538) (-643.699) (-644.313) * (-642.422) (-646.726) [-639.885] (-640.814) -- 0:00:42
333000 -- (-641.524) (-645.839) [-642.256] (-640.844) * (-644.226) (-651.924) (-641.634) [-645.523] -- 0:00:42
333500 -- (-641.595) (-645.039) [-642.790] (-641.759) * (-643.518) (-649.274) [-642.074] (-640.935) -- 0:00:41
334000 -- (-641.379) (-642.894) (-642.013) [-645.996] * [-642.386] (-645.662) (-641.671) (-642.498) -- 0:00:41
334500 -- (-643.196) [-641.890] (-643.992) (-642.832) * [-640.688] (-644.283) (-642.874) (-645.760) -- 0:00:41
335000 -- (-645.167) (-644.397) [-643.861] (-642.340) * (-641.763) (-641.626) [-647.095] (-642.248) -- 0:00:41
Average standard deviation of split frequencies: 0.013882
335500 -- (-644.614) (-645.063) (-643.021) [-640.222] * (-642.196) (-644.122) [-644.295] (-641.736) -- 0:00:41
336000 -- (-640.856) [-644.610] (-641.720) (-646.807) * (-644.114) (-643.254) [-642.095] (-643.613) -- 0:00:41
336500 -- (-641.728) [-645.525] (-640.580) (-644.113) * [-641.961] (-644.777) (-642.774) (-643.402) -- 0:00:43
337000 -- (-648.208) (-646.478) [-641.991] (-642.062) * (-640.837) (-643.453) [-643.163] (-644.006) -- 0:00:43
337500 -- (-645.939) (-646.617) [-640.414] (-642.248) * [-642.082] (-644.391) (-643.310) (-643.228) -- 0:00:43
338000 -- (-642.602) (-642.987) (-641.607) [-643.534] * (-642.696) (-643.254) (-643.682) [-643.673] -- 0:00:43
338500 -- (-640.992) (-642.775) [-643.384] (-645.732) * (-645.783) (-642.258) [-646.829] (-643.128) -- 0:00:42
339000 -- [-643.237] (-643.022) (-644.079) (-642.948) * [-641.067] (-643.458) (-642.334) (-647.134) -- 0:00:42
339500 -- (-644.371) (-641.683) (-640.426) [-643.103] * (-641.478) (-644.299) [-646.974] (-642.676) -- 0:00:42
340000 -- (-641.440) [-643.939] (-646.235) (-642.303) * (-642.081) [-642.095] (-641.554) (-646.960) -- 0:00:42
Average standard deviation of split frequencies: 0.013255
340500 -- (-640.536) (-642.698) [-642.928] (-645.019) * [-643.854] (-642.098) (-640.462) (-641.503) -- 0:00:42
341000 -- (-643.665) (-646.358) [-640.591] (-642.520) * (-641.709) (-644.812) (-645.012) [-641.567] -- 0:00:42
341500 -- [-643.094] (-643.098) (-642.853) (-640.557) * (-641.490) (-646.073) (-645.016) [-642.988] -- 0:00:42
342000 -- [-642.955] (-640.838) (-641.397) (-643.238) * (-643.245) (-643.328) [-641.430] (-646.997) -- 0:00:42
342500 -- (-639.994) (-646.844) (-641.267) [-645.022] * (-643.131) (-645.422) [-642.269] (-646.488) -- 0:00:42
343000 -- [-643.228] (-643.402) (-643.331) (-646.142) * (-644.087) (-648.143) [-640.565] (-641.972) -- 0:00:42
343500 -- (-642.602) (-643.859) [-642.220] (-644.598) * (-643.087) (-644.604) [-639.728] (-641.921) -- 0:00:42
344000 -- (-643.594) (-642.460) (-640.925) [-643.785] * (-644.369) (-643.330) (-640.893) [-642.447] -- 0:00:41
344500 -- (-645.186) (-645.068) (-639.237) [-642.920] * (-643.792) (-642.943) (-641.388) [-643.563] -- 0:00:41
345000 -- [-646.649] (-642.273) (-643.308) (-648.190) * [-640.753] (-643.495) (-646.762) (-642.189) -- 0:00:41
Average standard deviation of split frequencies: 0.011832
345500 -- (-643.143) (-642.040) (-650.560) [-642.402] * (-639.867) (-642.325) [-648.805] (-646.253) -- 0:00:41
346000 -- (-642.621) (-644.480) (-641.932) [-645.007] * (-639.834) [-641.910] (-646.736) (-647.461) -- 0:00:41
346500 -- [-642.655] (-642.153) (-640.078) (-640.473) * [-642.749] (-641.972) (-640.007) (-645.389) -- 0:00:41
347000 -- (-642.771) (-643.649) [-643.613] (-641.720) * [-641.179] (-645.123) (-641.375) (-643.218) -- 0:00:41
347500 -- (-642.269) (-643.004) (-645.683) [-641.853] * [-642.315] (-645.142) (-642.415) (-640.858) -- 0:00:41
348000 -- (-643.579) (-643.024) [-647.552] (-641.768) * (-643.539) (-643.094) [-640.843] (-643.178) -- 0:00:41
348500 -- (-642.845) (-641.065) [-644.190] (-645.753) * (-640.541) [-642.487] (-643.498) (-643.647) -- 0:00:41
349000 -- (-640.407) (-645.879) [-642.666] (-647.932) * (-644.378) (-641.538) (-639.948) [-643.038] -- 0:00:41
349500 -- [-642.188] (-645.989) (-641.048) (-641.942) * (-641.905) (-642.534) [-643.550] (-645.221) -- 0:00:40
350000 -- (-642.936) (-648.580) (-641.787) [-642.137] * (-644.586) (-641.158) (-640.539) [-642.949] -- 0:00:40
Average standard deviation of split frequencies: 0.013019
350500 -- (-642.418) [-643.961] (-641.119) (-642.614) * (-645.473) (-645.468) (-642.601) [-642.018] -- 0:00:40
351000 -- [-643.234] (-642.621) (-648.258) (-644.610) * (-640.033) (-641.629) (-640.392) [-643.471] -- 0:00:40
351500 -- (-640.086) (-641.687) (-642.269) [-641.660] * [-640.885] (-639.787) (-645.327) (-642.882) -- 0:00:40
352000 -- (-642.760) (-649.923) (-641.477) [-642.988] * [-643.702] (-642.751) (-641.162) (-643.963) -- 0:00:40
352500 -- (-643.986) (-642.896) [-641.383] (-642.203) * (-644.344) [-641.316] (-641.794) (-643.443) -- 0:00:42
353000 -- (-642.077) (-645.013) [-641.486] (-642.807) * [-641.708] (-643.544) (-644.381) (-643.400) -- 0:00:42
353500 -- (-641.686) (-642.172) [-642.540] (-646.619) * [-641.950] (-642.639) (-645.460) (-643.020) -- 0:00:42
354000 -- (-642.361) (-642.193) [-641.578] (-644.383) * [-642.125] (-642.936) (-643.686) (-642.236) -- 0:00:41
354500 -- (-641.698) (-643.880) [-644.822] (-643.082) * (-643.082) [-642.013] (-641.572) (-645.711) -- 0:00:41
355000 -- [-642.349] (-645.498) (-646.536) (-643.329) * [-642.215] (-644.722) (-642.229) (-644.620) -- 0:00:41
Average standard deviation of split frequencies: 0.013242
355500 -- (-642.639) (-641.526) [-643.958] (-642.827) * (-643.173) (-642.227) (-640.947) [-642.043] -- 0:00:41
356000 -- (-643.542) (-641.427) [-641.631] (-642.457) * (-643.267) (-641.738) (-641.971) [-642.749] -- 0:00:41
356500 -- (-641.119) (-643.054) (-642.425) [-642.759] * (-641.869) (-647.231) (-642.305) [-647.035] -- 0:00:41
357000 -- (-641.424) [-644.327] (-642.017) (-642.330) * (-641.789) (-643.306) [-641.921] (-644.310) -- 0:00:41
357500 -- (-644.498) [-642.416] (-644.351) (-643.966) * (-644.582) (-643.632) [-641.224] (-643.004) -- 0:00:41
358000 -- (-641.763) (-643.010) [-642.054] (-643.928) * (-641.580) [-639.685] (-639.935) (-644.951) -- 0:00:41
358500 -- (-641.837) [-644.772] (-641.541) (-642.219) * (-644.336) [-642.201] (-643.959) (-645.132) -- 0:00:41
359000 -- [-644.152] (-642.098) (-643.533) (-644.120) * (-643.779) [-643.186] (-643.479) (-645.715) -- 0:00:41
359500 -- (-641.470) (-642.805) (-642.554) [-642.527] * (-643.215) [-643.813] (-644.450) (-645.859) -- 0:00:40
360000 -- (-647.716) (-641.770) (-645.697) [-642.577] * [-642.881] (-643.218) (-648.541) (-644.994) -- 0:00:40
Average standard deviation of split frequencies: 0.013414
360500 -- (-642.260) (-644.400) (-643.418) [-642.047] * (-641.719) (-642.981) (-643.592) [-642.864] -- 0:00:40
361000 -- (-642.558) (-645.420) [-640.012] (-644.965) * (-642.802) (-645.263) (-641.353) [-643.183] -- 0:00:40
361500 -- (-642.979) (-641.759) (-643.338) [-650.607] * [-643.245] (-641.250) (-643.648) (-642.871) -- 0:00:40
362000 -- (-641.803) [-647.846] (-640.650) (-645.779) * (-642.442) [-643.089] (-644.056) (-642.880) -- 0:00:40
362500 -- (-642.953) [-644.643] (-643.017) (-643.804) * (-643.620) (-642.951) [-643.706] (-641.778) -- 0:00:40
363000 -- (-643.502) (-643.106) (-638.941) [-643.501] * (-646.115) (-642.939) [-644.304] (-642.468) -- 0:00:40
363500 -- (-642.452) (-643.118) [-641.516] (-643.224) * (-643.030) (-641.232) [-639.748] (-643.655) -- 0:00:40
364000 -- (-641.150) (-645.737) (-641.733) [-642.459] * (-644.740) (-642.223) (-644.044) [-642.144] -- 0:00:40
364500 -- (-641.376) (-643.477) [-641.507] (-642.691) * (-644.327) [-643.134] (-646.505) (-643.103) -- 0:00:40
365000 -- (-639.617) (-642.582) [-642.764] (-641.287) * (-642.695) (-644.682) (-646.284) [-643.030] -- 0:00:40
Average standard deviation of split frequencies: 0.011863
365500 -- [-640.442] (-640.130) (-643.330) (-641.455) * (-647.072) (-645.012) (-642.117) [-642.859] -- 0:00:39
366000 -- (-652.868) [-643.365] (-647.044) (-641.755) * (-646.271) (-642.305) (-645.453) [-643.135] -- 0:00:39
366500 -- (-642.454) (-646.162) [-643.893] (-646.010) * (-641.287) [-643.801] (-644.321) (-642.945) -- 0:00:39
367000 -- (-644.632) [-642.757] (-641.304) (-642.230) * (-644.134) [-640.311] (-641.356) (-645.848) -- 0:00:39
367500 -- (-643.202) [-640.554] (-647.417) (-642.073) * (-647.547) [-643.817] (-645.222) (-641.967) -- 0:00:39
368000 -- (-643.992) (-643.403) (-645.412) [-646.269] * [-641.046] (-643.242) (-640.622) (-641.755) -- 0:00:41
368500 -- (-643.170) (-646.902) [-642.045] (-641.197) * (-643.397) (-643.067) [-641.186] (-643.687) -- 0:00:41
369000 -- [-642.812] (-642.421) (-643.862) (-640.075) * (-642.105) (-643.180) [-641.599] (-644.756) -- 0:00:41
369500 -- (-645.198) (-646.307) (-644.429) [-642.763] * [-642.348] (-643.637) (-642.408) (-643.629) -- 0:00:40
370000 -- (-645.296) [-643.190] (-640.972) (-642.637) * [-641.765] (-643.334) (-644.319) (-645.593) -- 0:00:40
Average standard deviation of split frequencies: 0.012115
370500 -- [-643.226] (-647.313) (-643.506) (-639.877) * [-643.358] (-643.779) (-643.833) (-645.423) -- 0:00:40
371000 -- (-643.302) (-645.942) [-640.708] (-642.066) * [-641.161] (-642.717) (-643.602) (-643.010) -- 0:00:40
371500 -- (-646.027) (-643.003) (-640.010) [-642.833] * (-643.376) (-642.067) [-642.095] (-645.189) -- 0:00:40
372000 -- (-644.525) [-643.182] (-641.840) (-645.867) * (-649.294) (-641.631) [-641.228] (-644.195) -- 0:00:40
372500 -- (-642.204) (-642.892) [-643.061] (-642.057) * (-641.364) (-644.055) (-641.553) [-642.051] -- 0:00:40
373000 -- (-644.475) (-643.907) [-644.796] (-645.310) * [-641.278] (-645.011) (-639.786) (-641.489) -- 0:00:40
373500 -- [-646.514] (-643.554) (-642.560) (-643.890) * (-643.456) (-646.067) [-641.428] (-642.896) -- 0:00:40
374000 -- (-646.470) [-642.948] (-642.602) (-644.436) * (-642.505) [-643.558] (-641.010) (-643.999) -- 0:00:40
374500 -- [-643.288] (-643.517) (-643.303) (-645.300) * [-641.618] (-645.806) (-643.513) (-644.935) -- 0:00:40
375000 -- (-647.657) [-643.834] (-642.219) (-645.964) * (-644.171) (-641.679) [-644.093] (-645.036) -- 0:00:40
Average standard deviation of split frequencies: 0.012603
375500 -- (-643.290) [-640.061] (-644.832) (-640.241) * (-643.067) (-644.229) (-642.906) [-643.324] -- 0:00:39
376000 -- [-641.367] (-640.902) (-641.935) (-642.686) * [-643.568] (-642.039) (-643.368) (-643.105) -- 0:00:39
376500 -- [-640.509] (-642.090) (-641.417) (-644.191) * [-643.194] (-645.206) (-643.244) (-650.453) -- 0:00:39
377000 -- (-641.752) (-641.182) (-641.988) [-644.645] * (-641.211) (-643.582) (-646.033) [-645.323] -- 0:00:39
377500 -- (-639.418) [-642.015] (-643.539) (-646.603) * (-642.997) (-641.119) [-644.522] (-643.752) -- 0:00:39
378000 -- (-641.057) (-644.157) (-640.435) [-644.992] * (-642.308) (-641.493) [-642.658] (-646.736) -- 0:00:39
378500 -- (-646.294) (-640.451) [-646.610] (-642.713) * (-641.910) [-641.540] (-643.371) (-646.046) -- 0:00:39
379000 -- (-644.191) (-643.292) (-642.008) [-643.895] * (-642.702) [-642.573] (-644.286) (-645.770) -- 0:00:39
379500 -- [-642.942] (-644.296) (-643.188) (-647.704) * (-645.632) [-643.456] (-644.781) (-644.370) -- 0:00:39
380000 -- (-642.002) [-641.243] (-643.983) (-645.454) * (-639.981) (-643.776) [-642.016] (-646.354) -- 0:00:39
Average standard deviation of split frequencies: 0.011341
380500 -- (-648.752) (-644.145) (-642.074) [-644.332] * (-642.756) (-642.354) [-641.468] (-641.796) -- 0:00:39
381000 -- [-640.917] (-642.080) (-641.743) (-642.754) * [-641.245] (-642.683) (-643.416) (-643.563) -- 0:00:38
381500 -- (-641.820) (-642.530) (-642.376) [-639.970] * [-644.769] (-653.317) (-643.428) (-644.617) -- 0:00:38
382000 -- (-645.018) [-641.543] (-643.312) (-644.908) * (-644.979) [-641.935] (-642.783) (-643.564) -- 0:00:38
382500 -- (-642.961) [-640.795] (-642.974) (-643.162) * (-641.897) [-642.697] (-642.032) (-642.981) -- 0:00:38
383000 -- (-641.367) [-645.124] (-643.696) (-643.742) * (-644.348) (-643.374) [-642.917] (-644.882) -- 0:00:38
383500 -- (-646.416) [-643.723] (-648.059) (-640.437) * [-642.998] (-641.337) (-644.015) (-643.051) -- 0:00:40
384000 -- (-646.517) (-641.521) (-643.220) [-645.643] * (-646.210) [-642.390] (-643.153) (-641.640) -- 0:00:40
384500 -- (-645.362) [-641.007] (-642.305) (-643.016) * (-642.771) [-645.625] (-641.778) (-643.651) -- 0:00:40
385000 -- (-647.656) [-639.794] (-643.840) (-641.016) * (-642.105) (-643.904) (-643.492) [-644.082] -- 0:00:39
Average standard deviation of split frequencies: 0.010670
385500 -- (-646.133) [-639.554] (-645.316) (-642.696) * (-642.201) (-642.506) (-642.789) [-643.934] -- 0:00:39
386000 -- (-640.310) (-642.247) (-643.640) [-641.490] * (-641.239) [-641.275] (-644.468) (-640.612) -- 0:00:39
386500 -- (-639.383) [-642.251] (-647.111) (-648.465) * (-643.164) [-642.291] (-642.234) (-645.214) -- 0:00:39
387000 -- (-640.139) (-642.123) (-645.256) [-641.086] * (-640.515) [-642.698] (-642.514) (-644.507) -- 0:00:39
387500 -- (-646.042) [-642.431] (-644.267) (-644.966) * [-642.290] (-644.510) (-642.397) (-646.390) -- 0:00:39
388000 -- (-646.685) [-640.256] (-643.366) (-642.846) * (-644.595) (-646.338) [-642.997] (-638.745) -- 0:00:39
388500 -- (-640.966) (-642.816) [-643.254] (-644.326) * (-643.818) [-641.926] (-640.098) (-641.347) -- 0:00:39
389000 -- (-644.096) (-641.350) [-645.017] (-647.831) * [-644.123] (-643.007) (-644.476) (-642.756) -- 0:00:39
389500 -- (-644.125) [-638.684] (-645.015) (-643.994) * [-640.871] (-644.285) (-641.634) (-645.721) -- 0:00:39
390000 -- (-644.450) (-644.497) (-643.176) [-645.248] * (-643.998) (-640.979) (-641.543) [-642.062] -- 0:00:39
Average standard deviation of split frequencies: 0.010796
390500 -- (-645.463) (-643.795) [-643.965] (-642.494) * (-642.668) (-644.256) [-640.571] (-645.830) -- 0:00:39
391000 -- [-642.621] (-642.266) (-644.183) (-640.900) * (-643.246) [-640.249] (-647.942) (-644.315) -- 0:00:38
391500 -- (-644.152) (-643.180) [-640.924] (-640.133) * (-641.375) (-641.144) (-642.896) [-643.048] -- 0:00:38
392000 -- [-639.786] (-643.363) (-640.773) (-644.284) * (-641.791) [-641.942] (-643.810) (-644.485) -- 0:00:38
392500 -- [-641.829] (-642.541) (-644.243) (-639.953) * (-643.351) [-643.513] (-648.616) (-643.406) -- 0:00:38
393000 -- [-640.317] (-643.949) (-641.946) (-642.870) * (-645.023) [-641.817] (-642.129) (-642.461) -- 0:00:38
393500 -- (-641.258) (-642.738) [-644.333] (-642.619) * [-642.486] (-643.975) (-642.724) (-645.872) -- 0:00:38
394000 -- [-642.590] (-643.646) (-644.436) (-642.696) * [-641.477] (-640.972) (-644.057) (-645.628) -- 0:00:38
394500 -- (-643.347) (-642.279) [-640.136] (-641.558) * (-642.724) (-642.696) [-645.063] (-642.749) -- 0:00:38
395000 -- (-643.518) (-643.424) (-640.986) [-646.028] * (-645.443) (-649.250) [-641.384] (-642.773) -- 0:00:38
Average standard deviation of split frequencies: 0.011340
395500 -- (-641.289) (-643.437) [-642.046] (-642.683) * (-639.960) (-647.035) [-643.499] (-647.956) -- 0:00:38
396000 -- [-642.012] (-644.132) (-641.450) (-644.115) * [-642.840] (-642.071) (-643.539) (-641.134) -- 0:00:38
396500 -- (-647.602) [-641.532] (-642.730) (-644.387) * (-643.869) (-647.677) [-640.791] (-643.852) -- 0:00:38
397000 -- [-645.227] (-639.501) (-643.604) (-640.282) * [-641.549] (-646.189) (-640.950) (-642.374) -- 0:00:37
397500 -- [-642.503] (-640.627) (-644.233) (-642.160) * (-641.251) [-641.983] (-642.843) (-645.413) -- 0:00:37
398000 -- (-640.122) [-646.992] (-643.590) (-644.666) * (-645.523) (-643.142) (-642.882) [-645.974] -- 0:00:37
398500 -- [-641.966] (-643.210) (-641.932) (-642.243) * (-645.324) (-642.013) [-641.464] (-642.321) -- 0:00:37
399000 -- (-643.385) [-643.054] (-646.320) (-640.085) * (-640.510) (-639.223) (-641.274) [-644.607] -- 0:00:37
399500 -- [-640.411] (-641.593) (-644.192) (-641.943) * (-643.793) (-643.092) (-641.230) [-643.170] -- 0:00:39
400000 -- (-644.702) (-643.971) [-645.197] (-643.211) * [-642.767] (-640.605) (-645.708) (-642.912) -- 0:00:39
Average standard deviation of split frequencies: 0.011704
400500 -- (-643.041) (-644.881) (-644.953) [-643.440] * (-643.465) (-642.537) [-641.750] (-640.152) -- 0:00:38
401000 -- [-640.740] (-642.146) (-645.570) (-642.112) * (-642.314) (-643.356) [-646.535] (-645.497) -- 0:00:38
401500 -- (-641.250) (-642.134) [-642.039] (-646.815) * (-644.570) [-641.889] (-642.110) (-643.036) -- 0:00:38
402000 -- [-641.188] (-641.681) (-644.817) (-644.914) * (-645.910) (-648.844) [-645.196] (-642.175) -- 0:00:38
402500 -- [-643.708] (-641.957) (-643.642) (-645.557) * (-645.065) [-642.691] (-644.491) (-644.091) -- 0:00:38
403000 -- (-644.792) (-642.144) (-640.825) [-642.025] * (-644.250) (-642.588) (-643.650) [-642.132] -- 0:00:38
403500 -- [-641.875] (-642.068) (-642.197) (-642.869) * (-646.492) (-641.508) [-640.659] (-644.318) -- 0:00:38
404000 -- (-643.000) (-643.969) (-649.950) [-642.176] * (-642.934) (-642.074) (-640.508) [-644.075] -- 0:00:38
404500 -- (-644.112) (-642.662) [-642.348] (-644.859) * [-643.287] (-642.185) (-642.126) (-645.193) -- 0:00:38
405000 -- (-642.925) (-642.511) (-642.926) [-641.905] * (-642.038) [-642.010] (-642.057) (-641.705) -- 0:00:38
Average standard deviation of split frequencies: 0.012161
405500 -- (-642.159) [-639.916] (-643.665) (-641.842) * (-642.071) (-642.321) [-640.749] (-644.167) -- 0:00:38
406000 -- (-642.578) [-643.462] (-646.112) (-642.208) * [-643.515] (-641.975) (-640.119) (-642.137) -- 0:00:38
406500 -- (-642.456) [-643.125] (-643.282) (-641.615) * (-644.182) [-640.125] (-640.737) (-645.983) -- 0:00:37
407000 -- (-646.089) (-641.929) (-642.310) [-641.537] * [-641.799] (-643.217) (-641.269) (-642.298) -- 0:00:37
407500 -- (-638.993) (-646.241) (-642.503) [-641.898] * (-642.687) (-642.245) (-641.364) [-641.606] -- 0:00:37
408000 -- [-641.905] (-642.366) (-644.646) (-643.446) * (-640.043) (-645.905) [-641.481] (-643.303) -- 0:00:37
408500 -- (-638.774) (-642.397) [-644.277] (-646.173) * (-642.259) (-641.977) (-643.003) [-640.103] -- 0:00:37
409000 -- [-640.245] (-642.354) (-650.092) (-650.831) * (-643.943) [-642.288] (-641.770) (-644.127) -- 0:00:37
409500 -- (-644.778) (-641.918) [-641.858] (-642.557) * [-641.601] (-645.368) (-644.049) (-641.311) -- 0:00:37
410000 -- (-641.070) [-642.550] (-641.646) (-644.972) * (-643.722) (-645.175) [-641.377] (-641.174) -- 0:00:37
Average standard deviation of split frequencies: 0.012204
410500 -- [-641.393] (-644.433) (-644.161) (-643.052) * (-641.909) [-642.561] (-640.605) (-642.663) -- 0:00:37
411000 -- (-638.394) (-644.950) (-645.830) [-642.798] * (-642.612) (-640.651) [-643.619] (-642.784) -- 0:00:37
411500 -- (-640.764) (-643.415) [-644.661] (-641.334) * [-643.391] (-641.687) (-641.489) (-641.945) -- 0:00:37
412000 -- (-648.211) [-641.487] (-648.523) (-643.844) * [-642.017] (-642.681) (-642.557) (-643.355) -- 0:00:37
412500 -- (-643.113) [-641.566] (-644.076) (-645.480) * [-638.745] (-647.238) (-641.721) (-643.246) -- 0:00:37
413000 -- (-643.178) (-644.230) [-643.509] (-643.776) * (-645.704) [-650.188] (-643.251) (-644.700) -- 0:00:36
413500 -- (-644.208) (-643.488) [-646.081] (-649.077) * (-643.242) (-648.665) (-644.506) [-640.294] -- 0:00:36
414000 -- (-643.635) [-641.512] (-645.014) (-642.154) * [-644.120] (-641.684) (-641.272) (-642.169) -- 0:00:36
414500 -- (-642.538) [-641.418] (-645.334) (-642.987) * (-645.603) (-644.013) (-647.534) [-639.512] -- 0:00:36
415000 -- (-642.509) (-641.423) (-646.259) [-642.122] * [-644.276] (-642.467) (-643.810) (-641.063) -- 0:00:38
Average standard deviation of split frequencies: 0.012584
415500 -- (-644.136) (-642.587) [-645.932] (-644.087) * (-643.058) (-647.571) (-640.913) [-641.139] -- 0:00:37
416000 -- (-642.630) [-642.108] (-642.478) (-643.192) * [-640.801] (-643.495) (-641.994) (-642.288) -- 0:00:37
416500 -- (-643.465) (-643.646) (-645.326) [-647.173] * (-642.520) [-641.455] (-642.789) (-642.967) -- 0:00:37
417000 -- [-643.975] (-641.991) (-642.969) (-643.012) * (-642.404) [-643.406] (-644.227) (-642.124) -- 0:00:37
417500 -- (-642.828) (-643.101) (-639.780) [-643.943] * (-643.414) (-641.531) (-642.240) [-640.232] -- 0:00:37
418000 -- [-641.478] (-645.387) (-642.439) (-649.871) * (-641.551) [-641.125] (-641.909) (-641.442) -- 0:00:37
418500 -- [-641.943] (-640.782) (-642.301) (-643.712) * [-638.828] (-642.914) (-640.101) (-643.596) -- 0:00:37
419000 -- (-642.679) (-643.983) [-641.655] (-642.099) * (-647.403) (-642.950) [-641.534] (-639.392) -- 0:00:37
419500 -- [-642.289] (-641.736) (-643.767) (-646.425) * (-648.061) (-650.112) [-642.663] (-641.862) -- 0:00:37
420000 -- (-644.941) (-645.640) (-643.222) [-644.366] * (-645.071) (-643.019) [-643.449] (-642.199) -- 0:00:37
Average standard deviation of split frequencies: 0.013034
420500 -- (-642.709) (-642.957) (-646.721) [-642.364] * [-641.159] (-642.237) (-642.584) (-647.272) -- 0:00:37
421000 -- (-644.432) [-642.705] (-642.985) (-643.222) * (-644.323) (-643.538) (-641.319) [-642.033] -- 0:00:37
421500 -- (-641.984) (-643.060) [-642.541] (-644.849) * (-644.264) (-642.175) [-641.910] (-642.248) -- 0:00:37
422000 -- (-642.216) (-643.256) [-643.097] (-642.215) * (-640.503) (-642.661) (-641.554) [-642.179] -- 0:00:36
422500 -- [-643.216] (-642.729) (-643.147) (-644.342) * [-643.459] (-641.135) (-641.811) (-642.180) -- 0:00:36
423000 -- [-643.286] (-641.067) (-643.405) (-643.017) * [-643.397] (-643.049) (-641.611) (-641.298) -- 0:00:36
423500 -- [-642.403] (-639.971) (-642.473) (-642.134) * (-643.681) (-643.196) [-642.405] (-642.155) -- 0:00:36
424000 -- (-644.300) [-642.234] (-642.717) (-642.059) * (-643.685) (-641.823) [-640.990] (-643.746) -- 0:00:36
424500 -- [-642.144] (-643.517) (-641.481) (-641.779) * (-646.509) [-642.858] (-641.990) (-642.282) -- 0:00:36
425000 -- [-642.933] (-643.264) (-644.040) (-643.661) * [-642.377] (-641.706) (-642.577) (-641.623) -- 0:00:36
Average standard deviation of split frequencies: 0.013454
425500 -- [-645.278] (-642.478) (-645.796) (-642.538) * (-640.853) (-642.078) [-642.079] (-640.030) -- 0:00:36
426000 -- (-643.939) (-647.459) (-643.952) [-641.250] * (-643.542) (-642.486) [-646.096] (-641.927) -- 0:00:36
426500 -- (-642.548) (-642.879) (-647.133) [-642.681] * (-643.866) (-643.343) [-643.850] (-645.626) -- 0:00:36
427000 -- (-642.714) [-644.759] (-643.059) (-648.276) * (-643.380) [-646.710] (-642.056) (-645.414) -- 0:00:36
427500 -- (-643.601) (-642.580) (-641.962) [-642.198] * (-642.330) (-642.868) (-641.640) [-643.805] -- 0:00:36
428000 -- (-645.220) (-641.433) (-642.617) [-642.513] * (-641.754) (-644.914) (-642.931) [-641.245] -- 0:00:36
428500 -- [-642.905] (-641.832) (-643.376) (-643.838) * (-645.254) [-645.696] (-641.537) (-641.558) -- 0:00:36
429000 -- (-641.038) (-644.139) (-643.767) [-644.004] * (-642.263) (-644.153) [-643.782] (-642.030) -- 0:00:35
429500 -- (-641.791) (-639.867) (-645.408) [-641.818] * (-641.240) (-641.100) [-643.893] (-643.922) -- 0:00:35
430000 -- (-645.846) (-643.473) (-643.585) [-648.645] * (-648.536) (-642.322) (-644.065) [-641.865] -- 0:00:35
Average standard deviation of split frequencies: 0.013366
430500 -- [-641.793] (-644.166) (-643.895) (-642.511) * [-642.069] (-641.962) (-644.032) (-644.391) -- 0:00:35
431000 -- (-642.965) (-645.836) (-642.865) [-641.526] * (-644.510) (-641.858) (-643.746) [-642.723] -- 0:00:36
431500 -- (-641.212) (-644.070) [-642.169] (-641.342) * (-642.490) (-644.238) (-642.489) [-643.597] -- 0:00:36
432000 -- (-643.417) [-643.232] (-642.345) (-640.816) * [-648.239] (-645.461) (-643.677) (-640.877) -- 0:00:36
432500 -- (-640.956) (-642.178) (-644.941) [-641.721] * (-641.755) (-643.923) (-642.903) [-646.133] -- 0:00:36
433000 -- (-645.799) (-643.321) [-641.735] (-642.925) * (-641.690) (-645.383) (-644.877) [-644.036] -- 0:00:36
433500 -- [-643.777] (-643.454) (-639.188) (-641.925) * [-641.909] (-645.698) (-643.188) (-644.401) -- 0:00:36
434000 -- (-641.959) (-644.334) (-641.798) [-641.218] * [-643.167] (-646.057) (-642.859) (-642.741) -- 0:00:36
434500 -- (-642.503) [-648.440] (-641.331) (-642.166) * (-644.135) (-645.175) [-643.389] (-643.875) -- 0:00:36
435000 -- [-643.047] (-645.617) (-642.030) (-639.882) * (-642.168) (-643.842) (-647.115) [-643.071] -- 0:00:36
Average standard deviation of split frequencies: 0.013635
435500 -- [-644.497] (-641.299) (-639.946) (-644.336) * [-641.586] (-646.311) (-644.627) (-645.593) -- 0:00:36
436000 -- [-641.563] (-642.189) (-640.563) (-644.649) * (-641.777) (-644.802) (-647.522) [-643.696] -- 0:00:36
436500 -- (-640.892) [-645.354] (-642.716) (-641.924) * [-641.330] (-642.589) (-645.193) (-649.137) -- 0:00:36
437000 -- (-644.548) [-641.839] (-644.215) (-643.075) * (-647.209) (-642.503) [-642.344] (-649.327) -- 0:00:36
437500 -- (-642.683) (-641.552) (-643.435) [-644.470] * (-647.162) [-642.835] (-642.093) (-657.887) -- 0:00:36
438000 -- (-645.681) (-645.082) [-642.164] (-641.421) * [-643.155] (-643.696) (-641.470) (-643.021) -- 0:00:35
438500 -- (-640.715) (-642.352) (-643.546) [-641.496] * (-640.823) (-643.900) [-641.648] (-644.497) -- 0:00:35
439000 -- (-642.615) (-643.492) [-641.470] (-642.679) * (-642.673) (-644.427) [-643.005] (-641.638) -- 0:00:35
439500 -- (-643.913) (-642.049) (-645.085) [-642.265] * (-643.310) [-644.590] (-642.535) (-646.856) -- 0:00:35
440000 -- (-644.232) (-641.747) (-642.690) [-643.697] * (-641.122) (-644.601) [-644.415] (-643.724) -- 0:00:35
Average standard deviation of split frequencies: 0.013134
440500 -- [-641.220] (-643.031) (-643.009) (-642.787) * (-647.438) (-642.364) [-643.102] (-642.298) -- 0:00:35
441000 -- (-644.742) (-643.435) (-645.066) [-643.986] * (-646.472) (-643.372) (-643.173) [-642.679] -- 0:00:35
441500 -- (-641.369) (-642.517) [-641.715] (-642.696) * [-644.374] (-646.114) (-642.423) (-641.167) -- 0:00:35
442000 -- (-641.483) (-643.089) (-641.531) [-641.022] * (-644.059) (-645.035) (-645.523) [-642.448] -- 0:00:35
442500 -- (-643.913) (-641.888) [-643.659] (-641.808) * [-644.471] (-646.295) (-642.621) (-644.180) -- 0:00:35
443000 -- (-641.680) [-642.668] (-643.235) (-643.480) * (-645.443) (-644.478) [-651.019] (-643.186) -- 0:00:35
443500 -- (-643.541) (-644.569) (-642.829) [-641.592] * (-644.579) [-648.530] (-643.113) (-641.026) -- 0:00:35
444000 -- (-643.339) [-641.012] (-644.590) (-642.901) * (-641.906) (-644.744) (-642.275) [-641.598] -- 0:00:35
444500 -- [-645.125] (-643.168) (-643.858) (-642.753) * [-641.702] (-647.249) (-642.423) (-641.862) -- 0:00:34
445000 -- [-643.182] (-642.530) (-641.645) (-643.925) * (-643.452) (-645.140) (-644.040) [-644.169] -- 0:00:34
Average standard deviation of split frequencies: 0.013153
445500 -- (-638.620) [-643.599] (-641.708) (-643.541) * (-643.091) [-644.187] (-643.067) (-642.694) -- 0:00:34
446000 -- (-641.235) [-641.829] (-642.219) (-644.947) * (-643.268) (-643.048) [-642.360] (-643.756) -- 0:00:34
446500 -- (-640.621) [-642.949] (-641.838) (-647.062) * [-643.138] (-643.964) (-643.946) (-644.429) -- 0:00:35
447000 -- (-641.094) (-644.916) [-645.040] (-639.855) * (-643.780) [-641.345] (-643.646) (-644.039) -- 0:00:35
447500 -- (-641.939) (-643.039) [-642.381] (-641.447) * [-642.609] (-643.087) (-643.506) (-643.750) -- 0:00:35
448000 -- (-642.591) (-645.209) [-641.357] (-642.886) * (-643.798) [-641.620] (-647.642) (-643.459) -- 0:00:35
448500 -- (-645.986) [-642.113] (-643.849) (-642.654) * [-643.526] (-644.692) (-646.013) (-643.641) -- 0:00:35
449000 -- (-642.951) (-642.611) [-645.727] (-647.825) * (-643.907) (-647.322) [-642.245] (-650.053) -- 0:00:35
449500 -- (-644.799) (-643.574) [-647.257] (-642.340) * (-642.233) (-643.120) [-644.593] (-643.744) -- 0:00:35
450000 -- (-642.510) [-644.367] (-647.852) (-645.260) * [-645.821] (-643.245) (-644.021) (-644.817) -- 0:00:35
Average standard deviation of split frequencies: 0.013656
450500 -- (-642.328) (-644.044) [-641.796] (-647.770) * (-644.042) (-642.248) [-641.589] (-642.021) -- 0:00:35
451000 -- (-644.175) (-642.765) (-643.266) [-641.894] * (-645.687) (-644.931) [-641.073] (-641.580) -- 0:00:35
451500 -- [-642.082] (-640.302) (-648.359) (-641.967) * (-647.893) (-643.019) [-644.533] (-642.535) -- 0:00:35
452000 -- (-643.004) [-641.987] (-647.688) (-641.879) * [-641.997] (-640.771) (-642.750) (-644.620) -- 0:00:35
452500 -- [-642.007] (-642.798) (-644.477) (-646.326) * (-642.256) (-644.338) (-639.960) [-642.663] -- 0:00:35
453000 -- (-640.217) (-642.780) [-646.161] (-641.085) * (-642.594) (-645.523) [-641.359] (-643.096) -- 0:00:35
453500 -- [-641.069] (-641.937) (-639.997) (-641.721) * [-641.500] (-643.995) (-640.128) (-642.995) -- 0:00:34
454000 -- (-643.624) [-644.150] (-641.319) (-642.952) * [-646.049] (-643.573) (-641.614) (-647.282) -- 0:00:34
454500 -- (-644.698) (-642.920) [-643.857] (-648.973) * [-642.472] (-644.173) (-642.057) (-642.674) -- 0:00:34
455000 -- (-638.782) [-642.036] (-641.514) (-643.928) * (-643.060) (-643.348) (-643.068) [-643.428] -- 0:00:34
Average standard deviation of split frequencies: 0.014301
455500 -- [-644.968] (-643.092) (-642.322) (-643.273) * (-647.359) [-642.682] (-640.042) (-644.165) -- 0:00:34
456000 -- (-642.963) [-642.950] (-643.348) (-644.057) * (-644.406) [-640.859] (-644.662) (-644.476) -- 0:00:34
456500 -- (-641.247) [-643.125] (-642.582) (-642.385) * (-644.373) (-641.192) [-644.027] (-641.795) -- 0:00:34
457000 -- (-641.415) [-642.619] (-642.084) (-642.983) * (-643.085) [-642.565] (-639.871) (-646.278) -- 0:00:34
457500 -- (-641.280) (-642.157) (-644.126) [-643.319] * (-643.591) [-642.803] (-641.096) (-643.807) -- 0:00:34
458000 -- [-642.979] (-643.715) (-642.947) (-642.568) * [-641.961] (-641.413) (-640.906) (-644.130) -- 0:00:34
458500 -- (-642.524) (-644.750) [-642.605] (-641.665) * (-642.244) (-642.506) [-640.598] (-642.509) -- 0:00:34
459000 -- (-641.849) (-641.571) [-643.373] (-645.902) * [-641.965] (-641.449) (-638.916) (-642.314) -- 0:00:34
459500 -- (-642.226) (-641.462) (-642.720) [-642.281] * (-641.734) [-642.378] (-641.383) (-644.099) -- 0:00:34
460000 -- [-643.489] (-641.042) (-644.137) (-643.314) * [-644.439] (-642.707) (-644.814) (-642.156) -- 0:00:34
Average standard deviation of split frequencies: 0.013758
460500 -- (-645.411) (-644.466) [-643.106] (-645.752) * (-646.000) (-641.166) (-641.991) [-644.520] -- 0:00:33
461000 -- (-643.290) [-642.518] (-642.682) (-643.616) * (-644.544) (-642.835) (-640.667) [-640.793] -- 0:00:33
461500 -- (-640.803) (-643.016) (-644.048) [-641.363] * (-645.303) [-639.841] (-641.923) (-644.341) -- 0:00:33
462000 -- (-646.404) (-641.305) (-642.526) [-642.124] * (-643.824) (-642.777) [-640.400] (-643.040) -- 0:00:33
462500 -- [-642.852] (-648.068) (-644.455) (-644.543) * [-641.209] (-643.757) (-643.195) (-643.469) -- 0:00:34
463000 -- (-641.601) [-640.382] (-645.980) (-641.938) * (-643.474) (-648.766) [-641.819] (-645.287) -- 0:00:34
463500 -- (-642.239) [-643.928] (-646.506) (-643.873) * (-642.843) (-642.805) [-641.940] (-645.315) -- 0:00:34
464000 -- (-642.025) (-641.342) (-645.032) [-641.405] * (-644.058) (-643.141) (-643.352) [-642.949] -- 0:00:34
464500 -- [-642.479] (-639.503) (-642.305) (-642.005) * [-646.342] (-643.338) (-642.714) (-643.238) -- 0:00:34
465000 -- (-642.197) (-641.270) (-643.700) [-643.255] * [-643.806] (-642.849) (-643.691) (-646.310) -- 0:00:34
Average standard deviation of split frequencies: 0.013376
465500 -- (-642.777) (-645.276) (-642.528) [-642.935] * [-641.594] (-643.905) (-643.316) (-641.704) -- 0:00:34
466000 -- (-641.471) (-642.477) (-642.833) [-641.257] * (-642.181) (-643.702) [-642.471] (-641.466) -- 0:00:34
466500 -- (-640.241) (-643.962) (-647.248) [-642.489] * (-642.829) [-640.013] (-645.747) (-643.116) -- 0:00:34
467000 -- (-649.410) (-643.048) (-641.940) [-647.898] * [-642.109] (-643.841) (-642.025) (-643.550) -- 0:00:34
467500 -- (-642.030) (-642.021) (-643.699) [-646.423] * (-642.247) (-642.066) [-639.275] (-644.475) -- 0:00:34
468000 -- (-639.591) (-645.779) [-644.098] (-642.078) * (-641.079) (-643.423) [-644.024] (-645.177) -- 0:00:34
468500 -- [-642.070] (-642.951) (-643.925) (-646.845) * (-642.518) [-649.290] (-643.147) (-643.384) -- 0:00:34
469000 -- (-644.342) [-643.142] (-642.468) (-644.746) * (-642.521) (-644.213) (-642.253) [-641.288] -- 0:00:33
469500 -- (-642.190) (-644.662) (-641.342) [-645.415] * (-641.455) (-642.678) (-643.359) [-641.137] -- 0:00:33
470000 -- [-642.404] (-645.525) (-644.105) (-653.120) * [-640.464] (-642.214) (-642.435) (-647.035) -- 0:00:33
Average standard deviation of split frequencies: 0.013073
470500 -- [-644.280] (-643.063) (-645.117) (-645.801) * (-642.227) [-646.801] (-639.941) (-643.814) -- 0:00:33
471000 -- [-643.061] (-642.620) (-643.212) (-641.453) * (-642.887) (-646.195) (-640.866) [-641.999] -- 0:00:33
471500 -- (-643.760) (-643.338) (-647.766) [-642.935] * (-644.366) (-642.741) (-642.818) [-644.618] -- 0:00:33
472000 -- [-641.290] (-644.616) (-642.873) (-641.087) * (-645.978) (-642.143) [-640.603] (-646.037) -- 0:00:33
472500 -- [-642.886] (-644.463) (-643.436) (-644.276) * (-641.256) (-644.367) [-642.185] (-644.095) -- 0:00:33
473000 -- (-646.102) (-643.965) (-642.258) [-642.512] * [-638.432] (-640.112) (-640.812) (-645.229) -- 0:00:33
473500 -- [-642.702] (-641.787) (-647.423) (-644.161) * [-642.488] (-643.272) (-642.921) (-643.762) -- 0:00:33
474000 -- (-642.448) [-643.087] (-642.580) (-647.746) * (-643.902) [-642.181] (-641.951) (-646.937) -- 0:00:33
474500 -- [-641.578] (-642.379) (-641.721) (-642.028) * (-643.482) [-642.733] (-642.033) (-646.383) -- 0:00:33
475000 -- (-641.795) (-642.207) [-641.531] (-649.954) * (-642.269) [-644.485] (-645.661) (-642.421) -- 0:00:33
Average standard deviation of split frequencies: 0.013480
475500 -- (-642.196) (-641.319) (-641.641) [-646.595] * [-641.886] (-642.398) (-646.294) (-642.726) -- 0:00:33
476000 -- [-640.677] (-642.063) (-642.691) (-641.869) * [-644.054] (-643.777) (-643.627) (-642.257) -- 0:00:33
476500 -- (-642.652) (-642.743) (-643.915) [-643.209] * (-641.506) (-643.042) (-641.606) [-642.105] -- 0:00:32
477000 -- (-642.746) [-645.091] (-643.289) (-644.512) * (-640.326) (-643.530) (-649.154) [-643.875] -- 0:00:32
477500 -- (-642.070) (-638.953) (-642.774) [-644.085] * [-643.888] (-644.865) (-642.895) (-642.168) -- 0:00:32
478000 -- (-642.715) [-641.804] (-643.589) (-640.437) * (-640.536) (-644.374) [-643.069] (-644.033) -- 0:00:33
478500 -- [-642.071] (-641.883) (-644.160) (-641.263) * [-641.418] (-644.392) (-643.228) (-642.390) -- 0:00:33
479000 -- (-642.370) (-642.467) [-641.857] (-643.735) * (-641.933) (-643.968) [-641.639] (-646.772) -- 0:00:33
479500 -- (-641.847) [-643.319] (-647.594) (-641.659) * (-644.674) (-642.464) [-640.603] (-644.526) -- 0:00:33
480000 -- [-641.564] (-642.449) (-648.136) (-641.065) * (-644.016) (-643.557) (-643.502) [-641.794] -- 0:00:33
Average standard deviation of split frequencies: 0.014057
480500 -- [-641.240] (-641.861) (-644.106) (-642.670) * (-648.400) (-645.818) [-641.177] (-643.228) -- 0:00:33
481000 -- (-645.455) (-645.632) [-645.292] (-648.519) * (-641.683) (-642.246) (-645.132) [-641.007] -- 0:00:33
481500 -- [-642.262] (-644.871) (-642.461) (-647.051) * [-640.356] (-645.749) (-644.033) (-643.709) -- 0:00:33
482000 -- [-639.606] (-644.114) (-641.749) (-638.983) * [-642.601] (-646.971) (-643.000) (-642.662) -- 0:00:33
482500 -- (-641.398) (-642.285) (-642.188) [-642.539] * [-641.622] (-643.580) (-646.097) (-642.904) -- 0:00:33
483000 -- [-642.134] (-642.878) (-642.238) (-644.731) * [-643.120] (-643.684) (-642.134) (-647.505) -- 0:00:33
483500 -- (-642.094) (-641.804) (-645.339) [-643.890] * (-643.847) [-643.359] (-641.396) (-644.352) -- 0:00:33
484000 -- (-642.662) (-643.755) (-641.824) [-640.512] * (-642.987) [-643.486] (-641.524) (-643.718) -- 0:00:33
484500 -- (-642.591) [-641.689] (-642.158) (-644.311) * (-642.380) (-642.871) [-643.137] (-643.045) -- 0:00:32
485000 -- (-644.487) (-641.281) (-642.872) [-644.467] * (-645.090) [-642.712] (-642.059) (-642.418) -- 0:00:32
Average standard deviation of split frequencies: 0.013741
485500 -- (-642.005) (-643.276) (-642.641) [-647.038] * (-640.447) [-642.227] (-641.607) (-642.064) -- 0:00:32
486000 -- (-642.033) [-643.268] (-645.881) (-643.073) * (-642.836) (-644.545) [-644.087] (-643.681) -- 0:00:32
486500 -- (-642.312) (-646.399) [-640.077] (-645.200) * (-642.542) (-643.378) (-643.356) [-642.019] -- 0:00:32
487000 -- (-641.764) (-639.795) [-646.639] (-647.994) * [-641.888] (-644.045) (-643.713) (-642.832) -- 0:00:32
487500 -- (-644.151) (-644.250) (-644.304) [-648.737] * (-640.292) (-646.202) (-644.905) [-640.770] -- 0:00:32
488000 -- [-642.052] (-643.861) (-641.643) (-647.684) * (-641.718) (-647.845) [-643.334] (-645.357) -- 0:00:32
488500 -- (-643.092) (-642.870) (-641.063) [-644.371] * (-644.415) (-642.717) (-646.295) [-644.190] -- 0:00:32
489000 -- (-642.050) (-642.187) [-642.421] (-642.362) * (-645.642) [-641.713] (-646.386) (-648.151) -- 0:00:32
489500 -- (-641.862) [-642.791] (-645.724) (-645.730) * (-642.943) (-644.052) [-642.705] (-645.025) -- 0:00:32
490000 -- (-641.596) [-641.561] (-641.693) (-644.396) * (-643.186) (-641.685) [-642.673] (-642.763) -- 0:00:32
Average standard deviation of split frequencies: 0.013290
490500 -- (-642.220) (-640.304) (-642.508) [-641.946] * [-641.253] (-639.190) (-645.437) (-641.685) -- 0:00:32
491000 -- (-642.514) (-642.528) [-642.816] (-644.241) * (-642.962) (-642.162) (-642.823) [-643.628] -- 0:00:32
491500 -- (-644.355) (-644.280) [-641.003] (-644.635) * (-641.986) [-645.248] (-644.420) (-642.995) -- 0:00:32
492000 -- (-643.964) [-642.121] (-640.502) (-643.253) * (-645.092) (-640.490) (-644.537) [-642.683] -- 0:00:32
492500 -- (-645.188) (-646.073) (-641.883) [-644.503] * [-644.064] (-643.396) (-645.420) (-643.137) -- 0:00:31
493000 -- [-643.530] (-642.977) (-643.821) (-643.250) * (-645.399) [-642.177] (-645.659) (-641.941) -- 0:00:32
493500 -- [-643.164] (-642.820) (-644.580) (-643.876) * (-642.537) [-641.474] (-645.911) (-643.021) -- 0:00:32
494000 -- [-643.912] (-642.146) (-641.545) (-643.975) * (-643.488) (-644.557) [-644.180] (-646.479) -- 0:00:32
494500 -- (-646.820) [-641.478] (-642.949) (-643.662) * (-639.807) (-640.496) (-644.121) [-644.841] -- 0:00:32
495000 -- (-643.824) (-642.921) [-641.781] (-641.248) * [-643.346] (-643.663) (-644.152) (-641.601) -- 0:00:32
Average standard deviation of split frequencies: 0.013623
495500 -- (-642.992) [-643.107] (-643.555) (-643.245) * (-643.246) (-644.971) (-642.035) [-643.192] -- 0:00:32
496000 -- (-642.371) [-640.509] (-643.077) (-646.590) * (-644.350) (-642.595) [-646.302] (-641.766) -- 0:00:32
496500 -- (-643.267) (-644.305) [-643.389] (-643.607) * [-640.427] (-644.000) (-642.386) (-642.470) -- 0:00:32
497000 -- [-641.963] (-642.242) (-640.050) (-641.779) * [-642.610] (-644.779) (-642.999) (-643.336) -- 0:00:32
497500 -- [-640.699] (-645.889) (-640.519) (-642.132) * (-642.850) (-645.972) [-642.537] (-641.815) -- 0:00:32
498000 -- (-640.633) (-642.882) [-644.601] (-645.174) * [-642.936] (-641.891) (-644.994) (-642.404) -- 0:00:32
498500 -- [-641.651] (-642.472) (-648.988) (-644.685) * (-643.940) (-643.868) (-641.614) [-642.212] -- 0:00:32
499000 -- (-639.844) (-644.913) [-641.746] (-644.065) * (-644.544) [-644.644] (-642.700) (-643.629) -- 0:00:32
499500 -- (-641.797) (-648.966) [-639.723] (-641.344) * (-644.327) (-644.523) [-642.883] (-642.873) -- 0:00:32
500000 -- [-641.895] (-646.002) (-644.522) (-643.244) * (-644.271) (-642.040) (-644.074) [-640.650] -- 0:00:32
Average standard deviation of split frequencies: 0.013234
500500 -- [-641.780] (-644.610) (-645.052) (-644.325) * [-642.315] (-641.117) (-641.505) (-645.475) -- 0:00:31
501000 -- (-643.155) [-639.326] (-648.547) (-641.640) * (-641.849) [-643.843] (-641.403) (-643.967) -- 0:00:31
501500 -- (-643.245) (-642.510) (-642.073) [-642.208] * (-642.496) [-641.469] (-642.112) (-642.521) -- 0:00:31
502000 -- (-642.678) [-643.633] (-643.850) (-643.186) * (-641.644) (-648.369) [-641.896] (-643.693) -- 0:00:31
502500 -- (-641.489) (-644.966) (-643.742) [-643.170] * (-641.945) (-641.723) [-642.472] (-642.480) -- 0:00:31
503000 -- (-645.154) [-643.789] (-643.196) (-644.423) * (-642.175) (-641.474) [-643.462] (-642.418) -- 0:00:31
503500 -- (-644.654) (-643.407) (-644.873) [-642.702] * (-643.692) (-642.135) [-643.589] (-649.289) -- 0:00:31
504000 -- (-647.949) [-642.573] (-643.933) (-646.555) * (-645.316) (-643.805) [-643.753] (-641.859) -- 0:00:31
504500 -- (-647.679) (-643.562) [-644.451] (-643.663) * (-642.295) (-644.000) [-641.519] (-642.856) -- 0:00:31
505000 -- (-640.320) (-643.072) (-647.316) [-642.074] * (-640.597) [-642.863] (-642.438) (-642.795) -- 0:00:31
Average standard deviation of split frequencies: 0.012784
505500 -- (-642.879) [-641.388] (-644.042) (-643.923) * (-646.017) (-643.003) (-642.487) [-641.747] -- 0:00:31
506000 -- [-642.149] (-645.190) (-643.062) (-641.786) * (-645.527) (-642.962) [-645.960] (-643.695) -- 0:00:31
506500 -- (-643.935) (-646.449) [-643.999] (-641.515) * (-644.891) [-640.733] (-643.190) (-643.307) -- 0:00:31
507000 -- (-644.544) [-641.960] (-642.465) (-644.741) * (-645.338) [-640.325] (-642.142) (-642.801) -- 0:00:31
507500 -- [-643.888] (-642.431) (-643.339) (-644.082) * (-642.119) (-639.305) (-642.996) [-642.708] -- 0:00:31
508000 -- (-647.208) [-645.288] (-646.574) (-642.792) * (-643.539) (-641.307) (-641.871) [-640.998] -- 0:00:30
508500 -- (-646.473) [-642.077] (-643.982) (-645.832) * (-643.051) (-643.076) [-642.527] (-641.355) -- 0:00:31
509000 -- (-644.266) (-641.269) [-647.773] (-640.609) * (-641.613) (-641.831) (-644.682) [-644.548] -- 0:00:31
509500 -- (-646.749) [-645.811] (-643.376) (-647.044) * (-642.205) (-641.981) (-643.101) [-643.488] -- 0:00:31
510000 -- (-644.039) (-642.988) (-641.848) [-645.639] * (-641.454) [-642.179] (-641.760) (-644.187) -- 0:00:31
Average standard deviation of split frequencies: 0.012462
510500 -- [-642.277] (-645.715) (-644.767) (-643.486) * (-642.084) [-640.909] (-642.419) (-646.512) -- 0:00:31
511000 -- (-643.490) (-642.500) (-644.807) [-643.361] * (-641.392) (-639.561) [-641.778] (-640.928) -- 0:00:31
511500 -- [-643.270] (-643.359) (-643.344) (-645.518) * (-648.748) (-644.299) [-642.395] (-645.149) -- 0:00:31
512000 -- (-641.613) (-642.105) (-645.349) [-638.936] * [-641.579] (-641.970) (-642.994) (-643.259) -- 0:00:31
512500 -- (-644.080) [-639.656] (-643.994) (-640.823) * (-648.360) (-643.308) [-641.413] (-643.382) -- 0:00:31
513000 -- [-643.267] (-643.316) (-642.045) (-640.220) * (-641.712) [-642.930] (-640.738) (-641.712) -- 0:00:31
513500 -- [-642.431] (-644.188) (-643.004) (-639.456) * (-643.528) (-643.015) (-645.861) [-641.979] -- 0:00:31
514000 -- [-645.674] (-642.690) (-642.169) (-640.665) * (-643.573) [-643.561] (-643.121) (-644.755) -- 0:00:31
514500 -- (-639.489) (-647.203) [-643.574] (-640.350) * (-643.068) [-640.487] (-641.600) (-644.487) -- 0:00:31
515000 -- (-641.604) (-643.405) (-648.117) [-639.464] * (-644.305) [-641.547] (-644.168) (-640.789) -- 0:00:31
Average standard deviation of split frequencies: 0.012079
515500 -- (-644.800) (-643.476) [-641.496] (-643.782) * [-644.350] (-643.664) (-642.767) (-642.869) -- 0:00:31
516000 -- (-644.121) (-643.146) (-643.479) [-640.827] * (-642.961) (-639.874) (-641.804) [-641.713] -- 0:00:30
516500 -- [-643.543] (-642.509) (-644.086) (-642.947) * [-642.534] (-645.707) (-643.440) (-640.133) -- 0:00:30
517000 -- (-643.371) (-644.511) [-642.009] (-645.222) * [-640.595] (-643.257) (-642.659) (-641.751) -- 0:00:30
517500 -- (-642.746) (-642.784) [-644.211] (-645.087) * (-643.609) [-641.611] (-648.814) (-643.765) -- 0:00:30
518000 -- [-643.411] (-641.226) (-642.485) (-643.177) * [-644.046] (-642.470) (-642.306) (-646.734) -- 0:00:30
518500 -- (-640.373) (-643.173) [-643.415] (-642.324) * [-639.090] (-642.025) (-642.834) (-640.614) -- 0:00:30
519000 -- (-642.218) (-649.343) (-642.855) [-639.100] * (-643.347) (-640.862) (-646.804) [-641.138] -- 0:00:30
519500 -- (-642.259) (-646.134) (-642.173) [-643.160] * (-642.425) [-644.045] (-645.610) (-642.769) -- 0:00:30
520000 -- [-645.899] (-640.573) (-642.307) (-644.154) * (-642.379) (-647.534) [-641.796] (-640.839) -- 0:00:30
Average standard deviation of split frequencies: 0.012474
520500 -- (-644.679) (-641.172) [-642.144] (-641.195) * [-641.802] (-642.293) (-641.751) (-640.933) -- 0:00:30
521000 -- [-642.220] (-645.401) (-641.863) (-643.253) * [-641.980] (-642.783) (-641.653) (-640.938) -- 0:00:30
521500 -- (-641.099) [-641.777] (-643.249) (-640.141) * (-642.084) (-643.003) (-642.476) [-641.781] -- 0:00:30
522000 -- [-638.262] (-641.234) (-642.276) (-644.062) * (-640.992) (-644.917) (-642.555) [-643.077] -- 0:00:30
522500 -- [-641.666] (-643.299) (-642.297) (-641.818) * (-641.787) [-639.001] (-644.053) (-646.301) -- 0:00:30
523000 -- [-643.893] (-644.349) (-643.405) (-643.319) * (-643.193) (-642.031) [-642.784] (-647.791) -- 0:00:30
523500 -- [-642.622] (-645.139) (-645.880) (-645.159) * (-645.305) (-644.356) [-641.951] (-644.577) -- 0:00:30
524000 -- (-643.714) (-644.817) (-642.424) [-641.538] * (-642.664) (-643.513) (-642.804) [-643.043] -- 0:00:29
524500 -- (-644.581) (-643.894) [-643.907] (-642.509) * (-641.800) (-642.573) [-642.608] (-644.151) -- 0:00:30
525000 -- (-642.879) (-642.669) (-644.583) [-642.536] * (-642.593) [-644.695] (-642.707) (-641.996) -- 0:00:30
Average standard deviation of split frequencies: 0.012049
525500 -- (-643.841) (-641.477) [-646.962] (-644.638) * (-644.607) [-641.850] (-642.910) (-642.982) -- 0:00:30
526000 -- (-644.394) (-644.979) (-642.268) [-641.218] * (-640.919) [-641.196] (-641.646) (-643.286) -- 0:00:30
526500 -- (-644.318) (-642.971) (-641.522) [-643.636] * (-642.402) (-643.295) (-642.443) [-642.910] -- 0:00:30
527000 -- (-642.172) (-642.809) (-643.315) [-641.896] * (-644.775) (-641.591) [-643.326] (-646.472) -- 0:00:30
527500 -- (-645.357) (-643.809) (-644.393) [-645.940] * (-652.183) (-641.367) (-642.717) [-643.161] -- 0:00:30
528000 -- (-641.641) (-644.104) [-642.713] (-640.501) * (-640.379) (-641.227) [-642.651] (-641.569) -- 0:00:30
528500 -- (-646.227) (-643.682) (-641.968) [-644.256] * (-641.668) [-643.942] (-643.809) (-648.335) -- 0:00:30
529000 -- [-642.063] (-641.847) (-640.172) (-640.296) * (-639.937) (-641.329) (-645.169) [-641.294] -- 0:00:30
529500 -- (-643.405) (-641.997) (-639.010) [-642.734] * (-642.390) (-642.624) (-644.237) [-644.043] -- 0:00:30
530000 -- (-639.272) (-641.831) (-642.693) [-645.817] * (-643.918) [-642.416] (-643.847) (-643.599) -- 0:00:30
Average standard deviation of split frequencies: 0.012387
530500 -- (-644.282) (-645.296) (-642.713) [-639.661] * (-641.421) [-642.892] (-643.455) (-642.539) -- 0:00:30
531000 -- (-642.206) (-646.816) [-643.491] (-641.910) * (-646.433) (-642.674) [-645.183] (-641.986) -- 0:00:30
531500 -- [-643.574] (-647.348) (-649.790) (-641.798) * [-640.969] (-648.023) (-647.069) (-642.810) -- 0:00:29
532000 -- (-643.142) (-642.875) (-644.667) [-644.628] * (-643.240) (-641.470) (-643.654) [-641.690] -- 0:00:29
532500 -- (-643.173) (-642.608) [-645.999] (-639.146) * (-643.847) (-643.386) (-645.474) [-641.986] -- 0:00:29
533000 -- (-642.703) (-643.053) [-639.610] (-642.296) * (-643.623) (-643.361) [-642.724] (-642.942) -- 0:00:29
533500 -- (-644.036) (-647.883) (-644.639) [-642.978] * (-643.085) (-642.513) [-640.174] (-642.661) -- 0:00:29
534000 -- (-642.729) [-641.139] (-642.655) (-641.703) * [-639.717] (-646.718) (-642.775) (-644.154) -- 0:00:29
534500 -- [-644.970] (-642.911) (-644.943) (-642.217) * [-642.565] (-642.663) (-646.253) (-639.557) -- 0:00:29
535000 -- (-643.106) [-643.271] (-644.019) (-643.695) * (-641.424) (-641.106) (-644.694) [-641.890] -- 0:00:29
Average standard deviation of split frequencies: 0.011873
535500 -- (-645.329) (-643.218) (-642.029) [-643.352] * (-642.808) [-641.633] (-644.615) (-641.585) -- 0:00:29
536000 -- (-642.912) [-643.173] (-642.922) (-648.537) * [-641.173] (-640.883) (-644.403) (-640.402) -- 0:00:29
536500 -- (-641.712) (-643.711) [-645.375] (-646.789) * (-640.259) [-641.116] (-645.393) (-640.413) -- 0:00:29
537000 -- [-641.973] (-643.175) (-647.404) (-644.460) * (-642.343) (-642.494) [-641.476] (-645.392) -- 0:00:29
537500 -- (-643.748) [-641.422] (-644.715) (-642.399) * (-642.433) [-641.211] (-642.093) (-645.727) -- 0:00:29
538000 -- (-643.554) (-648.612) [-645.344] (-644.036) * (-640.880) (-640.641) [-644.553] (-642.035) -- 0:00:29
538500 -- (-640.211) (-643.346) [-643.010] (-644.721) * (-642.974) [-640.683] (-644.326) (-641.214) -- 0:00:29
539000 -- [-642.182] (-644.295) (-644.364) (-642.322) * [-641.771] (-641.770) (-640.551) (-643.011) -- 0:00:29
539500 -- (-643.142) [-644.520] (-642.090) (-644.559) * (-639.485) (-642.521) (-641.543) [-643.237] -- 0:00:29
540000 -- (-640.029) (-646.168) [-641.997] (-643.505) * (-641.978) [-641.148] (-642.726) (-644.372) -- 0:00:29
Average standard deviation of split frequencies: 0.011044
540500 -- (-645.606) [-641.981] (-641.719) (-642.196) * (-643.922) [-640.748] (-642.635) (-644.219) -- 0:00:29
541000 -- (-642.419) (-644.294) (-641.929) [-639.689] * (-641.269) [-642.824] (-641.996) (-640.471) -- 0:00:29
541500 -- [-641.797] (-644.981) (-642.413) (-642.372) * (-642.204) (-644.365) (-642.258) [-642.442] -- 0:00:29
542000 -- (-642.318) [-640.866] (-643.757) (-645.037) * [-641.728] (-646.363) (-642.813) (-641.517) -- 0:00:29
542500 -- (-644.690) [-642.944] (-642.330) (-644.570) * (-643.753) [-641.631] (-642.779) (-640.301) -- 0:00:29
543000 -- (-645.170) (-643.347) [-641.848] (-642.870) * [-638.734] (-641.188) (-645.299) (-642.204) -- 0:00:29
543500 -- [-643.570] (-640.945) (-641.754) (-642.412) * [-643.734] (-647.250) (-644.232) (-646.490) -- 0:00:29
544000 -- [-642.903] (-640.704) (-643.110) (-647.400) * (-639.894) (-640.831) (-644.993) [-641.589] -- 0:00:29
544500 -- (-641.245) (-645.563) (-639.626) [-644.193] * (-640.841) [-643.286] (-644.726) (-641.832) -- 0:00:29
545000 -- [-640.105] (-641.359) (-641.845) (-646.397) * [-639.508] (-644.856) (-643.311) (-643.207) -- 0:00:29
Average standard deviation of split frequencies: 0.011133
545500 -- [-641.090] (-641.184) (-644.078) (-644.608) * (-644.479) (-642.145) [-642.317] (-641.783) -- 0:00:29
546000 -- (-642.415) (-642.750) [-640.433] (-642.173) * (-642.246) [-642.973] (-642.296) (-640.749) -- 0:00:29
546500 -- (-642.854) (-643.744) (-640.632) [-643.695] * (-643.134) [-644.103] (-646.361) (-646.051) -- 0:00:29
547000 -- (-642.696) [-641.945] (-645.120) (-643.233) * (-643.671) [-643.299] (-641.949) (-646.635) -- 0:00:28
547500 -- (-646.466) (-642.119) (-642.664) [-641.661] * (-642.615) (-641.746) [-642.231] (-642.899) -- 0:00:28
548000 -- (-640.843) [-641.769] (-643.636) (-642.707) * (-643.728) [-642.641] (-645.483) (-645.702) -- 0:00:28
548500 -- (-641.538) [-641.451] (-641.957) (-642.376) * (-644.137) [-641.514] (-645.946) (-641.684) -- 0:00:28
549000 -- (-644.282) [-645.007] (-642.142) (-643.739) * (-642.770) [-641.754] (-643.618) (-646.663) -- 0:00:28
549500 -- (-641.077) (-643.886) [-642.899] (-643.631) * (-644.417) [-640.725] (-642.198) (-643.481) -- 0:00:28
550000 -- [-642.516] (-642.991) (-644.129) (-642.373) * (-638.987) [-642.340] (-642.510) (-645.586) -- 0:00:28
Average standard deviation of split frequencies: 0.011129
550500 -- (-648.418) (-644.632) [-641.449] (-643.747) * (-642.111) (-643.622) [-641.846] (-643.804) -- 0:00:28
551000 -- (-643.340) (-641.589) (-644.081) [-640.798] * (-641.451) (-641.327) [-644.114] (-642.313) -- 0:00:28
551500 -- (-642.646) (-648.988) (-641.022) [-643.608] * (-643.441) (-639.144) [-645.734] (-641.744) -- 0:00:28
552000 -- (-640.766) (-642.505) [-642.856] (-647.058) * (-643.932) (-645.523) (-643.864) [-644.403] -- 0:00:28
552500 -- [-638.537] (-642.531) (-641.788) (-643.194) * (-643.524) (-642.329) (-642.788) [-645.218] -- 0:00:28
553000 -- (-641.385) (-647.079) (-642.629) [-644.357] * (-642.592) [-643.726] (-643.210) (-645.683) -- 0:00:28
553500 -- (-644.966) (-639.812) (-641.610) [-641.947] * (-642.252) (-645.397) (-644.414) [-643.526] -- 0:00:28
554000 -- [-642.500] (-643.313) (-643.425) (-643.920) * (-642.959) (-649.218) (-642.564) [-640.115] -- 0:00:28
554500 -- [-640.916] (-647.700) (-640.859) (-644.171) * [-643.265] (-648.100) (-640.102) (-641.594) -- 0:00:28
555000 -- (-642.928) [-651.335] (-646.955) (-644.573) * [-642.306] (-644.934) (-646.300) (-640.933) -- 0:00:28
Average standard deviation of split frequencies: 0.011634
555500 -- (-641.768) (-644.151) (-644.152) [-645.152] * (-641.693) (-644.395) (-644.143) [-641.784] -- 0:00:28
556000 -- (-645.915) [-643.654] (-642.348) (-643.293) * [-643.770] (-647.246) (-641.492) (-644.099) -- 0:00:28
556500 -- [-641.644] (-646.822) (-641.921) (-640.288) * [-639.846] (-643.822) (-641.119) (-642.052) -- 0:00:28
557000 -- (-648.176) (-641.782) (-643.035) [-642.040] * (-643.402) [-646.863] (-641.505) (-641.646) -- 0:00:28
557500 -- (-642.055) (-641.979) [-642.448] (-643.813) * [-643.654] (-644.664) (-646.100) (-643.730) -- 0:00:28
558000 -- (-641.635) (-646.050) (-642.867) [-639.850] * (-642.535) [-643.973] (-644.543) (-643.843) -- 0:00:28
558500 -- [-641.969] (-643.375) (-642.116) (-641.696) * [-643.001] (-646.425) (-641.021) (-642.169) -- 0:00:28
559000 -- [-641.587] (-644.515) (-642.117) (-642.127) * (-642.032) (-643.618) (-643.126) [-641.656] -- 0:00:28
559500 -- (-641.501) (-642.784) [-642.506] (-642.726) * [-642.081] (-642.171) (-641.892) (-643.078) -- 0:00:28
560000 -- (-642.998) (-643.065) [-645.760] (-642.533) * (-640.842) [-642.325] (-650.332) (-642.294) -- 0:00:28
Average standard deviation of split frequencies: 0.011329
560500 -- [-642.469] (-642.253) (-647.703) (-642.445) * (-643.951) [-642.184] (-643.345) (-642.249) -- 0:00:28
561000 -- (-643.317) (-642.701) (-642.415) [-644.769] * (-641.784) (-646.455) [-644.092] (-649.606) -- 0:00:28
561500 -- [-639.776] (-643.358) (-644.179) (-646.017) * [-642.334] (-644.015) (-644.203) (-641.845) -- 0:00:28
562000 -- (-642.895) [-646.061] (-643.779) (-643.344) * [-644.880] (-645.103) (-643.125) (-645.224) -- 0:00:28
562500 -- (-642.324) (-647.025) (-642.311) [-641.240] * (-644.135) [-642.298] (-645.704) (-640.972) -- 0:00:28
563000 -- (-642.654) (-646.335) (-643.288) [-641.559] * (-643.462) [-641.808] (-642.803) (-640.284) -- 0:00:27
563500 -- (-643.711) (-642.559) (-641.980) [-641.580] * [-639.280] (-644.547) (-642.199) (-641.982) -- 0:00:27
564000 -- (-642.566) [-643.362] (-642.731) (-645.079) * [-642.385] (-644.614) (-642.157) (-641.417) -- 0:00:27
564500 -- [-644.956] (-644.171) (-643.095) (-645.447) * (-641.501) (-643.720) [-640.660] (-640.822) -- 0:00:27
565000 -- (-644.081) [-641.388] (-641.523) (-647.850) * (-641.742) (-642.917) (-639.855) [-642.775] -- 0:00:27
Average standard deviation of split frequencies: 0.010827
565500 -- (-641.821) [-639.475] (-642.462) (-645.030) * [-640.751] (-643.239) (-647.104) (-643.755) -- 0:00:27
566000 -- (-643.558) (-644.152) [-641.345] (-644.495) * [-639.383] (-643.284) (-643.697) (-647.080) -- 0:00:27
566500 -- (-642.591) [-643.018] (-642.093) (-641.502) * (-646.020) [-642.478] (-643.737) (-642.243) -- 0:00:27
567000 -- (-644.044) (-640.804) (-646.479) [-642.567] * (-641.693) [-644.428] (-641.695) (-643.617) -- 0:00:27
567500 -- [-644.093] (-641.614) (-645.056) (-643.397) * [-643.095] (-642.943) (-644.161) (-649.830) -- 0:00:27
568000 -- [-644.001] (-641.320) (-642.013) (-645.748) * (-642.333) [-643.775] (-645.477) (-643.647) -- 0:00:27
568500 -- (-644.533) (-643.996) (-641.336) [-646.621] * (-647.500) [-643.161] (-642.673) (-641.299) -- 0:00:27
569000 -- (-646.529) [-643.624] (-641.886) (-642.080) * (-643.030) (-644.188) (-641.525) [-645.445] -- 0:00:27
569500 -- [-640.366] (-641.339) (-642.669) (-641.610) * (-644.383) [-639.779] (-640.343) (-643.747) -- 0:00:27
570000 -- (-643.068) (-642.224) (-642.741) [-648.683] * (-642.356) (-640.279) [-641.537] (-639.952) -- 0:00:27
Average standard deviation of split frequencies: 0.010652
570500 -- [-641.529] (-642.107) (-647.727) (-643.631) * (-644.104) [-643.939] (-643.501) (-644.971) -- 0:00:27
571000 -- (-641.925) (-645.888) (-642.119) [-640.386] * [-644.470] (-642.725) (-642.239) (-640.698) -- 0:00:27
571500 -- [-642.770] (-643.115) (-641.934) (-643.731) * (-644.847) (-643.060) (-639.721) [-642.454] -- 0:00:27
572000 -- (-644.768) (-642.998) (-640.190) [-641.566] * (-645.391) [-642.825] (-643.710) (-640.957) -- 0:00:27
572500 -- (-643.400) (-644.955) (-642.402) [-642.421] * (-642.388) [-638.989] (-643.257) (-641.275) -- 0:00:27
573000 -- (-642.290) (-643.550) [-645.529] (-642.179) * [-643.133] (-644.932) (-647.283) (-643.256) -- 0:00:27
573500 -- (-643.722) [-642.103] (-645.505) (-644.874) * (-643.346) [-642.476] (-643.984) (-643.019) -- 0:00:27
574000 -- (-644.236) [-642.521] (-644.501) (-642.842) * [-641.248] (-640.742) (-642.069) (-641.965) -- 0:00:27
574500 -- (-647.358) (-639.171) (-642.763) [-643.188] * (-640.180) [-643.611] (-642.261) (-642.773) -- 0:00:27
575000 -- [-642.679] (-649.305) (-641.657) (-642.244) * (-641.809) (-643.022) [-642.440] (-642.951) -- 0:00:27
Average standard deviation of split frequencies: 0.010769
575500 -- (-644.912) (-642.388) (-643.919) [-640.195] * [-641.483] (-644.552) (-643.848) (-640.765) -- 0:00:27
576000 -- (-639.988) (-641.457) [-642.407] (-640.341) * (-639.069) (-645.815) [-641.964] (-641.661) -- 0:00:27
576500 -- (-641.293) (-643.304) (-640.315) [-641.180] * (-642.416) (-646.676) [-641.545] (-642.914) -- 0:00:27
577000 -- [-642.645] (-641.017) (-643.309) (-640.143) * (-643.126) (-642.787) (-642.135) [-641.796] -- 0:00:27
577500 -- (-644.965) (-639.456) [-640.300] (-642.396) * [-642.105] (-640.807) (-642.146) (-643.256) -- 0:00:27
578000 -- [-644.484] (-641.815) (-640.302) (-644.296) * [-640.946] (-644.177) (-644.829) (-644.609) -- 0:00:27
578500 -- [-642.273] (-642.328) (-643.182) (-646.665) * (-645.893) (-643.897) (-645.558) [-645.733] -- 0:00:26
579000 -- (-643.840) (-643.949) [-641.773] (-642.562) * (-644.935) [-642.212] (-644.677) (-644.456) -- 0:00:26
579500 -- [-642.321] (-646.614) (-642.879) (-644.702) * (-644.529) [-640.120] (-641.892) (-647.481) -- 0:00:26
580000 -- [-642.785] (-642.371) (-641.320) (-644.916) * [-642.141] (-641.723) (-643.188) (-643.116) -- 0:00:26
Average standard deviation of split frequencies: 0.010169
580500 -- (-643.492) (-641.365) (-643.356) [-642.674] * (-646.468) (-649.801) [-644.347] (-639.892) -- 0:00:26
581000 -- (-646.267) (-644.068) [-641.967] (-641.728) * [-642.096] (-643.993) (-639.484) (-643.247) -- 0:00:26
581500 -- (-643.487) [-643.147] (-642.205) (-641.908) * (-643.678) (-643.068) [-641.618] (-645.259) -- 0:00:26
582000 -- (-642.219) (-644.696) [-643.004] (-642.193) * [-641.303] (-644.676) (-642.351) (-643.223) -- 0:00:26
582500 -- (-641.878) (-646.963) (-645.866) [-642.176] * (-643.687) (-641.860) (-640.665) [-644.090] -- 0:00:26
583000 -- (-642.184) [-641.817] (-645.455) (-643.920) * (-642.816) (-642.229) (-642.391) [-641.407] -- 0:00:26
583500 -- (-644.497) (-648.943) [-644.508] (-652.086) * [-643.804] (-643.726) (-642.074) (-645.304) -- 0:00:26
584000 -- (-642.264) (-645.758) (-640.103) [-643.084] * (-641.855) [-645.687] (-642.171) (-643.009) -- 0:00:26
584500 -- [-643.053] (-642.830) (-644.249) (-643.980) * [-642.758] (-646.482) (-642.394) (-644.426) -- 0:00:26
585000 -- (-641.056) [-642.309] (-646.553) (-641.515) * [-641.538] (-642.537) (-641.638) (-644.551) -- 0:00:26
Average standard deviation of split frequencies: 0.010034
585500 -- [-641.644] (-643.798) (-645.707) (-642.865) * (-650.128) (-644.070) (-643.301) [-642.653] -- 0:00:26
586000 -- [-643.419] (-640.741) (-642.567) (-644.948) * (-646.118) (-645.089) (-643.703) [-643.544] -- 0:00:26
586500 -- (-641.213) [-642.471] (-639.367) (-639.754) * (-649.326) (-642.763) (-644.330) [-643.561] -- 0:00:26
587000 -- (-641.531) (-643.147) [-639.565] (-642.203) * (-649.858) [-642.568] (-643.115) (-642.516) -- 0:00:26
587500 -- (-641.709) (-645.436) [-640.439] (-643.480) * (-641.928) (-647.190) [-642.585] (-641.389) -- 0:00:26
588000 -- [-642.463] (-642.788) (-642.895) (-642.515) * (-643.070) (-641.924) (-639.461) [-641.416] -- 0:00:26
588500 -- [-643.497] (-640.566) (-643.791) (-643.437) * (-641.891) (-641.846) (-642.038) [-641.552] -- 0:00:26
589000 -- (-641.405) [-640.334] (-642.742) (-644.126) * (-643.953) [-647.721] (-642.803) (-642.724) -- 0:00:26
589500 -- (-642.557) (-642.128) [-644.224] (-644.401) * [-642.603] (-643.047) (-643.909) (-650.668) -- 0:00:26
590000 -- [-644.845] (-646.907) (-641.627) (-643.967) * [-642.204] (-646.958) (-646.031) (-647.122) -- 0:00:26
Average standard deviation of split frequencies: 0.009955
590500 -- [-640.344] (-643.556) (-641.374) (-642.382) * (-641.594) [-642.245] (-643.984) (-647.054) -- 0:00:26
591000 -- (-642.090) [-643.375] (-643.759) (-642.108) * (-641.210) (-641.609) [-640.601] (-644.355) -- 0:00:26
591500 -- (-643.140) (-649.006) [-643.312] (-642.022) * [-642.438] (-642.349) (-643.152) (-643.175) -- 0:00:26
592000 -- (-641.579) [-645.991] (-642.546) (-642.215) * [-642.856] (-644.694) (-643.020) (-642.642) -- 0:00:26
592500 -- (-641.756) (-641.797) (-643.901) [-644.219] * (-643.167) (-643.077) [-644.401] (-642.008) -- 0:00:26
593000 -- (-638.816) (-643.163) (-640.466) [-641.781] * (-641.192) [-643.124] (-642.228) (-646.197) -- 0:00:26
593500 -- (-642.508) (-645.391) (-645.136) [-640.769] * (-646.543) (-643.487) (-641.099) [-645.052] -- 0:00:26
594000 -- (-644.231) [-644.919] (-645.873) (-641.102) * [-640.594] (-642.830) (-643.408) (-643.028) -- 0:00:25
594500 -- (-645.301) [-643.618] (-644.747) (-640.627) * (-643.197) (-642.122) (-647.151) [-642.834] -- 0:00:25
595000 -- (-645.418) [-643.970] (-643.878) (-642.466) * (-642.220) (-644.391) (-644.041) [-642.771] -- 0:00:25
Average standard deviation of split frequencies: 0.010033
595500 -- (-642.221) (-643.540) (-642.969) [-642.600] * (-643.441) (-643.421) (-643.304) [-642.028] -- 0:00:25
596000 -- (-643.702) [-640.403] (-643.049) (-643.949) * [-644.084] (-642.106) (-642.341) (-648.591) -- 0:00:25
596500 -- (-642.953) [-645.082] (-641.607) (-644.113) * (-641.967) (-647.437) [-645.493] (-643.324) -- 0:00:25
597000 -- (-640.051) (-642.585) [-641.380] (-643.500) * (-644.992) (-646.366) (-641.495) [-641.875] -- 0:00:25
597500 -- [-639.258] (-645.010) (-642.032) (-642.744) * (-642.002) [-643.678] (-643.572) (-642.391) -- 0:00:25
598000 -- (-641.617) (-643.076) (-645.591) [-642.936] * (-642.994) (-645.691) (-642.249) [-645.356] -- 0:00:25
598500 -- (-643.021) (-643.555) (-647.166) [-642.496] * (-645.267) (-648.135) [-641.326] (-642.290) -- 0:00:25
599000 -- (-645.011) [-640.337] (-643.181) (-648.171) * (-644.758) (-644.843) [-641.859] (-642.352) -- 0:00:25
599500 -- [-641.557] (-641.637) (-647.714) (-645.663) * [-642.496] (-643.223) (-642.211) (-642.942) -- 0:00:25
600000 -- (-642.952) (-641.357) [-640.999] (-641.060) * [-644.154] (-642.805) (-641.923) (-644.978) -- 0:00:25
Average standard deviation of split frequencies: 0.009583
600500 -- (-641.987) [-641.112] (-644.193) (-646.291) * (-642.299) (-647.780) [-642.619] (-644.564) -- 0:00:25
601000 -- (-643.418) (-643.562) [-641.351] (-641.761) * (-644.830) (-644.775) (-642.039) [-642.987] -- 0:00:25
601500 -- (-643.373) (-644.523) (-641.851) [-638.933] * [-641.430] (-641.706) (-643.983) (-641.899) -- 0:00:25
602000 -- [-643.708] (-638.202) (-638.988) (-641.466) * (-639.638) (-641.500) (-642.716) [-644.514] -- 0:00:25
602500 -- [-645.277] (-649.624) (-641.840) (-642.668) * (-641.470) [-641.324] (-644.475) (-642.424) -- 0:00:25
603000 -- (-644.979) (-641.912) [-642.104] (-641.741) * [-643.303] (-641.926) (-650.661) (-640.919) -- 0:00:25
603500 -- [-640.224] (-643.590) (-641.684) (-642.605) * (-644.224) (-641.103) (-643.195) [-644.137] -- 0:00:25
604000 -- (-643.611) [-643.522] (-645.091) (-640.497) * [-642.469] (-641.663) (-643.919) (-642.810) -- 0:00:25
604500 -- (-643.149) [-643.816] (-643.831) (-643.377) * (-643.021) (-644.542) (-642.787) [-644.886] -- 0:00:25
605000 -- (-644.454) (-643.394) (-643.380) [-642.307] * (-642.064) (-645.944) [-642.353] (-645.171) -- 0:00:25
Average standard deviation of split frequencies: 0.009499
605500 -- (-643.001) (-642.504) (-642.768) [-640.734] * (-642.703) [-639.634] (-646.047) (-642.457) -- 0:00:25
606000 -- (-642.336) (-648.894) [-642.246] (-640.030) * (-641.956) [-640.146] (-643.678) (-648.710) -- 0:00:25
606500 -- (-642.108) [-642.150] (-643.156) (-647.370) * (-642.034) (-643.373) [-646.827] (-642.655) -- 0:00:25
607000 -- (-642.844) (-643.861) (-641.581) [-641.533] * (-642.777) (-645.226) [-647.283] (-643.745) -- 0:00:25
607500 -- (-642.847) (-645.328) (-641.737) [-641.976] * (-645.757) [-641.288] (-646.266) (-642.953) -- 0:00:25
608000 -- [-643.395] (-642.419) (-643.063) (-641.796) * (-642.110) (-641.271) (-644.372) [-641.863] -- 0:00:25
608500 -- (-642.535) (-643.564) (-641.583) [-642.623] * (-642.005) (-640.636) (-645.064) [-642.251] -- 0:00:25
609000 -- (-642.320) [-643.267] (-640.312) (-642.348) * [-644.272] (-640.580) (-643.143) (-641.443) -- 0:00:25
609500 -- (-644.946) [-643.150] (-645.360) (-642.584) * (-643.051) (-642.379) (-641.705) [-639.023] -- 0:00:24
610000 -- (-644.533) (-642.570) [-643.864] (-644.302) * (-643.547) [-640.142] (-642.712) (-644.371) -- 0:00:24
Average standard deviation of split frequencies: 0.009507
610500 -- [-640.799] (-642.375) (-640.509) (-641.867) * (-644.681) (-641.862) [-643.444] (-643.417) -- 0:00:24
611000 -- (-641.556) [-641.502] (-644.604) (-641.863) * (-643.243) (-644.256) [-643.428] (-641.411) -- 0:00:24
611500 -- (-643.432) (-643.642) (-641.114) [-645.995] * (-644.452) [-644.393] (-642.500) (-643.943) -- 0:00:24
612000 -- (-643.067) (-644.672) [-642.915] (-643.336) * (-648.641) (-642.118) (-642.365) [-642.826] -- 0:00:24
612500 -- [-642.609] (-642.486) (-646.618) (-643.295) * (-641.418) (-641.741) [-639.399] (-646.124) -- 0:00:24
613000 -- [-642.991] (-641.894) (-641.681) (-644.206) * [-642.398] (-641.240) (-646.291) (-642.797) -- 0:00:24
613500 -- (-641.249) (-644.349) [-643.634] (-643.375) * (-640.526) (-642.706) [-643.274] (-644.988) -- 0:00:24
614000 -- (-640.837) (-643.465) (-642.513) [-639.060] * (-641.656) (-642.817) (-645.306) [-641.843] -- 0:00:24
614500 -- [-642.485] (-643.516) (-640.858) (-645.083) * (-644.560) (-643.192) [-643.408] (-641.978) -- 0:00:24
615000 -- [-642.761] (-640.794) (-641.526) (-644.182) * (-641.183) (-646.692) [-643.569] (-644.225) -- 0:00:24
Average standard deviation of split frequencies: 0.009183
615500 -- (-643.436) (-641.911) [-644.014] (-643.268) * [-642.117] (-644.655) (-642.321) (-642.379) -- 0:00:24
616000 -- (-644.911) (-642.162) (-642.310) [-644.474] * [-641.219] (-645.888) (-643.164) (-640.172) -- 0:00:24
616500 -- (-641.923) [-640.367] (-641.356) (-643.339) * (-641.812) (-645.789) (-643.731) [-641.651] -- 0:00:24
617000 -- (-642.261) (-641.160) [-638.382] (-639.429) * (-643.728) (-643.555) (-646.439) [-641.833] -- 0:00:24
617500 -- (-644.113) [-642.122] (-643.038) (-647.855) * (-641.276) [-644.687] (-642.950) (-641.151) -- 0:00:24
618000 -- [-643.006] (-641.783) (-642.339) (-642.223) * (-643.802) (-644.543) [-643.934] (-642.908) -- 0:00:24
618500 -- (-642.279) [-643.497] (-642.714) (-647.027) * (-640.611) (-644.570) [-640.062] (-641.373) -- 0:00:24
619000 -- (-642.409) [-641.448] (-645.103) (-642.090) * [-641.902] (-641.859) (-641.592) (-643.017) -- 0:00:24
619500 -- (-642.483) [-640.522] (-651.102) (-646.649) * [-644.084] (-644.865) (-645.942) (-643.182) -- 0:00:24
620000 -- (-642.665) (-642.358) [-642.261] (-642.511) * (-645.217) (-642.250) (-641.168) [-646.393] -- 0:00:24
Average standard deviation of split frequencies: 0.009714
620500 -- (-645.740) [-643.823] (-645.889) (-643.668) * (-644.686) [-641.289] (-642.448) (-641.956) -- 0:00:24
621000 -- (-643.556) (-644.630) (-644.029) [-644.174] * (-646.109) (-642.149) [-641.743] (-644.429) -- 0:00:24
621500 -- (-641.198) [-643.309] (-641.181) (-643.516) * (-645.768) (-641.222) (-640.794) [-645.167] -- 0:00:24
622000 -- (-647.145) (-645.058) (-642.891) [-643.779] * [-641.151] (-644.644) (-642.363) (-642.618) -- 0:00:24
622500 -- (-643.403) (-644.350) (-641.609) [-643.812] * (-643.640) (-647.058) [-648.093] (-646.261) -- 0:00:24
623000 -- (-643.267) [-642.947] (-640.713) (-646.379) * (-644.652) (-643.624) [-640.257] (-646.119) -- 0:00:24
623500 -- (-642.041) [-641.649] (-643.356) (-645.139) * (-644.318) (-645.318) [-646.981] (-642.842) -- 0:00:24
624000 -- (-642.844) (-642.540) [-641.223] (-645.339) * (-644.255) (-641.971) (-644.181) [-642.318] -- 0:00:24
624500 -- (-641.323) [-640.317] (-644.435) (-643.208) * (-642.582) (-645.057) [-647.428] (-643.094) -- 0:00:24
625000 -- (-641.888) (-643.387) (-641.869) [-648.302] * (-643.702) (-643.794) (-646.858) [-642.166] -- 0:00:24
Average standard deviation of split frequencies: 0.010067
625500 -- [-641.522] (-643.795) (-641.989) (-645.830) * (-644.440) (-644.240) [-642.747] (-643.370) -- 0:00:23
626000 -- [-642.509] (-641.929) (-642.579) (-642.088) * [-643.980] (-643.685) (-639.489) (-642.130) -- 0:00:23
626500 -- [-644.250] (-642.290) (-645.075) (-646.038) * (-645.867) (-640.143) (-640.333) [-642.818] -- 0:00:23
627000 -- (-647.809) [-643.814] (-646.056) (-643.537) * [-639.709] (-646.263) (-642.560) (-649.063) -- 0:00:23
627500 -- (-641.150) [-642.994] (-642.987) (-638.988) * (-641.171) (-644.509) [-643.695] (-648.808) -- 0:00:23
628000 -- [-642.950] (-640.232) (-643.068) (-643.923) * [-643.910] (-642.283) (-641.244) (-644.778) -- 0:00:23
628500 -- (-643.785) (-644.039) [-643.922] (-642.602) * (-643.943) (-642.446) [-642.161] (-640.376) -- 0:00:23
629000 -- (-641.853) (-642.705) [-641.439] (-643.059) * (-645.882) [-643.007] (-640.069) (-644.997) -- 0:00:23
629500 -- (-641.954) (-642.502) (-642.403) [-639.788] * (-643.469) (-644.914) [-642.731] (-646.841) -- 0:00:23
630000 -- [-644.825] (-641.604) (-643.927) (-642.318) * [-642.970] (-642.943) (-645.193) (-641.933) -- 0:00:23
Average standard deviation of split frequencies: 0.009324
630500 -- (-645.776) (-643.130) (-644.485) [-647.170] * [-642.479] (-644.561) (-646.942) (-642.073) -- 0:00:23
631000 -- (-645.980) [-644.560] (-640.557) (-642.100) * (-641.860) (-643.334) [-643.635] (-644.815) -- 0:00:23
631500 -- (-642.885) (-644.509) (-644.279) [-641.988] * [-643.117] (-645.315) (-646.550) (-643.170) -- 0:00:23
632000 -- (-642.670) (-642.473) (-646.157) [-642.663] * (-643.049) (-642.075) (-641.845) [-642.668] -- 0:00:23
632500 -- (-643.961) [-642.367] (-641.275) (-643.672) * [-642.823] (-644.637) (-643.783) (-641.538) -- 0:00:23
633000 -- (-642.987) (-641.645) [-644.073] (-641.497) * [-643.762] (-643.579) (-643.821) (-643.096) -- 0:00:23
633500 -- (-641.788) [-642.480] (-642.226) (-641.359) * (-643.778) (-643.033) [-643.854] (-643.178) -- 0:00:23
634000 -- [-643.623] (-640.587) (-644.111) (-643.788) * (-645.607) (-643.632) (-642.241) [-643.079] -- 0:00:23
634500 -- (-643.831) (-641.613) (-644.345) [-643.488] * (-646.587) (-642.552) [-640.476] (-645.765) -- 0:00:23
635000 -- (-641.528) (-643.957) [-641.592] (-641.860) * (-643.651) (-645.141) [-642.812] (-648.260) -- 0:00:23
Average standard deviation of split frequencies: 0.009480
635500 -- (-643.700) (-645.078) (-643.099) [-643.451] * (-642.619) [-644.776] (-644.938) (-644.567) -- 0:00:23
636000 -- (-643.057) (-644.813) (-644.185) [-641.914] * (-643.836) (-643.503) (-644.551) [-642.170] -- 0:00:23
636500 -- (-644.659) [-649.800] (-645.201) (-642.785) * (-643.867) (-645.346) (-643.313) [-642.374] -- 0:00:23
637000 -- (-643.675) (-644.058) (-645.664) [-642.790] * (-643.694) (-644.264) [-642.396] (-641.546) -- 0:00:23
637500 -- (-642.670) (-643.920) (-643.775) [-642.440] * (-643.761) (-644.912) (-644.897) [-644.508] -- 0:00:23
638000 -- (-642.995) (-642.711) (-645.171) [-641.756] * (-642.701) (-639.351) [-642.801] (-646.410) -- 0:00:23
638500 -- (-642.973) (-641.352) [-643.832] (-642.239) * (-644.517) [-644.392] (-645.265) (-642.423) -- 0:00:23
639000 -- (-641.018) [-642.805] (-642.760) (-642.668) * (-643.378) (-644.854) (-642.189) [-642.272] -- 0:00:23
639500 -- [-642.349] (-640.637) (-646.491) (-642.250) * (-645.445) (-642.359) (-643.127) [-642.049] -- 0:00:23
640000 -- (-642.080) (-645.821) [-640.884] (-641.521) * (-642.273) [-642.960] (-641.547) (-646.399) -- 0:00:23
Average standard deviation of split frequencies: 0.009178
640500 -- [-642.576] (-647.119) (-641.915) (-643.838) * (-641.495) [-645.204] (-644.491) (-644.425) -- 0:00:23
641000 -- (-642.895) [-640.319] (-643.511) (-644.365) * (-643.650) [-644.570] (-644.392) (-647.117) -- 0:00:22
641500 -- (-642.401) (-643.409) (-640.171) [-646.791] * (-644.061) (-640.276) (-646.693) [-645.387] -- 0:00:22
642000 -- [-642.366] (-643.662) (-649.619) (-644.003) * [-647.381] (-645.215) (-642.208) (-643.808) -- 0:00:22
642500 -- (-643.032) (-644.269) (-644.227) [-643.232] * (-644.770) [-643.018] (-642.864) (-642.810) -- 0:00:22
643000 -- [-641.865] (-642.694) (-642.609) (-642.713) * (-640.934) [-642.935] (-642.213) (-643.726) -- 0:00:22
643500 -- [-642.971] (-643.857) (-643.944) (-642.106) * (-642.563) [-643.110] (-642.465) (-644.337) -- 0:00:22
644000 -- [-642.444] (-641.937) (-643.814) (-641.971) * [-641.941] (-643.863) (-642.665) (-648.373) -- 0:00:22
644500 -- (-643.869) (-643.587) [-642.821] (-642.071) * [-642.944] (-641.373) (-645.437) (-646.687) -- 0:00:22
645000 -- (-639.423) [-643.150] (-642.002) (-643.867) * [-642.531] (-642.770) (-645.179) (-648.587) -- 0:00:22
Average standard deviation of split frequencies: 0.009256
645500 -- (-646.909) [-647.010] (-641.482) (-644.331) * (-643.033) (-642.852) (-642.644) [-644.375] -- 0:00:22
646000 -- [-642.827] (-642.965) (-649.598) (-644.420) * (-642.861) (-644.910) (-645.204) [-643.130] -- 0:00:22
646500 -- (-647.133) (-646.818) [-642.820] (-644.242) * (-643.172) [-642.317] (-644.129) (-641.408) -- 0:00:22
647000 -- (-642.557) (-644.898) [-643.361] (-645.097) * (-638.953) (-642.942) (-642.437) [-642.961] -- 0:00:22
647500 -- (-646.445) (-643.040) [-642.019] (-643.061) * (-645.806) [-640.794] (-642.761) (-643.154) -- 0:00:22
648000 -- (-644.523) [-642.467] (-644.519) (-644.393) * (-647.996) (-641.147) [-642.152] (-643.942) -- 0:00:22
648500 -- (-641.621) (-643.149) [-643.136] (-643.045) * (-645.026) (-643.154) [-641.321] (-642.942) -- 0:00:22
649000 -- (-643.607) (-642.372) (-644.543) [-643.053] * (-642.131) (-644.337) [-641.716] (-642.161) -- 0:00:22
649500 -- (-641.183) (-647.431) [-642.328] (-644.076) * (-644.266) (-640.394) (-640.854) [-642.061] -- 0:00:22
650000 -- (-646.954) [-645.429] (-641.935) (-640.894) * (-643.382) (-642.329) [-642.365] (-643.343) -- 0:00:22
Average standard deviation of split frequencies: 0.009418
650500 -- (-647.306) (-641.285) [-644.899] (-642.299) * (-643.489) (-644.685) (-644.852) [-641.144] -- 0:00:22
651000 -- [-645.438] (-642.036) (-645.232) (-643.300) * (-641.834) (-642.033) (-640.200) [-641.651] -- 0:00:22
651500 -- [-645.082] (-641.587) (-647.836) (-645.014) * (-642.887) (-647.393) (-648.120) [-640.301] -- 0:00:22
652000 -- [-641.967] (-640.727) (-642.240) (-642.839) * (-641.981) (-648.627) [-640.926] (-642.787) -- 0:00:22
652500 -- (-641.145) [-642.491] (-642.329) (-641.563) * (-641.151) [-640.515] (-645.023) (-643.625) -- 0:00:22
653000 -- (-640.743) (-643.002) [-644.820] (-642.449) * [-640.864] (-645.751) (-642.607) (-639.898) -- 0:00:22
653500 -- [-642.282] (-643.419) (-643.329) (-643.946) * (-640.986) (-645.072) (-641.862) [-641.156] -- 0:00:22
654000 -- (-639.187) (-642.435) (-641.277) [-641.944] * (-642.397) (-646.062) [-642.100] (-641.427) -- 0:00:22
654500 -- (-644.389) [-644.563] (-642.845) (-644.082) * [-641.879] (-639.517) (-641.674) (-645.554) -- 0:00:22
655000 -- (-642.390) (-645.466) [-642.201] (-640.847) * (-645.953) (-642.420) [-642.047] (-642.325) -- 0:00:22
Average standard deviation of split frequencies: 0.010098
655500 -- [-640.670] (-643.151) (-646.581) (-645.082) * [-643.838] (-646.681) (-642.558) (-642.027) -- 0:00:22
656000 -- [-642.531] (-643.244) (-642.949) (-642.401) * (-643.655) (-642.909) [-642.742] (-642.651) -- 0:00:22
656500 -- [-642.699] (-642.379) (-641.860) (-643.689) * [-644.132] (-643.038) (-646.214) (-641.867) -- 0:00:21
657000 -- (-643.325) [-643.803] (-642.144) (-644.399) * (-644.009) (-641.517) [-643.068] (-640.769) -- 0:00:21
657500 -- (-643.891) (-641.042) (-642.461) [-643.002] * (-644.574) (-642.259) [-644.843] (-645.597) -- 0:00:21
658000 -- (-644.003) [-641.935] (-643.798) (-642.538) * [-643.194] (-642.037) (-646.310) (-642.265) -- 0:00:21
658500 -- (-642.392) (-640.339) (-642.531) [-643.946] * (-642.538) [-641.615] (-644.142) (-641.524) -- 0:00:21
659000 -- (-644.272) [-644.226] (-643.237) (-641.357) * [-643.827] (-642.120) (-644.483) (-641.559) -- 0:00:21
659500 -- (-646.294) [-642.403] (-647.337) (-640.622) * (-644.411) (-647.672) (-643.037) [-641.308] -- 0:00:21
660000 -- (-643.135) [-642.694] (-642.825) (-642.846) * [-650.137] (-646.860) (-643.492) (-643.184) -- 0:00:21
Average standard deviation of split frequencies: 0.009952
660500 -- [-642.667] (-644.814) (-645.488) (-641.966) * [-640.973] (-642.695) (-640.866) (-642.897) -- 0:00:21
661000 -- (-643.871) (-642.586) [-641.316] (-642.368) * [-642.841] (-643.235) (-643.668) (-641.728) -- 0:00:21
661500 -- (-646.829) (-643.778) [-648.072] (-644.401) * (-643.327) (-645.372) [-641.054] (-645.035) -- 0:00:21
662000 -- [-644.944] (-642.736) (-646.309) (-642.560) * (-643.702) (-643.057) [-641.618] (-642.934) -- 0:00:21
662500 -- (-642.944) (-645.725) [-643.357] (-643.335) * (-642.893) [-642.299] (-642.740) (-646.963) -- 0:00:21
663000 -- [-642.404] (-642.564) (-646.360) (-643.968) * (-644.121) (-643.224) [-642.330] (-641.784) -- 0:00:21
663500 -- (-645.103) (-642.214) [-642.151] (-641.864) * [-642.321] (-644.569) (-641.344) (-643.227) -- 0:00:21
664000 -- [-643.380] (-642.197) (-641.986) (-644.450) * (-639.749) (-641.559) (-640.886) [-644.462] -- 0:00:21
664500 -- (-646.637) (-646.282) (-642.711) [-642.163] * (-642.438) [-641.370] (-647.320) (-645.335) -- 0:00:21
665000 -- (-644.213) [-641.367] (-639.868) (-642.294) * (-645.087) (-641.245) [-641.850] (-646.070) -- 0:00:21
Average standard deviation of split frequencies: 0.009760
665500 -- [-642.302] (-642.706) (-643.618) (-645.119) * (-643.993) (-642.790) (-644.102) [-642.903] -- 0:00:21
666000 -- (-642.454) [-642.289] (-642.905) (-646.161) * (-641.410) [-641.329] (-643.607) (-643.879) -- 0:00:21
666500 -- (-641.967) [-643.271] (-646.307) (-647.970) * (-643.040) [-645.995] (-644.698) (-643.458) -- 0:00:21
667000 -- [-641.430] (-645.120) (-641.052) (-644.517) * (-644.644) [-646.627] (-648.328) (-643.332) -- 0:00:21
667500 -- (-642.709) (-643.726) (-645.608) [-642.416] * (-643.202) (-641.856) (-642.181) [-642.366] -- 0:00:21
668000 -- (-642.852) [-642.949] (-639.367) (-641.330) * (-644.462) (-643.805) [-646.738] (-644.154) -- 0:00:21
668500 -- [-645.102] (-640.636) (-642.787) (-643.430) * (-644.014) [-644.034] (-642.147) (-643.504) -- 0:00:21
669000 -- (-645.676) [-645.713] (-643.732) (-642.476) * [-642.240] (-643.885) (-643.220) (-643.470) -- 0:00:21
669500 -- (-644.166) (-643.006) [-646.651] (-640.750) * (-644.088) (-642.367) (-643.093) [-641.626] -- 0:00:21
670000 -- [-642.137] (-642.183) (-641.212) (-642.280) * (-643.981) (-642.222) [-646.153] (-642.548) -- 0:00:21
Average standard deviation of split frequencies: 0.009471
670500 -- (-642.198) [-642.868] (-644.590) (-642.109) * (-642.699) (-642.769) (-645.086) [-643.329] -- 0:00:21
671000 -- [-642.661] (-643.888) (-646.775) (-642.741) * (-642.956) (-642.706) (-642.119) [-642.690] -- 0:00:21
671500 -- [-642.616] (-646.879) (-640.793) (-643.935) * [-645.322] (-646.640) (-641.617) (-649.691) -- 0:00:21
672000 -- [-643.514] (-642.902) (-644.958) (-642.934) * [-643.774] (-644.264) (-644.497) (-648.370) -- 0:00:20
672500 -- (-645.189) [-642.218] (-644.133) (-642.583) * (-643.915) [-642.206] (-640.568) (-648.641) -- 0:00:20
673000 -- (-644.208) (-643.571) [-642.097] (-646.717) * [-641.741] (-643.514) (-643.490) (-643.806) -- 0:00:20
673500 -- [-643.846] (-642.513) (-645.474) (-643.863) * (-642.021) [-643.920] (-642.630) (-643.984) -- 0:00:20
674000 -- (-642.308) (-644.283) (-642.517) [-647.754] * (-643.030) [-642.493] (-642.153) (-643.556) -- 0:00:20
674500 -- (-641.544) (-644.074) (-640.364) [-644.313] * [-642.831] (-643.443) (-642.771) (-647.973) -- 0:00:20
675000 -- (-640.690) [-641.823] (-645.008) (-646.297) * (-642.795) (-644.010) [-645.073] (-643.940) -- 0:00:20
Average standard deviation of split frequencies: 0.009212
675500 -- (-640.286) [-641.876] (-644.631) (-647.397) * (-644.514) [-641.651] (-643.261) (-643.285) -- 0:00:20
676000 -- (-642.401) [-645.140] (-645.144) (-641.863) * [-644.345] (-642.827) (-642.863) (-644.046) -- 0:00:20
676500 -- (-643.066) (-642.626) (-642.551) [-641.637] * [-641.533] (-639.533) (-645.032) (-645.248) -- 0:00:20
677000 -- (-644.079) (-641.914) [-642.842] (-643.520) * (-642.917) (-643.986) [-643.381] (-647.649) -- 0:00:20
677500 -- (-643.014) [-640.211] (-646.772) (-643.623) * (-641.763) [-643.723] (-643.782) (-648.920) -- 0:00:20
678000 -- (-644.510) (-643.682) (-645.194) [-643.095] * (-643.521) (-645.340) (-643.045) [-641.095] -- 0:00:20
678500 -- [-642.183] (-643.096) (-644.563) (-644.703) * (-641.375) [-643.231] (-650.662) (-642.084) -- 0:00:20
679000 -- [-644.147] (-651.966) (-644.936) (-642.813) * [-639.482] (-643.793) (-642.308) (-646.456) -- 0:00:20
679500 -- (-642.007) (-648.750) [-641.624] (-643.940) * (-642.217) (-646.559) [-641.929] (-645.372) -- 0:00:20
680000 -- [-641.054] (-643.269) (-641.991) (-642.793) * (-640.656) [-642.472] (-643.179) (-643.527) -- 0:00:20
Average standard deviation of split frequencies: 0.008748
680500 -- [-641.588] (-643.167) (-642.189) (-643.273) * (-646.113) (-643.923) (-643.063) [-644.785] -- 0:00:20
681000 -- (-641.651) (-642.827) (-644.968) [-642.604] * (-643.253) [-644.579] (-642.086) (-648.790) -- 0:00:20
681500 -- (-644.419) (-644.131) [-642.767] (-643.658) * (-646.933) (-641.227) [-639.628] (-642.150) -- 0:00:20
682000 -- (-643.216) (-645.225) (-641.899) [-640.365] * (-643.412) [-642.476] (-642.188) (-642.450) -- 0:00:20
682500 -- [-642.570] (-646.163) (-646.739) (-645.347) * (-645.320) [-644.731] (-645.043) (-640.846) -- 0:00:20
683000 -- (-648.769) [-643.752] (-644.043) (-641.595) * [-643.551] (-641.818) (-643.215) (-642.758) -- 0:00:20
683500 -- (-644.697) (-640.949) [-641.962] (-642.540) * [-643.868] (-639.686) (-646.776) (-646.201) -- 0:00:20
684000 -- (-642.666) [-642.142] (-643.618) (-643.544) * (-646.312) [-640.540] (-643.419) (-646.689) -- 0:00:20
684500 -- (-640.789) [-640.920] (-644.270) (-646.445) * [-645.740] (-644.838) (-642.499) (-644.904) -- 0:00:20
685000 -- [-642.850] (-647.085) (-642.987) (-646.324) * (-643.095) (-642.227) [-643.172] (-645.320) -- 0:00:20
Average standard deviation of split frequencies: 0.008282
685500 -- [-642.631] (-643.801) (-644.021) (-649.540) * (-642.735) [-642.765] (-643.193) (-642.080) -- 0:00:20
686000 -- (-641.964) (-642.412) [-639.176] (-641.582) * (-644.591) (-640.956) (-646.067) [-641.749] -- 0:00:20
686500 -- (-643.996) [-645.152] (-641.427) (-643.845) * [-642.318] (-643.417) (-647.936) (-642.132) -- 0:00:20
687000 -- (-644.425) (-644.615) (-641.935) [-646.130] * (-641.852) [-643.027] (-642.062) (-642.776) -- 0:00:20
687500 -- [-645.254] (-643.049) (-642.313) (-643.452) * (-644.964) (-642.513) (-644.206) [-640.907] -- 0:00:20
688000 -- (-643.054) [-642.351] (-640.223) (-640.976) * (-643.518) (-640.988) (-641.631) [-642.438] -- 0:00:19
688500 -- [-642.847] (-643.431) (-642.824) (-643.773) * (-642.085) (-640.930) [-642.505] (-641.651) -- 0:00:19
689000 -- (-643.680) (-641.697) [-638.652] (-641.327) * (-643.674) [-640.745] (-642.730) (-646.417) -- 0:00:19
689500 -- (-642.908) (-642.105) [-645.319] (-642.310) * (-642.220) (-641.040) [-642.538] (-647.304) -- 0:00:19
690000 -- [-641.635] (-644.020) (-644.973) (-645.304) * (-642.874) [-644.616] (-645.047) (-641.910) -- 0:00:19
Average standard deviation of split frequencies: 0.008478
690500 -- (-642.836) [-639.711] (-642.655) (-644.396) * (-640.309) (-644.864) [-646.539] (-643.653) -- 0:00:19
691000 -- (-645.058) (-643.718) (-642.682) [-643.524] * (-643.954) [-642.016] (-645.050) (-642.717) -- 0:00:19
691500 -- (-642.364) (-641.315) (-643.763) [-643.480] * (-648.046) (-642.787) (-644.601) [-643.993] -- 0:00:19
692000 -- (-641.189) (-641.898) (-642.866) [-642.418] * (-647.312) (-641.619) [-643.526] (-646.157) -- 0:00:19
692500 -- (-642.606) (-645.480) (-642.668) [-642.946] * (-640.636) [-641.739] (-642.165) (-644.499) -- 0:00:19
693000 -- (-644.552) (-642.310) [-643.320] (-642.863) * (-645.772) [-643.513] (-646.523) (-644.254) -- 0:00:19
693500 -- (-642.977) (-641.598) (-643.343) [-645.500] * [-643.025] (-644.307) (-645.015) (-641.708) -- 0:00:19
694000 -- (-643.738) [-642.154] (-643.709) (-643.208) * (-644.383) (-642.903) [-641.362] (-644.367) -- 0:00:19
694500 -- (-646.090) (-643.922) (-644.008) [-642.204] * (-640.212) (-644.137) [-644.197] (-641.438) -- 0:00:19
695000 -- (-645.958) (-642.884) [-644.884] (-643.378) * (-645.093) [-639.324] (-642.357) (-645.275) -- 0:00:19
Average standard deviation of split frequencies: 0.008413
695500 -- (-642.537) (-640.778) [-646.209] (-644.208) * (-642.836) [-641.645] (-644.959) (-640.928) -- 0:00:19
696000 -- (-642.992) [-641.907] (-643.344) (-643.677) * (-642.561) [-642.294] (-645.911) (-646.322) -- 0:00:19
696500 -- [-641.086] (-646.084) (-642.731) (-643.174) * (-644.260) (-640.619) (-644.037) [-645.706] -- 0:00:19
697000 -- (-644.091) [-641.891] (-640.374) (-645.842) * (-642.320) (-640.512) (-643.067) [-641.849] -- 0:00:19
697500 -- (-643.216) [-641.130] (-641.540) (-644.518) * [-642.158] (-644.530) (-647.216) (-644.928) -- 0:00:19
698000 -- (-643.514) (-641.834) [-644.354] (-641.936) * (-642.559) [-641.523] (-642.540) (-644.740) -- 0:00:19
698500 -- [-640.968] (-642.869) (-639.604) (-642.844) * (-644.409) (-649.041) [-642.116] (-642.328) -- 0:00:19
699000 -- (-640.029) [-643.029] (-642.257) (-644.504) * (-642.952) (-643.875) (-645.141) [-642.600] -- 0:00:19
699500 -- (-641.666) (-642.604) (-641.952) [-642.624] * (-643.759) (-643.725) [-644.387] (-646.116) -- 0:00:19
700000 -- (-648.545) (-641.440) [-641.079] (-645.337) * [-643.204] (-639.661) (-643.680) (-642.512) -- 0:00:19
Average standard deviation of split frequencies: 0.007967
700500 -- (-645.376) (-642.731) [-642.805] (-643.772) * (-643.427) (-644.055) (-642.060) [-642.364] -- 0:00:19
701000 -- (-644.563) (-642.774) [-640.619] (-644.169) * (-643.311) [-641.257] (-640.866) (-642.368) -- 0:00:19
701500 -- (-642.087) (-643.003) [-640.423] (-643.155) * [-641.644] (-645.813) (-644.846) (-644.165) -- 0:00:19
702000 -- (-641.416) (-642.386) (-642.612) [-641.253] * (-643.351) (-642.803) (-642.733) [-644.569] -- 0:00:19
702500 -- [-642.186] (-644.416) (-642.190) (-640.953) * [-642.693] (-641.817) (-643.273) (-642.887) -- 0:00:19
703000 -- (-647.871) [-641.563] (-641.909) (-641.244) * (-646.508) [-643.935] (-641.426) (-643.231) -- 0:00:19
703500 -- (-646.509) (-642.287) (-642.894) [-649.311] * (-641.719) (-644.758) (-642.374) [-643.058] -- 0:00:18
704000 -- (-645.281) (-643.184) [-641.678] (-642.359) * [-640.772] (-642.575) (-640.721) (-643.286) -- 0:00:18
704500 -- (-645.791) [-645.546] (-642.727) (-643.604) * (-642.836) (-644.761) [-640.464] (-649.146) -- 0:00:18
705000 -- (-641.653) [-642.714] (-638.736) (-644.070) * [-640.170] (-644.707) (-642.507) (-645.612) -- 0:00:18
Average standard deviation of split frequencies: 0.007872
705500 -- (-644.632) (-643.173) [-640.184] (-641.212) * (-643.129) (-643.528) (-644.342) [-647.651] -- 0:00:18
706000 -- (-642.276) (-642.345) [-642.197] (-644.167) * [-642.599] (-644.247) (-646.375) (-644.982) -- 0:00:18
706500 -- (-643.652) [-645.149] (-641.861) (-643.697) * (-643.850) (-643.727) (-644.561) [-641.671] -- 0:00:18
707000 -- (-644.935) [-647.134] (-639.814) (-645.915) * (-641.225) [-642.274] (-644.386) (-644.964) -- 0:00:18
707500 -- [-651.602] (-645.687) (-644.357) (-646.402) * [-644.257] (-643.150) (-643.362) (-642.481) -- 0:00:18
708000 -- [-641.460] (-643.069) (-644.279) (-641.645) * (-641.878) [-640.646] (-642.732) (-642.657) -- 0:00:18
708500 -- (-642.678) (-641.918) [-643.116] (-639.517) * [-642.829] (-642.185) (-643.201) (-641.744) -- 0:00:18
709000 -- [-642.962] (-644.318) (-643.136) (-642.883) * (-642.467) (-648.537) (-639.726) [-643.942] -- 0:00:18
709500 -- (-643.874) (-642.278) (-644.833) [-642.222] * [-642.719] (-642.405) (-646.054) (-643.484) -- 0:00:18
710000 -- (-643.949) [-641.224] (-644.225) (-644.272) * (-642.828) (-646.617) (-643.789) [-643.756] -- 0:00:18
Average standard deviation of split frequencies: 0.007820
710500 -- (-642.776) [-643.782] (-641.909) (-642.646) * (-641.906) [-642.407] (-642.994) (-645.841) -- 0:00:18
711000 -- (-643.727) (-642.878) (-642.436) [-644.859] * (-641.835) (-642.129) [-642.289] (-645.306) -- 0:00:18
711500 -- [-641.848] (-646.504) (-644.372) (-640.943) * (-648.087) (-642.715) [-641.395] (-644.245) -- 0:00:18
712000 -- [-640.443] (-641.944) (-643.296) (-641.134) * [-644.435] (-641.814) (-639.768) (-646.705) -- 0:00:18
712500 -- (-642.127) (-643.705) [-642.393] (-642.950) * (-644.032) [-642.283] (-641.588) (-645.583) -- 0:00:18
713000 -- [-642.446] (-641.058) (-643.504) (-643.554) * (-642.945) (-647.961) [-641.584] (-647.734) -- 0:00:18
713500 -- [-642.701] (-650.353) (-643.797) (-643.123) * (-642.564) [-640.907] (-644.602) (-645.809) -- 0:00:18
714000 -- [-641.498] (-642.840) (-642.255) (-644.411) * (-641.499) (-642.095) (-640.134) [-644.493] -- 0:00:18
714500 -- (-642.174) [-639.426] (-642.492) (-640.970) * (-642.547) (-641.686) [-642.304] (-642.422) -- 0:00:18
715000 -- (-639.894) (-642.534) (-642.886) [-642.123] * [-641.412] (-643.525) (-642.635) (-643.780) -- 0:00:18
Average standard deviation of split frequencies: 0.007762
715500 -- (-641.194) [-643.567] (-641.417) (-650.283) * (-642.442) (-642.247) [-642.397] (-641.663) -- 0:00:18
716000 -- (-641.996) (-645.597) (-644.038) [-643.254] * [-641.031] (-642.502) (-647.888) (-642.250) -- 0:00:18
716500 -- (-640.897) (-642.651) (-642.996) [-643.217] * (-642.866) (-645.514) (-647.022) [-644.230] -- 0:00:18
717000 -- (-642.411) [-641.557] (-644.588) (-640.885) * (-643.420) [-641.512] (-640.687) (-645.322) -- 0:00:18
717500 -- (-641.676) [-641.440] (-642.320) (-642.036) * [-643.132] (-643.854) (-641.929) (-642.249) -- 0:00:18
718000 -- (-642.796) [-639.939] (-641.204) (-638.555) * (-641.279) [-642.115] (-641.239) (-642.522) -- 0:00:18
718500 -- (-642.757) (-641.883) (-644.227) [-641.519] * [-640.901] (-642.742) (-641.699) (-641.349) -- 0:00:18
719000 -- (-644.334) (-645.593) [-642.419] (-645.913) * (-642.512) (-645.647) [-645.478] (-646.222) -- 0:00:17
719500 -- (-642.554) [-640.880] (-640.273) (-641.977) * (-640.915) [-643.047] (-643.930) (-641.801) -- 0:00:17
720000 -- [-643.845] (-643.667) (-643.127) (-644.978) * (-641.401) [-644.950] (-644.861) (-645.509) -- 0:00:17
Average standard deviation of split frequencies: 0.007781
720500 -- (-638.865) (-642.736) [-642.830] (-643.538) * [-642.007] (-641.090) (-643.912) (-644.278) -- 0:00:17
721000 -- [-647.654] (-643.214) (-641.166) (-643.883) * (-642.272) (-641.554) (-649.229) [-644.613] -- 0:00:17
721500 -- (-647.362) [-642.908] (-644.153) (-643.102) * [-645.408] (-643.741) (-642.784) (-645.073) -- 0:00:17
722000 -- (-643.222) (-644.536) (-640.653) [-643.092] * (-642.856) (-647.967) [-640.471] (-642.755) -- 0:00:17
722500 -- [-645.264] (-645.578) (-641.595) (-642.288) * (-645.813) (-646.256) [-644.246] (-643.122) -- 0:00:17
723000 -- (-642.550) [-641.586] (-643.135) (-643.474) * (-642.294) (-643.547) (-644.004) [-643.192] -- 0:00:17
723500 -- [-641.127] (-641.690) (-641.401) (-643.128) * [-645.586] (-639.918) (-642.868) (-642.157) -- 0:00:17
724000 -- (-643.344) (-642.998) (-647.538) [-642.671] * (-643.570) [-647.182] (-641.682) (-642.402) -- 0:00:17
724500 -- (-642.516) (-642.661) (-641.219) [-641.646] * (-644.276) [-640.705] (-641.515) (-643.571) -- 0:00:17
725000 -- (-641.804) (-641.104) (-641.710) [-641.880] * [-645.511] (-641.578) (-642.269) (-642.379) -- 0:00:17
Average standard deviation of split frequencies: 0.007929
725500 -- (-642.702) [-642.443] (-641.616) (-642.244) * [-643.152] (-643.698) (-642.054) (-642.459) -- 0:00:17
726000 -- (-643.979) (-643.586) (-640.851) [-643.268] * (-641.391) [-649.735] (-641.272) (-643.247) -- 0:00:17
726500 -- (-640.414) (-644.178) (-643.016) [-640.075] * (-642.248) (-643.671) [-641.752] (-648.170) -- 0:00:17
727000 -- (-643.882) [-643.537] (-642.726) (-644.824) * [-642.138] (-641.002) (-642.167) (-643.140) -- 0:00:17
727500 -- [-642.795] (-645.696) (-649.237) (-643.357) * (-641.972) (-644.372) (-640.489) [-643.483] -- 0:00:17
728000 -- (-644.920) (-646.079) [-643.910] (-648.901) * [-643.345] (-642.424) (-641.331) (-640.548) -- 0:00:17
728500 -- (-642.185) (-641.895) (-641.937) [-642.415] * (-642.355) (-643.357) (-643.071) [-643.078] -- 0:00:17
729000 -- (-642.215) (-642.565) [-643.546] (-641.564) * [-641.409] (-644.803) (-644.962) (-643.227) -- 0:00:17
729500 -- [-644.332] (-642.594) (-643.258) (-643.345) * (-642.963) (-642.068) (-642.396) [-639.757] -- 0:00:17
730000 -- (-642.056) [-643.428] (-641.892) (-642.839) * (-643.271) (-645.037) [-646.251] (-642.752) -- 0:00:17
Average standard deviation of split frequencies: 0.007504
730500 -- (-641.684) (-642.765) [-641.462] (-644.478) * (-647.742) (-642.842) [-642.951] (-640.914) -- 0:00:17
731000 -- (-643.450) (-643.887) (-639.603) [-642.535] * (-643.555) (-643.045) (-643.107) [-641.838] -- 0:00:17
731500 -- (-642.574) (-642.186) [-645.437] (-643.507) * (-642.743) [-645.641] (-645.309) (-644.860) -- 0:00:17
732000 -- (-644.622) (-639.982) [-644.088] (-640.387) * (-642.742) (-642.978) (-644.598) [-640.112] -- 0:00:17
732500 -- (-643.201) [-641.583] (-641.867) (-640.942) * (-643.085) (-642.150) [-641.934] (-644.133) -- 0:00:17
733000 -- (-641.935) (-640.691) [-639.753] (-642.015) * (-642.951) (-639.583) (-645.094) [-644.839] -- 0:00:17
733500 -- [-642.237] (-645.689) (-642.777) (-643.057) * (-641.623) (-642.319) (-643.921) [-645.765] -- 0:00:17
734000 -- (-643.330) (-647.929) (-644.039) [-643.029] * (-643.242) [-641.157] (-643.559) (-643.379) -- 0:00:17
734500 -- (-644.012) [-645.324] (-647.224) (-643.945) * [-641.945] (-642.413) (-644.205) (-647.094) -- 0:00:16
735000 -- (-642.692) (-643.970) (-646.627) [-641.745] * (-640.877) [-641.669] (-642.666) (-644.956) -- 0:00:16
Average standard deviation of split frequencies: 0.007989
735500 -- [-641.950] (-643.475) (-644.677) (-641.944) * (-644.113) [-641.370] (-646.095) (-640.667) -- 0:00:16
736000 -- (-644.715) (-644.504) [-639.958] (-644.925) * (-645.773) (-646.552) (-643.647) [-641.953] -- 0:00:16
736500 -- (-647.411) (-646.279) [-645.130] (-641.760) * (-641.423) (-646.423) [-642.716] (-647.397) -- 0:00:16
737000 -- (-643.723) [-644.147] (-645.628) (-643.623) * (-643.437) [-643.510] (-643.842) (-641.591) -- 0:00:16
737500 -- (-643.430) (-642.259) [-642.923] (-644.530) * (-644.842) (-641.763) [-643.754] (-642.254) -- 0:00:16
738000 -- (-644.529) (-642.387) (-646.584) [-643.742] * (-645.536) [-642.301] (-644.058) (-642.265) -- 0:00:16
738500 -- [-643.338] (-641.189) (-643.114) (-645.327) * (-640.869) [-643.911] (-642.570) (-645.517) -- 0:00:16
739000 -- (-642.441) (-644.282) [-641.261] (-646.170) * (-645.469) [-643.275] (-642.326) (-641.754) -- 0:00:16
739500 -- [-639.826] (-643.127) (-642.367) (-644.793) * (-641.071) (-643.717) [-639.855] (-646.107) -- 0:00:16
740000 -- [-641.715] (-647.858) (-642.769) (-644.707) * (-644.647) [-640.383] (-642.802) (-643.987) -- 0:00:16
Average standard deviation of split frequencies: 0.007939
740500 -- (-642.252) [-645.841] (-644.865) (-644.120) * (-648.069) (-646.898) [-642.798] (-645.147) -- 0:00:16
741000 -- [-638.974] (-644.191) (-644.312) (-641.353) * (-642.675) [-641.651] (-644.027) (-643.271) -- 0:00:16
741500 -- [-640.812] (-644.278) (-644.849) (-642.974) * (-642.448) (-643.738) (-644.208) [-640.912] -- 0:00:16
742000 -- (-640.818) [-644.729] (-643.326) (-645.320) * (-643.304) [-643.766] (-643.583) (-644.412) -- 0:00:16
742500 -- [-642.572] (-642.413) (-641.370) (-643.286) * (-641.454) (-642.404) (-647.743) [-643.976] -- 0:00:16
743000 -- [-641.666] (-644.521) (-642.326) (-645.005) * (-640.342) (-642.388) (-643.277) [-640.472] -- 0:00:16
743500 -- (-641.449) (-643.297) (-640.853) [-644.789] * [-642.020] (-642.770) (-642.937) (-640.996) -- 0:00:16
744000 -- (-642.154) [-641.944] (-643.082) (-642.245) * (-641.353) (-644.099) [-643.633] (-640.913) -- 0:00:16
744500 -- (-644.953) (-642.152) [-642.017] (-643.658) * (-642.120) (-641.478) [-645.379] (-644.092) -- 0:00:16
745000 -- (-642.047) (-643.363) (-644.240) [-643.013] * (-647.732) (-641.726) (-646.546) [-642.825] -- 0:00:16
Average standard deviation of split frequencies: 0.008115
745500 -- [-641.431] (-641.963) (-644.546) (-642.225) * (-648.306) (-643.582) (-641.292) [-640.181] -- 0:00:16
746000 -- [-643.566] (-643.088) (-641.694) (-641.541) * (-642.377) (-643.399) (-642.006) [-639.764] -- 0:00:16
746500 -- [-644.051] (-645.004) (-642.139) (-643.737) * (-642.126) (-642.591) (-642.407) [-642.665] -- 0:00:16
747000 -- [-642.616] (-642.964) (-643.132) (-644.888) * (-648.476) [-644.299] (-641.338) (-643.045) -- 0:00:16
747500 -- (-645.811) (-644.053) (-641.755) [-644.431] * (-644.675) [-641.528] (-647.358) (-645.960) -- 0:00:16
748000 -- (-640.196) (-642.033) (-642.732) [-643.038] * (-643.643) [-642.357] (-641.469) (-641.220) -- 0:00:16
748500 -- [-643.236] (-643.148) (-640.647) (-643.521) * [-643.923] (-643.612) (-641.287) (-644.850) -- 0:00:16
749000 -- [-641.589] (-642.279) (-640.679) (-642.858) * (-639.531) (-641.581) (-649.549) [-641.284] -- 0:00:16
749500 -- (-642.682) (-642.414) [-643.972] (-642.230) * (-642.335) (-649.495) [-644.616] (-641.854) -- 0:00:16
750000 -- [-640.221] (-644.355) (-649.565) (-643.989) * [-644.439] (-642.814) (-643.944) (-644.581) -- 0:00:16
Average standard deviation of split frequencies: 0.008032
750500 -- [-640.640] (-647.724) (-641.956) (-644.249) * (-650.592) [-642.677] (-647.196) (-648.375) -- 0:00:15
751000 -- [-641.179] (-642.245) (-641.590) (-642.861) * (-647.742) (-639.923) [-641.406] (-643.261) -- 0:00:15
751500 -- (-643.068) (-650.794) [-645.038] (-642.065) * (-641.064) (-641.360) [-646.008] (-642.895) -- 0:00:15
752000 -- (-641.492) (-641.366) (-643.307) [-643.615] * (-644.145) (-643.835) [-642.374] (-646.718) -- 0:00:15
752500 -- (-644.461) (-640.608) (-642.194) [-644.194] * (-646.198) [-642.221] (-642.834) (-643.792) -- 0:00:15
753000 -- (-640.849) (-641.441) (-643.363) [-643.308] * (-644.650) [-640.409] (-640.790) (-644.596) -- 0:00:15
753500 -- (-644.293) (-642.588) (-645.238) [-642.644] * (-642.835) (-642.133) (-644.790) [-643.436] -- 0:00:15
754000 -- (-644.170) (-641.043) (-643.724) [-641.363] * [-642.836] (-643.344) (-643.785) (-640.944) -- 0:00:15
754500 -- (-642.788) (-642.161) [-644.837] (-644.491) * (-641.570) [-641.996] (-645.219) (-643.749) -- 0:00:15
755000 -- (-642.974) [-640.228] (-642.679) (-644.346) * (-642.452) (-641.378) [-640.991] (-642.189) -- 0:00:15
Average standard deviation of split frequencies: 0.007319
755500 -- (-643.436) (-642.845) [-642.272] (-643.823) * (-642.265) [-641.888] (-642.142) (-642.719) -- 0:00:15
756000 -- (-642.912) (-643.454) (-642.192) [-645.019] * (-645.408) [-641.789] (-644.282) (-641.413) -- 0:00:15
756500 -- (-643.107) [-639.895] (-642.952) (-641.840) * [-642.320] (-643.454) (-641.600) (-641.263) -- 0:00:15
757000 -- (-638.922) [-639.176] (-642.069) (-641.163) * (-644.508) [-643.600] (-643.394) (-641.508) -- 0:00:15
757500 -- (-641.753) (-644.978) [-642.449] (-642.147) * (-643.373) (-641.382) [-642.324] (-641.522) -- 0:00:15
758000 -- [-639.639] (-646.794) (-640.581) (-642.303) * (-642.644) (-639.875) [-644.816] (-642.277) -- 0:00:15
758500 -- (-645.603) [-641.924] (-641.232) (-643.209) * (-642.336) (-645.192) [-641.906] (-641.562) -- 0:00:15
759000 -- (-641.683) [-639.719] (-644.837) (-643.030) * (-641.238) (-645.340) [-641.405] (-642.351) -- 0:00:15
759500 -- (-642.619) (-646.194) [-642.053] (-641.526) * [-644.304] (-645.594) (-643.162) (-641.140) -- 0:00:15
760000 -- (-646.008) (-646.256) [-641.246] (-644.579) * (-644.645) [-645.403] (-643.825) (-645.102) -- 0:00:15
Average standard deviation of split frequencies: 0.007111
760500 -- (-640.767) (-643.290) (-641.922) [-642.697] * (-643.482) (-644.302) (-640.514) [-643.845] -- 0:00:15
761000 -- (-641.092) (-641.257) (-643.518) [-642.077] * (-643.093) [-641.902] (-643.616) (-646.155) -- 0:00:15
761500 -- (-643.241) (-639.788) [-642.545] (-645.266) * [-643.074] (-643.469) (-641.543) (-641.589) -- 0:00:15
762000 -- (-644.166) (-648.650) (-646.141) [-644.229] * [-642.823] (-641.486) (-642.045) (-641.874) -- 0:00:15
762500 -- (-644.466) [-644.143] (-644.916) (-644.722) * (-643.634) (-641.282) [-644.165] (-645.386) -- 0:00:15
763000 -- [-642.892] (-643.958) (-643.490) (-643.318) * (-642.089) [-641.696] (-643.563) (-644.778) -- 0:00:15
763500 -- [-642.885] (-642.929) (-643.689) (-641.842) * (-641.891) (-643.834) [-644.338] (-642.206) -- 0:00:15
764000 -- (-642.966) [-643.483] (-642.999) (-645.663) * (-642.520) (-642.055) [-642.593] (-642.370) -- 0:00:15
764500 -- (-642.246) [-647.687] (-642.120) (-645.905) * (-642.066) (-649.423) [-643.227] (-644.314) -- 0:00:15
765000 -- (-642.794) (-642.735) (-640.805) [-641.454] * [-643.526] (-648.600) (-642.397) (-643.009) -- 0:00:15
Average standard deviation of split frequencies: 0.006381
765500 -- (-643.321) (-641.688) (-639.736) [-645.652] * (-644.812) (-638.211) (-640.307) [-643.534] -- 0:00:15
766000 -- [-642.373] (-641.371) (-645.664) (-645.792) * (-646.014) (-642.850) (-642.783) [-644.536] -- 0:00:14
766500 -- (-642.268) [-642.129] (-643.228) (-641.760) * (-643.186) (-645.798) [-643.609] (-641.562) -- 0:00:14
767000 -- (-643.047) [-644.117] (-641.983) (-642.940) * (-642.756) [-648.002] (-646.490) (-643.597) -- 0:00:14
767500 -- (-642.345) (-644.358) [-643.683] (-643.540) * [-641.139] (-641.140) (-642.045) (-643.386) -- 0:00:14
768000 -- (-643.334) (-642.081) [-640.978] (-643.898) * [-643.599] (-642.848) (-644.095) (-642.853) -- 0:00:14
768500 -- (-642.707) [-641.749] (-641.347) (-643.138) * (-642.179) [-645.674] (-648.004) (-643.282) -- 0:00:14
769000 -- [-643.289] (-641.379) (-643.928) (-644.160) * (-645.146) (-644.357) (-642.249) [-641.691] -- 0:00:14
769500 -- (-644.412) (-641.098) [-645.484] (-643.103) * (-642.198) (-644.255) [-642.034] (-641.489) -- 0:00:14
770000 -- [-643.039] (-642.414) (-644.796) (-644.328) * (-646.250) (-643.727) [-641.904] (-645.775) -- 0:00:14
Average standard deviation of split frequencies: 0.006535
770500 -- (-643.848) (-643.616) [-643.848] (-642.044) * (-643.463) (-642.622) (-642.859) [-639.217] -- 0:00:14
771000 -- [-646.248] (-647.311) (-642.744) (-642.599) * (-644.101) (-640.745) (-641.485) [-641.489] -- 0:00:14
771500 -- (-642.695) (-643.211) [-644.061] (-640.435) * [-641.696] (-638.731) (-641.832) (-640.272) -- 0:00:14
772000 -- (-643.344) [-643.292] (-645.637) (-643.503) * (-640.028) [-640.314] (-642.678) (-639.967) -- 0:00:14
772500 -- (-643.353) (-645.743) (-642.345) [-642.530] * [-641.274] (-641.987) (-644.830) (-644.871) -- 0:00:14
773000 -- (-641.732) (-641.786) (-641.128) [-643.715] * (-644.199) [-640.857] (-642.763) (-645.269) -- 0:00:14
773500 -- (-643.192) [-640.508] (-641.724) (-644.287) * (-644.957) (-643.748) (-641.582) [-644.062] -- 0:00:14
774000 -- (-642.296) [-642.516] (-640.717) (-643.584) * (-644.498) (-641.856) [-638.901] (-643.060) -- 0:00:14
774500 -- (-642.754) (-641.184) [-643.003] (-643.355) * [-643.986] (-645.296) (-641.455) (-643.074) -- 0:00:14
775000 -- (-640.912) (-642.368) (-641.048) [-643.685] * (-644.433) (-643.673) [-641.398] (-645.122) -- 0:00:14
Average standard deviation of split frequencies: 0.006650
775500 -- (-644.059) (-642.667) (-643.617) [-643.404] * (-643.287) (-644.414) (-647.904) [-644.642] -- 0:00:14
776000 -- (-644.279) [-641.677] (-643.420) (-641.623) * (-641.530) [-645.506] (-642.917) (-644.644) -- 0:00:14
776500 -- (-641.420) [-641.601] (-643.269) (-641.292) * (-642.063) (-644.302) (-642.997) [-643.752] -- 0:00:14
777000 -- (-642.423) [-641.896] (-642.261) (-641.827) * [-641.878] (-643.596) (-643.326) (-642.630) -- 0:00:14
777500 -- (-640.871) (-643.579) (-643.970) [-643.279] * (-642.366) (-640.830) [-647.489] (-644.840) -- 0:00:14
778000 -- [-643.622] (-643.211) (-644.072) (-643.557) * (-646.888) [-644.754] (-642.287) (-642.790) -- 0:00:14
778500 -- (-641.406) (-645.998) (-643.689) [-641.465] * (-639.349) [-643.628] (-643.619) (-641.979) -- 0:00:14
779000 -- (-643.246) (-643.589) (-646.442) [-643.953] * [-641.619] (-641.729) (-650.438) (-642.624) -- 0:00:14
779500 -- (-642.221) (-642.709) [-642.091] (-639.388) * (-643.200) (-645.171) [-641.782] (-642.512) -- 0:00:14
780000 -- (-644.798) [-642.018] (-641.516) (-646.714) * (-647.713) (-640.423) [-641.666] (-644.519) -- 0:00:14
Average standard deviation of split frequencies: 0.006865
780500 -- (-647.695) [-642.624] (-642.266) (-643.424) * (-642.123) [-642.744] (-641.300) (-641.652) -- 0:00:14
781000 -- (-651.960) [-642.214] (-647.081) (-647.533) * (-640.915) [-641.361] (-641.155) (-642.584) -- 0:00:14
781500 -- (-643.539) (-642.073) (-643.509) [-645.455] * (-640.979) [-640.376] (-641.563) (-641.190) -- 0:00:13
782000 -- (-646.919) [-642.711] (-641.249) (-652.052) * (-644.229) (-642.403) [-645.605] (-643.027) -- 0:00:13
782500 -- (-644.345) [-642.584] (-644.602) (-646.649) * (-643.503) (-641.022) [-639.460] (-644.158) -- 0:00:13
783000 -- (-644.696) (-641.910) [-644.461] (-641.250) * (-644.863) [-642.264] (-643.640) (-641.847) -- 0:00:13
783500 -- [-642.921] (-643.463) (-648.188) (-642.393) * (-641.213) (-642.145) [-642.275] (-642.960) -- 0:00:13
784000 -- [-643.968] (-642.857) (-644.453) (-640.379) * (-646.929) (-641.829) [-640.638] (-643.672) -- 0:00:13
784500 -- (-644.231) [-642.016] (-647.071) (-642.859) * (-646.214) [-643.078] (-641.016) (-644.349) -- 0:00:13
785000 -- (-646.941) (-641.849) (-644.874) [-642.818] * (-644.570) [-642.051] (-641.642) (-642.100) -- 0:00:13
Average standard deviation of split frequencies: 0.006597
785500 -- (-640.852) [-641.679] (-646.492) (-643.989) * (-643.962) [-642.752] (-642.521) (-641.490) -- 0:00:13
786000 -- (-641.895) (-642.952) (-643.032) [-644.833] * [-643.536] (-644.675) (-644.523) (-642.642) -- 0:00:13
786500 -- (-640.701) [-643.305] (-642.600) (-640.941) * (-645.751) [-643.925] (-645.550) (-647.892) -- 0:00:13
787000 -- (-643.383) [-642.427] (-642.762) (-642.850) * (-642.411) (-643.591) (-644.243) [-642.582] -- 0:00:13
787500 -- (-644.507) (-643.993) (-643.687) [-641.999] * (-645.559) [-641.267] (-647.293) (-641.571) -- 0:00:13
788000 -- (-642.493) (-643.251) (-641.661) [-642.926] * [-641.774] (-640.812) (-642.481) (-643.579) -- 0:00:13
788500 -- (-642.046) (-642.346) [-640.087] (-641.910) * (-640.003) (-640.843) [-640.261] (-642.295) -- 0:00:13
789000 -- (-642.707) [-642.080] (-643.151) (-643.989) * (-643.447) (-641.139) [-646.312] (-647.462) -- 0:00:13
789500 -- [-642.058] (-642.546) (-643.058) (-643.401) * (-644.458) (-647.395) (-643.438) [-640.498] -- 0:00:13
790000 -- [-643.677] (-642.810) (-643.366) (-643.651) * (-643.924) (-643.225) (-641.756) [-643.004] -- 0:00:13
Average standard deviation of split frequencies: 0.006527
790500 -- [-640.283] (-642.833) (-645.484) (-643.540) * (-644.182) (-642.939) (-641.677) [-642.550] -- 0:00:13
791000 -- (-644.833) (-642.407) (-641.653) [-643.365] * (-641.923) [-641.288] (-643.465) (-644.533) -- 0:00:13
791500 -- (-643.965) (-643.210) [-641.184] (-643.688) * [-643.201] (-640.462) (-643.530) (-645.187) -- 0:00:13
792000 -- (-642.989) (-649.308) (-643.396) [-646.474] * (-643.933) [-641.138] (-644.090) (-641.381) -- 0:00:13
792500 -- (-642.384) (-643.781) [-642.008] (-646.540) * (-642.995) (-642.649) [-640.793] (-642.233) -- 0:00:13
793000 -- [-643.011] (-646.707) (-641.969) (-651.574) * (-643.753) [-641.054] (-650.508) (-639.999) -- 0:00:13
793500 -- (-645.847) (-645.114) [-645.521] (-646.030) * (-642.812) (-641.384) [-643.804] (-641.480) -- 0:00:13
794000 -- (-642.241) [-645.141] (-647.017) (-643.141) * (-643.402) (-644.121) (-645.157) [-637.809] -- 0:00:13
794500 -- [-641.599] (-642.075) (-641.862) (-647.038) * (-644.647) [-638.603] (-646.736) (-643.455) -- 0:00:13
795000 -- (-644.963) [-642.278] (-643.232) (-642.417) * [-640.988] (-642.235) (-646.805) (-641.651) -- 0:00:13
Average standard deviation of split frequencies: 0.006452
795500 -- (-645.998) (-647.066) (-643.470) [-643.542] * [-642.679] (-640.503) (-645.836) (-641.846) -- 0:00:13
796000 -- (-643.069) (-648.796) (-640.042) [-641.460] * (-642.708) [-644.779] (-643.803) (-643.210) -- 0:00:13
796500 -- [-642.848] (-645.068) (-642.144) (-642.842) * [-641.778] (-642.477) (-644.127) (-643.498) -- 0:00:13
797000 -- [-642.204] (-645.881) (-642.460) (-649.187) * (-642.630) (-642.166) [-645.128] (-642.544) -- 0:00:12
797500 -- (-644.843) (-642.739) [-643.176] (-643.493) * [-643.572] (-643.322) (-641.897) (-643.112) -- 0:00:12
798000 -- [-643.310] (-644.844) (-642.644) (-641.608) * [-640.394] (-643.005) (-642.730) (-646.891) -- 0:00:12
798500 -- (-646.570) [-643.152] (-642.729) (-647.342) * (-641.998) (-642.635) (-642.470) [-642.864] -- 0:00:12
799000 -- (-642.908) (-644.369) (-647.196) [-642.509] * (-642.642) (-641.900) [-643.125] (-643.911) -- 0:00:12
799500 -- (-644.907) (-644.339) [-644.362] (-643.630) * [-641.050] (-640.698) (-641.898) (-641.336) -- 0:00:12
800000 -- (-645.096) [-644.292] (-644.602) (-645.631) * (-644.002) [-644.973] (-641.647) (-644.670) -- 0:00:12
Average standard deviation of split frequencies: 0.006352
800500 -- (-642.138) (-643.399) [-644.699] (-644.356) * (-644.455) (-644.787) (-643.020) [-642.894] -- 0:00:12
801000 -- [-642.665] (-641.953) (-641.574) (-643.568) * (-646.671) [-644.152] (-644.288) (-642.177) -- 0:00:12
801500 -- (-642.529) (-646.264) [-639.687] (-647.944) * [-642.438] (-643.025) (-644.287) (-642.261) -- 0:00:12
802000 -- (-644.140) [-644.797] (-640.932) (-645.174) * (-642.683) (-642.803) (-645.019) [-648.759] -- 0:00:12
802500 -- [-643.038] (-642.786) (-641.756) (-643.107) * (-643.182) [-644.518] (-646.009) (-643.054) -- 0:00:12
803000 -- [-641.470] (-641.961) (-639.762) (-642.313) * (-644.560) (-643.821) (-642.603) [-640.687] -- 0:00:12
803500 -- (-641.998) (-642.925) [-639.001] (-644.057) * [-642.118] (-644.941) (-644.827) (-642.376) -- 0:00:12
804000 -- (-642.510) (-646.910) (-642.282) [-643.403] * [-641.548] (-643.058) (-642.865) (-643.824) -- 0:00:12
804500 -- [-641.311] (-641.909) (-646.115) (-642.855) * (-642.532) (-643.911) (-644.608) [-643.884] -- 0:00:12
805000 -- [-643.478] (-642.598) (-642.663) (-643.071) * (-643.618) (-645.298) (-641.725) [-643.048] -- 0:00:12
Average standard deviation of split frequencies: 0.005910
805500 -- (-641.921) (-642.490) [-644.769] (-645.405) * (-646.943) (-644.786) (-642.359) [-642.124] -- 0:00:12
806000 -- (-643.332) (-647.531) (-645.487) [-645.694] * (-643.527) (-643.059) (-642.467) [-644.580] -- 0:00:12
806500 -- (-645.557) (-643.041) (-644.837) [-643.240] * (-646.560) (-641.761) [-641.916] (-643.691) -- 0:00:12
807000 -- [-643.537] (-641.722) (-646.570) (-642.654) * (-643.330) (-645.131) (-645.016) [-641.398] -- 0:00:12
807500 -- [-641.910] (-644.258) (-643.730) (-641.882) * (-640.913) [-642.578] (-640.069) (-640.497) -- 0:00:12
808000 -- (-641.470) (-645.949) (-642.846) [-642.250] * (-642.610) [-644.070] (-641.628) (-640.932) -- 0:00:12
808500 -- [-642.258] (-644.317) (-642.496) (-640.366) * (-644.718) [-642.923] (-641.382) (-641.743) -- 0:00:12
809000 -- (-642.834) (-642.254) [-642.181] (-641.685) * (-639.875) (-643.621) [-641.313] (-643.564) -- 0:00:12
809500 -- [-642.603] (-642.875) (-642.912) (-645.322) * [-643.211] (-642.460) (-642.989) (-641.185) -- 0:00:12
810000 -- (-641.083) (-643.002) [-642.646] (-643.954) * [-645.675] (-643.489) (-641.892) (-644.991) -- 0:00:12
Average standard deviation of split frequencies: 0.005784
810500 -- (-643.298) (-641.357) (-644.573) [-639.266] * (-642.820) [-642.151] (-642.221) (-642.471) -- 0:00:12
811000 -- (-642.376) (-645.663) (-642.913) [-643.481] * (-644.677) [-642.317] (-643.914) (-641.686) -- 0:00:12
811500 -- (-642.429) (-642.825) (-643.183) [-641.721] * (-642.859) (-641.502) [-643.904] (-643.417) -- 0:00:12
812000 -- (-642.294) (-642.728) (-644.516) [-642.526] * [-643.607] (-642.633) (-644.330) (-640.366) -- 0:00:12
812500 -- (-642.248) [-642.380] (-645.361) (-642.685) * (-642.202) [-643.160] (-642.285) (-641.798) -- 0:00:12
813000 -- (-640.041) (-640.253) (-644.255) [-639.973] * (-642.981) [-641.252] (-647.839) (-638.967) -- 0:00:11
813500 -- (-642.543) (-644.714) [-644.346] (-642.001) * (-642.771) (-644.052) [-643.961] (-643.036) -- 0:00:11
814000 -- (-641.750) (-642.078) [-641.895] (-645.928) * (-643.604) [-644.141] (-647.094) (-642.395) -- 0:00:11
814500 -- (-645.021) (-644.945) (-643.906) [-642.462] * (-644.749) (-644.094) (-645.456) [-642.394] -- 0:00:11
815000 -- (-642.266) (-646.098) (-642.729) [-643.842] * (-642.196) (-644.473) (-641.832) [-642.939] -- 0:00:11
Average standard deviation of split frequencies: 0.005473
815500 -- (-641.883) (-647.778) [-643.091] (-642.683) * (-642.251) (-647.179) [-641.698] (-644.912) -- 0:00:11
816000 -- (-646.043) (-643.016) [-645.044] (-646.419) * [-641.318] (-644.785) (-640.553) (-643.998) -- 0:00:11
816500 -- (-644.832) (-647.244) (-645.506) [-644.664] * (-641.463) [-643.124] (-643.218) (-644.090) -- 0:00:11
817000 -- (-644.720) (-642.583) [-647.717] (-642.919) * [-642.903] (-641.218) (-643.981) (-642.396) -- 0:00:11
817500 -- [-644.337] (-643.811) (-645.730) (-641.541) * (-646.859) [-642.265] (-645.205) (-642.613) -- 0:00:11
818000 -- (-642.465) (-644.696) [-642.531] (-643.577) * (-642.796) (-644.960) [-641.557] (-641.648) -- 0:00:11
818500 -- (-645.423) [-644.774] (-642.911) (-644.101) * (-642.891) (-643.413) [-642.230] (-641.654) -- 0:00:11
819000 -- (-646.814) (-643.149) [-645.149] (-645.368) * (-642.288) [-641.282] (-641.264) (-641.595) -- 0:00:11
819500 -- (-644.779) (-645.970) (-644.847) [-642.522] * (-642.820) (-641.738) [-643.895] (-641.243) -- 0:00:11
820000 -- (-645.374) [-644.835] (-643.553) (-642.974) * (-642.576) [-640.288] (-643.479) (-644.635) -- 0:00:11
Average standard deviation of split frequencies: 0.005381
820500 -- (-642.615) (-642.576) [-643.781] (-641.682) * (-642.860) (-644.281) [-641.582] (-647.273) -- 0:00:11
821000 -- (-642.964) (-642.464) (-643.413) [-641.588] * [-643.094] (-643.701) (-639.968) (-644.040) -- 0:00:11
821500 -- (-643.798) (-642.903) (-641.415) [-641.924] * (-643.190) [-638.421] (-640.144) (-644.225) -- 0:00:11
822000 -- (-642.009) [-643.055] (-643.641) (-644.858) * (-643.651) (-643.230) [-643.116] (-643.679) -- 0:00:11
822500 -- (-643.418) (-644.281) (-643.383) [-643.853] * (-643.564) [-642.813] (-643.709) (-644.421) -- 0:00:11
823000 -- (-643.074) (-645.128) [-645.433] (-644.868) * [-641.823] (-642.745) (-645.112) (-648.495) -- 0:00:11
823500 -- (-643.458) (-645.312) (-643.800) [-641.891] * (-642.367) (-641.901) [-644.422] (-641.932) -- 0:00:11
824000 -- (-645.898) (-646.502) [-643.409] (-642.203) * (-644.093) [-641.239] (-642.196) (-645.132) -- 0:00:11
824500 -- (-645.534) (-642.739) [-641.398] (-642.340) * [-641.255] (-642.865) (-645.779) (-641.172) -- 0:00:11
825000 -- [-642.707] (-641.876) (-639.098) (-643.809) * (-641.614) [-639.190] (-647.159) (-644.872) -- 0:00:11
Average standard deviation of split frequencies: 0.005467
825500 -- (-643.662) [-643.295] (-641.681) (-642.034) * (-648.969) [-641.970] (-642.224) (-643.238) -- 0:00:11
826000 -- (-642.750) (-642.389) (-642.334) [-641.312] * (-647.877) (-641.474) [-642.219] (-641.703) -- 0:00:11
826500 -- (-644.157) [-642.559] (-642.537) (-642.816) * (-645.157) (-645.436) [-645.212] (-646.869) -- 0:00:11
827000 -- (-642.416) (-643.409) [-648.197] (-644.224) * (-642.589) (-643.618) [-647.801] (-643.222) -- 0:00:11
827500 -- (-642.725) [-645.057] (-645.233) (-642.995) * (-642.998) (-643.411) (-645.040) [-642.952] -- 0:00:11
828000 -- [-645.444] (-642.752) (-645.124) (-643.986) * (-643.559) (-642.728) [-645.967] (-641.346) -- 0:00:11
828500 -- (-641.492) (-640.479) [-648.056] (-642.553) * (-645.005) (-642.603) (-649.266) [-643.032] -- 0:00:10
829000 -- (-642.967) (-642.611) (-646.253) [-642.485] * [-641.774] (-643.758) (-642.581) (-641.968) -- 0:00:10
829500 -- [-640.938] (-641.321) (-644.614) (-643.238) * (-645.747) (-641.122) (-642.969) [-641.963] -- 0:00:10
830000 -- (-642.027) (-642.590) [-644.588] (-642.210) * (-641.228) (-642.744) (-643.228) [-643.969] -- 0:00:10
Average standard deviation of split frequencies: 0.005197
830500 -- (-641.623) [-641.441] (-642.407) (-642.685) * [-641.739] (-644.810) (-641.324) (-640.917) -- 0:00:10
831000 -- [-640.350] (-641.928) (-643.224) (-641.940) * (-642.743) [-641.885] (-643.540) (-641.807) -- 0:00:10
831500 -- [-643.065] (-642.309) (-645.927) (-644.380) * (-644.515) [-641.602] (-643.330) (-642.847) -- 0:00:10
832000 -- (-641.838) (-644.605) (-646.006) [-640.953] * (-644.866) (-646.189) [-640.913] (-641.914) -- 0:00:10
832500 -- [-641.797] (-640.796) (-643.600) (-644.913) * [-644.127] (-645.131) (-640.360) (-642.870) -- 0:00:10
833000 -- (-643.816) [-643.250] (-642.815) (-642.933) * (-644.250) (-643.341) (-641.950) [-643.395] -- 0:00:10
833500 -- (-643.896) (-643.461) (-645.548) [-643.663] * (-641.900) [-641.841] (-643.049) (-642.707) -- 0:00:10
834000 -- (-644.052) (-643.014) (-643.440) [-642.178] * (-644.221) [-645.624] (-642.173) (-645.688) -- 0:00:10
834500 -- [-644.427] (-643.006) (-643.027) (-643.270) * (-642.830) (-643.766) (-642.539) [-647.096] -- 0:00:10
835000 -- (-644.946) [-642.535] (-643.990) (-644.288) * [-645.713] (-641.567) (-641.637) (-645.260) -- 0:00:10
Average standard deviation of split frequencies: 0.005461
835500 -- (-646.358) (-648.625) [-642.249] (-651.912) * (-643.836) [-643.717] (-644.191) (-646.679) -- 0:00:10
836000 -- (-648.391) [-640.270] (-640.588) (-641.672) * (-645.132) (-640.465) [-641.947] (-645.203) -- 0:00:10
836500 -- [-644.729] (-641.966) (-642.044) (-641.841) * (-643.002) (-644.663) [-644.177] (-648.078) -- 0:00:10
837000 -- (-642.659) [-640.059] (-642.716) (-645.253) * [-644.331] (-644.356) (-641.875) (-642.659) -- 0:00:10
837500 -- (-642.168) [-642.146] (-644.316) (-644.887) * (-641.814) (-642.643) [-642.347] (-644.509) -- 0:00:10
838000 -- (-642.809) (-642.529) (-642.580) [-640.277] * (-643.909) [-638.598] (-644.711) (-644.067) -- 0:00:10
838500 -- [-643.038] (-646.703) (-640.120) (-643.137) * (-643.458) [-643.863] (-644.575) (-643.563) -- 0:00:10
839000 -- (-641.904) [-644.237] (-641.265) (-647.103) * [-644.261] (-643.437) (-641.421) (-643.155) -- 0:00:10
839500 -- [-640.077] (-644.102) (-644.295) (-645.751) * [-641.899] (-644.236) (-640.736) (-641.935) -- 0:00:10
840000 -- (-643.573) (-642.811) (-642.402) [-645.655] * (-646.967) (-643.862) (-640.831) [-642.939] -- 0:00:10
Average standard deviation of split frequencies: 0.005548
840500 -- (-641.036) [-641.221] (-641.681) (-645.440) * [-643.221] (-641.168) (-643.887) (-643.257) -- 0:00:10
841000 -- (-640.228) (-644.294) [-641.638] (-642.825) * (-643.880) (-641.367) [-640.189] (-644.763) -- 0:00:10
841500 -- (-641.042) (-641.309) (-643.431) [-643.709] * (-643.854) (-642.647) (-640.551) [-640.625] -- 0:00:10
842000 -- (-641.702) (-645.151) [-642.453] (-643.062) * [-646.301] (-642.007) (-642.968) (-644.042) -- 0:00:10
842500 -- (-647.713) [-644.976] (-644.444) (-641.411) * [-639.477] (-641.675) (-641.383) (-644.392) -- 0:00:10
843000 -- (-640.049) [-642.342] (-640.810) (-641.853) * (-642.079) (-642.898) (-641.928) [-640.751] -- 0:00:10
843500 -- (-641.662) (-640.706) [-642.919] (-642.172) * (-642.598) (-642.843) [-642.839] (-640.909) -- 0:00:10
844000 -- (-641.797) (-644.571) (-641.427) [-643.294] * (-646.111) (-643.911) (-642.797) [-638.906] -- 0:00:09
844500 -- (-643.365) (-641.626) [-643.033] (-642.749) * (-640.680) (-642.270) (-642.979) [-641.593] -- 0:00:09
845000 -- [-642.163] (-641.610) (-643.120) (-645.566) * (-646.442) (-644.818) [-642.308] (-640.098) -- 0:00:09
Average standard deviation of split frequencies: 0.005660
845500 -- (-641.403) (-642.133) (-641.210) [-638.619] * (-640.390) (-644.358) [-642.176] (-643.632) -- 0:00:09
846000 -- (-644.080) (-641.850) [-643.070] (-642.497) * (-643.093) (-641.973) (-641.661) [-642.135] -- 0:00:09
846500 -- (-643.875) (-644.152) [-640.841] (-647.493) * (-641.738) (-641.551) [-643.451] (-640.460) -- 0:00:09
847000 -- (-644.952) (-644.361) [-641.421] (-643.106) * (-643.744) (-643.669) [-640.611] (-642.008) -- 0:00:09
847500 -- (-643.268) (-643.093) (-643.028) [-641.719] * (-643.489) (-641.669) (-645.042) [-644.230] -- 0:00:09
848000 -- (-642.812) (-641.821) [-641.872] (-641.513) * (-641.352) (-643.375) (-643.160) [-639.232] -- 0:00:09
848500 -- (-644.989) [-642.360] (-643.343) (-645.027) * [-641.412] (-642.768) (-643.423) (-644.602) -- 0:00:09
849000 -- (-642.381) (-642.125) (-643.388) [-642.562] * (-647.253) [-643.496] (-643.325) (-640.151) -- 0:00:09
849500 -- (-643.927) (-642.808) (-642.219) [-642.314] * (-648.111) (-650.204) [-642.143] (-642.106) -- 0:00:09
850000 -- [-641.056] (-644.040) (-640.233) (-642.512) * (-645.283) (-646.212) (-643.637) [-647.823] -- 0:00:09
Average standard deviation of split frequencies: 0.005454
850500 -- [-642.045] (-650.349) (-640.955) (-648.997) * [-642.383] (-645.162) (-643.758) (-641.583) -- 0:00:09
851000 -- (-641.580) [-640.646] (-642.729) (-643.685) * (-644.248) [-643.528] (-645.317) (-641.919) -- 0:00:09
851500 -- (-643.686) (-640.791) (-642.967) [-644.377] * [-641.615] (-643.264) (-642.499) (-642.080) -- 0:00:09
852000 -- (-645.228) [-641.547] (-644.046) (-652.826) * (-645.549) (-642.685) [-642.833] (-642.552) -- 0:00:09
852500 -- [-641.668] (-642.116) (-642.734) (-643.596) * (-643.302) (-643.837) (-643.632) [-644.328] -- 0:00:09
853000 -- (-644.742) [-640.407] (-644.402) (-642.090) * (-642.468) (-644.555) (-641.348) [-642.087] -- 0:00:09
853500 -- (-646.298) (-640.886) (-645.241) [-642.561] * [-642.254] (-641.819) (-644.814) (-646.267) -- 0:00:09
854000 -- (-645.240) (-638.869) (-641.620) [-642.660] * (-642.940) (-642.076) (-643.287) [-644.580] -- 0:00:09
854500 -- (-646.941) [-642.772] (-641.971) (-644.158) * (-642.247) [-645.223] (-642.711) (-644.005) -- 0:00:09
855000 -- (-643.870) (-642.356) [-640.381] (-646.160) * [-642.313] (-642.286) (-642.894) (-642.698) -- 0:00:09
Average standard deviation of split frequencies: 0.005449
855500 -- (-643.625) (-641.065) (-639.882) [-642.749] * (-642.501) [-644.210] (-642.490) (-641.589) -- 0:00:09
856000 -- (-644.014) (-641.052) [-643.279] (-645.724) * [-641.910] (-642.928) (-641.822) (-642.447) -- 0:00:09
856500 -- (-642.723) (-643.731) [-640.808] (-643.968) * [-639.415] (-644.818) (-642.411) (-640.311) -- 0:00:09
857000 -- (-644.177) (-641.881) [-641.650] (-644.405) * (-642.793) (-641.365) (-642.710) [-639.628] -- 0:00:09
857500 -- (-640.587) (-641.787) [-641.843] (-643.203) * (-641.980) [-643.068] (-643.032) (-643.040) -- 0:00:09
858000 -- (-642.750) [-639.022] (-641.357) (-643.404) * (-644.843) [-642.760] (-645.655) (-645.968) -- 0:00:09
858500 -- (-643.855) (-640.800) (-642.459) [-645.691] * [-642.063] (-642.252) (-642.476) (-644.871) -- 0:00:09
859000 -- (-644.056) (-646.016) [-642.048] (-647.650) * (-646.478) [-643.440] (-641.789) (-641.011) -- 0:00:09
859500 -- [-642.590] (-642.143) (-642.102) (-642.840) * [-639.196] (-645.402) (-643.451) (-643.131) -- 0:00:08
860000 -- (-644.794) (-640.677) [-641.169] (-643.350) * (-641.634) (-643.434) [-642.853] (-641.822) -- 0:00:08
Average standard deviation of split frequencies: 0.005448
860500 -- (-642.616) (-647.463) (-643.835) [-642.007] * (-644.363) [-641.879] (-642.994) (-643.755) -- 0:00:08
861000 -- (-642.905) (-642.529) (-643.735) [-643.458] * (-643.902) (-645.119) (-642.650) [-643.366] -- 0:00:08
861500 -- (-648.468) (-643.344) [-643.018] (-643.075) * (-641.761) [-643.454] (-640.553) (-644.701) -- 0:00:08
862000 -- (-648.453) [-642.677] (-644.508) (-642.359) * (-642.455) (-644.008) (-642.396) [-642.837] -- 0:00:08
862500 -- [-648.523] (-642.149) (-644.442) (-643.532) * (-642.696) [-642.534] (-641.888) (-643.290) -- 0:00:08
863000 -- (-648.073) (-646.842) [-642.653] (-644.017) * [-641.810] (-642.387) (-642.382) (-644.430) -- 0:00:08
863500 -- (-643.870) (-643.860) [-641.088] (-644.159) * [-645.229] (-644.858) (-642.925) (-643.843) -- 0:00:08
864000 -- (-645.528) [-646.228] (-643.842) (-644.423) * (-646.185) (-644.493) [-641.575] (-641.112) -- 0:00:08
864500 -- (-647.997) [-645.125] (-644.711) (-642.171) * [-640.497] (-646.349) (-641.226) (-644.240) -- 0:00:08
865000 -- [-642.534] (-645.701) (-644.128) (-643.739) * (-647.644) [-643.130] (-642.572) (-644.612) -- 0:00:08
Average standard deviation of split frequencies: 0.005472
865500 -- [-644.198] (-644.004) (-645.238) (-645.900) * [-640.435] (-642.996) (-642.526) (-642.840) -- 0:00:08
866000 -- (-639.716) (-642.486) (-643.794) [-644.039] * (-642.072) (-643.339) (-642.812) [-646.150] -- 0:00:08
866500 -- (-640.546) [-645.800] (-645.207) (-642.804) * (-643.371) (-646.402) [-644.952] (-642.459) -- 0:00:08
867000 -- (-643.154) (-645.171) (-645.012) [-644.503] * (-644.549) [-644.713] (-642.590) (-642.772) -- 0:00:08
867500 -- (-642.083) (-653.907) (-643.797) [-642.227] * (-642.389) [-642.948] (-643.311) (-647.885) -- 0:00:08
868000 -- (-642.163) (-646.229) [-642.709] (-641.793) * (-640.966) (-642.622) (-643.897) [-640.016] -- 0:00:08
868500 -- (-641.302) [-642.604] (-642.418) (-643.774) * (-641.908) [-642.746] (-643.531) (-641.442) -- 0:00:08
869000 -- [-643.093] (-642.868) (-641.917) (-643.710) * [-640.805] (-643.395) (-642.293) (-641.270) -- 0:00:08
869500 -- (-645.108) [-643.021] (-645.283) (-642.347) * (-641.554) (-642.426) (-644.659) [-645.380] -- 0:00:08
870000 -- [-643.982] (-644.298) (-643.544) (-643.800) * (-643.200) (-643.284) [-641.463] (-643.025) -- 0:00:08
Average standard deviation of split frequencies: 0.005813
870500 -- (-642.738) (-643.714) (-644.033) [-642.025] * (-641.153) (-642.644) (-641.738) [-642.958] -- 0:00:08
871000 -- [-643.613] (-641.388) (-645.835) (-644.771) * (-640.850) (-642.907) [-641.065] (-644.178) -- 0:00:08
871500 -- (-645.503) [-643.878] (-643.219) (-642.404) * [-641.543] (-643.684) (-641.448) (-643.034) -- 0:00:08
872000 -- (-639.582) (-643.050) [-642.787] (-645.435) * [-642.760] (-641.624) (-641.797) (-646.414) -- 0:00:08
872500 -- (-643.710) (-644.859) (-642.713) [-645.738] * (-640.563) (-642.709) [-641.902] (-645.924) -- 0:00:08
873000 -- (-645.158) [-648.095] (-642.041) (-645.942) * [-642.792] (-642.721) (-644.898) (-642.812) -- 0:00:08
873500 -- [-643.921] (-643.466) (-642.507) (-647.617) * (-643.897) (-642.322) [-642.708] (-643.227) -- 0:00:08
874000 -- (-643.477) (-645.510) [-644.608] (-641.667) * (-642.721) (-645.807) [-643.291] (-643.459) -- 0:00:08
874500 -- (-641.965) (-642.787) (-644.458) [-641.779] * [-643.838] (-645.075) (-644.418) (-646.143) -- 0:00:08
875000 -- (-642.595) [-643.321] (-644.269) (-644.830) * [-644.074] (-642.025) (-644.173) (-646.671) -- 0:00:08
Average standard deviation of split frequencies: 0.005778
875500 -- (-645.052) (-642.318) [-641.249] (-642.328) * [-644.532] (-643.463) (-642.036) (-645.633) -- 0:00:07
876000 -- [-643.450] (-643.158) (-643.393) (-641.845) * [-642.540] (-641.902) (-642.862) (-645.453) -- 0:00:07
876500 -- (-646.661) (-642.278) (-642.619) [-640.400] * [-644.191] (-642.720) (-642.017) (-644.108) -- 0:00:07
877000 -- [-644.070] (-642.964) (-643.262) (-642.029) * (-642.585) [-642.333] (-641.617) (-642.936) -- 0:00:07
877500 -- (-642.973) (-642.688) (-644.765) [-642.847] * (-647.344) (-643.013) [-643.727] (-643.825) -- 0:00:07
878000 -- (-644.510) [-644.282] (-645.565) (-647.048) * (-643.741) (-642.199) (-643.510) [-644.180] -- 0:00:07
878500 -- (-644.052) (-645.717) (-643.152) [-645.683] * (-642.359) [-642.265] (-642.681) (-643.253) -- 0:00:07
879000 -- (-645.076) [-644.230] (-642.762) (-643.925) * (-641.064) [-643.714] (-643.047) (-641.071) -- 0:00:07
879500 -- (-643.539) (-643.448) [-642.330] (-642.129) * [-641.428] (-641.590) (-640.466) (-644.217) -- 0:00:07
880000 -- [-644.241] (-642.588) (-648.461) (-643.661) * (-644.286) [-640.275] (-644.754) (-643.448) -- 0:00:07
Average standard deviation of split frequencies: 0.005691
880500 -- [-642.656] (-642.615) (-642.470) (-641.386) * (-644.064) [-642.878] (-643.894) (-641.805) -- 0:00:07
881000 -- (-641.722) (-642.406) (-642.883) [-643.496] * (-645.830) (-644.022) (-640.742) [-642.498] -- 0:00:07
881500 -- (-643.415) [-646.599] (-644.421) (-646.557) * [-639.849] (-641.393) (-642.839) (-642.920) -- 0:00:07
882000 -- (-643.323) (-643.905) (-644.523) [-644.743] * (-641.569) [-641.867] (-642.633) (-642.958) -- 0:00:07
882500 -- (-642.702) (-643.052) (-642.805) [-643.994] * (-641.588) (-642.391) (-645.299) [-643.711] -- 0:00:07
883000 -- [-646.067] (-646.651) (-641.584) (-643.533) * [-644.652] (-642.114) (-643.265) (-643.277) -- 0:00:07
883500 -- (-643.176) (-645.965) (-642.403) [-643.278] * (-642.631) [-646.480] (-641.617) (-643.884) -- 0:00:07
884000 -- (-643.155) (-642.835) (-644.945) [-643.691] * (-642.134) [-642.308] (-642.595) (-644.252) -- 0:00:07
884500 -- (-642.400) (-644.165) (-643.830) [-643.034] * (-641.479) (-643.823) (-641.617) [-643.397] -- 0:00:07
885000 -- [-642.215] (-645.415) (-642.273) (-642.152) * (-641.988) [-643.962] (-644.426) (-643.573) -- 0:00:07
Average standard deviation of split frequencies: 0.005853
885500 -- (-641.510) (-646.826) [-644.552] (-642.016) * [-644.013] (-643.297) (-640.845) (-643.545) -- 0:00:07
886000 -- (-648.051) (-646.088) (-645.350) [-642.772] * (-644.299) (-643.266) [-645.037] (-640.838) -- 0:00:07
886500 -- (-647.604) (-642.147) [-648.000] (-643.515) * (-641.666) [-642.262] (-640.963) (-644.171) -- 0:00:07
887000 -- (-644.953) [-641.690] (-644.303) (-644.056) * (-647.877) (-642.915) [-640.293] (-643.921) -- 0:00:07
887500 -- (-648.731) [-639.589] (-640.978) (-641.636) * (-639.683) (-643.182) (-643.023) [-641.809] -- 0:00:07
888000 -- (-640.512) (-644.449) [-640.433] (-645.432) * [-643.220] (-642.154) (-644.440) (-642.114) -- 0:00:07
888500 -- (-643.297) (-642.201) (-641.676) [-645.517] * (-643.653) (-643.154) [-641.848] (-642.054) -- 0:00:07
889000 -- (-642.364) (-641.661) [-644.033] (-643.354) * [-644.072] (-644.559) (-642.387) (-643.812) -- 0:00:07
889500 -- (-643.043) (-643.734) [-642.616] (-641.687) * (-646.677) [-641.918] (-640.350) (-642.874) -- 0:00:07
890000 -- (-642.963) (-642.961) (-645.144) [-640.975] * (-646.531) (-640.654) (-642.534) [-640.048] -- 0:00:07
Average standard deviation of split frequencies: 0.005711
890500 -- (-643.419) [-640.924] (-643.816) (-648.132) * [-641.534] (-644.444) (-645.010) (-641.995) -- 0:00:07
891000 -- (-643.126) (-648.035) (-642.266) [-646.127] * (-641.714) (-644.759) (-643.761) [-642.142] -- 0:00:06
891500 -- (-642.329) [-642.731] (-641.341) (-643.549) * (-642.295) (-642.861) (-642.694) [-644.083] -- 0:00:06
892000 -- (-641.112) (-646.491) (-642.490) [-642.999] * (-642.026) (-643.774) (-641.656) [-644.469] -- 0:00:06
892500 -- [-640.541] (-643.412) (-642.889) (-643.964) * [-645.392] (-643.574) (-645.051) (-642.158) -- 0:00:06
893000 -- [-641.767] (-651.015) (-643.986) (-641.910) * (-644.603) (-640.781) (-643.736) [-642.383] -- 0:00:06
893500 -- (-643.060) (-647.551) (-646.487) [-644.443] * (-642.014) (-642.158) (-646.134) [-643.312] -- 0:00:06
894000 -- (-648.324) [-642.063] (-645.682) (-645.955) * [-639.757] (-640.053) (-645.263) (-643.635) -- 0:00:06
894500 -- (-644.146) (-643.817) [-642.101] (-643.508) * (-641.784) (-646.197) (-641.710) [-644.443] -- 0:00:06
895000 -- (-641.191) (-640.028) [-640.325] (-643.198) * [-642.252] (-645.555) (-642.720) (-645.703) -- 0:00:06
Average standard deviation of split frequencies: 0.005870
895500 -- (-641.089) (-642.535) (-642.353) [-642.783] * (-643.015) (-645.131) (-643.599) [-642.976] -- 0:00:06
896000 -- (-641.146) (-643.252) (-644.007) [-648.456] * (-646.280) (-643.220) (-640.762) [-643.541] -- 0:00:06
896500 -- [-642.412] (-642.324) (-645.230) (-648.925) * (-642.697) [-643.730] (-643.695) (-641.281) -- 0:00:06
897000 -- (-643.622) [-641.765] (-643.527) (-643.971) * (-644.495) [-644.851] (-644.635) (-642.102) -- 0:00:06
897500 -- [-640.864] (-646.407) (-644.251) (-642.168) * [-643.282] (-648.568) (-646.315) (-642.392) -- 0:00:06
898000 -- [-643.215] (-646.774) (-642.329) (-642.029) * (-647.629) (-641.061) (-642.209) [-640.842] -- 0:00:06
898500 -- [-644.106] (-642.492) (-642.212) (-642.658) * (-642.940) (-643.503) (-642.486) [-644.119] -- 0:00:06
899000 -- (-645.106) (-641.885) [-642.410] (-641.241) * (-642.348) [-644.656] (-646.423) (-642.454) -- 0:00:06
899500 -- (-643.902) (-641.312) (-640.421) [-644.310] * (-642.930) (-642.669) (-642.112) [-643.691] -- 0:00:06
900000 -- (-642.568) (-641.575) [-643.020] (-644.608) * (-643.046) (-647.047) [-647.025] (-640.508) -- 0:00:06
Average standard deviation of split frequencies: 0.005427
900500 -- [-641.476] (-641.179) (-642.538) (-642.446) * [-643.955] (-644.307) (-647.077) (-642.103) -- 0:00:06
901000 -- (-644.777) (-643.210) [-643.120] (-645.859) * (-643.782) (-643.501) [-642.619] (-641.601) -- 0:00:06
901500 -- (-641.694) (-644.132) [-641.274] (-640.369) * (-644.288) (-641.538) (-647.170) [-642.601] -- 0:00:06
902000 -- (-643.104) (-651.515) (-641.073) [-643.831] * [-642.045] (-643.210) (-642.255) (-642.666) -- 0:00:06
902500 -- (-641.304) (-642.457) (-642.647) [-640.504] * [-640.354] (-642.478) (-644.627) (-639.660) -- 0:00:06
903000 -- [-641.845] (-642.411) (-645.065) (-641.907) * (-641.686) (-642.803) (-646.219) [-642.360] -- 0:00:06
903500 -- [-640.924] (-642.146) (-643.573) (-640.201) * (-643.374) (-641.731) [-641.964] (-647.894) -- 0:00:06
904000 -- (-645.889) (-639.797) [-642.197] (-644.081) * (-643.484) [-644.718] (-642.102) (-643.957) -- 0:00:06
904500 -- [-640.738] (-642.041) (-648.803) (-643.088) * (-647.243) (-643.739) (-644.746) [-644.662] -- 0:00:06
905000 -- (-642.913) [-641.232] (-645.724) (-642.044) * [-641.473] (-644.053) (-645.610) (-642.863) -- 0:00:06
Average standard deviation of split frequencies: 0.005203
905500 -- (-642.023) [-645.685] (-644.595) (-644.259) * [-641.440] (-640.951) (-644.201) (-644.846) -- 0:00:06
906000 -- (-640.668) (-652.706) [-644.136] (-642.414) * [-641.972] (-643.711) (-643.303) (-643.387) -- 0:00:06
906500 -- (-640.787) [-647.858] (-642.670) (-642.319) * [-642.578] (-642.117) (-641.698) (-642.258) -- 0:00:05
907000 -- [-641.821] (-642.642) (-642.569) (-643.845) * (-643.105) (-645.081) (-641.646) [-643.119] -- 0:00:05
907500 -- [-638.871] (-641.193) (-642.689) (-645.331) * (-647.167) (-644.830) (-639.882) [-642.952] -- 0:00:05
908000 -- (-641.551) (-641.000) (-643.235) [-641.858] * (-644.965) (-643.710) [-643.253] (-645.354) -- 0:00:05
908500 -- [-640.309] (-642.748) (-641.876) (-643.405) * (-646.812) [-644.446] (-643.276) (-643.439) -- 0:00:05
909000 -- (-642.958) (-641.797) [-642.462] (-644.141) * [-643.832] (-641.380) (-643.790) (-640.826) -- 0:00:05
909500 -- (-640.288) (-643.650) [-644.136] (-643.306) * (-650.592) [-643.147] (-643.195) (-640.816) -- 0:00:05
910000 -- (-641.731) (-640.222) [-642.081] (-643.071) * (-645.568) (-643.376) [-641.126] (-641.814) -- 0:00:05
Average standard deviation of split frequencies: 0.005394
910500 -- (-644.111) [-644.030] (-643.625) (-642.986) * (-644.458) (-649.049) (-641.854) [-642.919] -- 0:00:05
911000 -- [-647.472] (-640.648) (-646.031) (-643.371) * (-643.806) (-644.521) (-642.821) [-644.041] -- 0:00:05
911500 -- (-650.197) (-641.188) [-643.432] (-643.273) * [-644.134] (-647.810) (-639.920) (-645.909) -- 0:00:05
912000 -- (-647.620) [-641.533] (-641.371) (-642.494) * (-641.687) (-642.751) (-643.248) [-645.092] -- 0:00:05
912500 -- (-646.654) (-641.860) (-640.718) [-643.354] * (-641.663) (-642.481) (-648.245) [-642.397] -- 0:00:05
913000 -- (-641.588) (-642.797) [-640.699] (-642.497) * (-646.242) (-641.041) (-644.904) [-642.605] -- 0:00:05
913500 -- [-644.755] (-642.160) (-644.573) (-644.916) * (-644.503) (-639.950) [-642.846] (-644.084) -- 0:00:05
914000 -- (-644.215) (-641.838) (-644.256) [-642.831] * (-642.651) (-643.105) (-640.092) [-641.218] -- 0:00:05
914500 -- (-644.341) [-641.765] (-641.232) (-642.558) * (-642.045) [-644.353] (-644.176) (-642.219) -- 0:00:05
915000 -- (-642.396) (-642.863) [-642.317] (-643.993) * (-643.560) (-641.871) [-641.393] (-642.196) -- 0:00:05
Average standard deviation of split frequencies: 0.005065
915500 -- (-642.421) (-642.827) [-644.640] (-648.092) * (-642.206) (-640.737) [-643.613] (-641.823) -- 0:00:05
916000 -- (-644.295) (-649.670) (-644.357) [-648.678] * [-639.068] (-639.029) (-642.970) (-642.386) -- 0:00:05
916500 -- (-644.763) [-643.824] (-647.913) (-642.562) * (-641.113) [-640.971] (-641.865) (-640.996) -- 0:00:05
917000 -- (-643.907) [-641.711] (-646.571) (-644.762) * (-643.424) (-645.842) [-642.948] (-643.957) -- 0:00:05
917500 -- (-642.964) (-647.098) [-647.178] (-649.810) * (-643.885) [-641.068] (-644.184) (-642.155) -- 0:00:05
918000 -- (-642.234) (-642.795) [-642.131] (-644.074) * (-641.739) [-646.215] (-643.075) (-644.740) -- 0:00:05
918500 -- (-641.103) (-649.678) (-643.508) [-642.665] * (-642.892) [-645.121] (-643.142) (-643.035) -- 0:00:05
919000 -- (-644.685) [-641.700] (-643.401) (-641.856) * (-641.743) (-642.831) [-644.826] (-639.233) -- 0:00:05
919500 -- (-644.500) [-645.868] (-640.641) (-642.930) * (-641.974) (-642.425) (-642.543) [-645.577] -- 0:00:05
920000 -- [-640.974] (-646.763) (-642.915) (-644.502) * (-643.784) (-643.126) (-642.177) [-643.333] -- 0:00:05
Average standard deviation of split frequencies: 0.005120
920500 -- (-641.544) [-643.877] (-642.488) (-641.909) * (-641.046) (-641.247) (-642.019) [-644.874] -- 0:00:05
921000 -- (-642.398) (-642.093) (-642.919) [-647.859] * (-641.296) (-641.471) [-642.449] (-642.778) -- 0:00:05
921500 -- [-641.606] (-640.138) (-646.070) (-645.574) * [-641.780] (-641.732) (-644.719) (-642.976) -- 0:00:05
922000 -- (-641.311) [-642.873] (-641.239) (-643.478) * [-642.693] (-641.488) (-641.656) (-644.110) -- 0:00:04
922500 -- (-641.600) (-643.073) (-641.093) [-641.631] * (-640.214) [-641.866] (-641.691) (-643.560) -- 0:00:04
923000 -- (-642.197) (-642.997) [-641.561] (-639.895) * (-642.135) (-641.210) (-641.949) [-644.676] -- 0:00:04
923500 -- (-645.951) (-642.767) (-644.276) [-642.514] * [-643.404] (-644.980) (-645.719) (-644.106) -- 0:00:04
924000 -- [-642.837] (-644.269) (-647.508) (-643.173) * (-640.813) (-638.695) (-640.446) [-643.398] -- 0:00:04
924500 -- (-639.780) [-642.163] (-641.432) (-643.465) * (-643.994) [-642.063] (-641.090) (-641.300) -- 0:00:04
925000 -- (-642.506) (-644.017) [-642.542] (-642.257) * (-646.205) (-643.370) [-640.056] (-642.297) -- 0:00:04
Average standard deviation of split frequencies: 0.005466
925500 -- [-643.483] (-642.697) (-643.307) (-644.521) * [-643.161] (-643.511) (-642.060) (-643.812) -- 0:00:04
926000 -- (-645.192) [-643.929] (-646.066) (-644.373) * (-641.935) [-641.599] (-642.793) (-645.012) -- 0:00:04
926500 -- (-643.941) [-642.792] (-645.808) (-644.455) * (-642.905) (-640.834) [-640.240] (-645.408) -- 0:00:04
927000 -- (-642.459) (-641.539) (-642.797) [-644.227] * (-643.893) (-642.131) [-641.534] (-643.971) -- 0:00:04
927500 -- (-644.527) [-641.088] (-643.260) (-642.743) * [-643.483] (-643.785) (-641.360) (-642.265) -- 0:00:04
928000 -- (-643.927) (-643.936) [-642.021] (-644.792) * (-642.718) [-642.682] (-641.497) (-642.681) -- 0:00:04
928500 -- (-644.710) (-643.656) (-643.615) [-641.571] * [-641.098] (-642.598) (-644.266) (-646.275) -- 0:00:04
929000 -- (-645.618) [-644.187] (-644.075) (-639.792) * (-647.038) (-642.543) (-642.550) [-644.256] -- 0:00:04
929500 -- (-646.387) (-641.966) [-642.922] (-642.668) * [-641.727] (-643.998) (-643.219) (-640.048) -- 0:00:04
930000 -- (-642.347) [-640.626] (-642.700) (-642.022) * [-642.357] (-645.419) (-644.856) (-642.013) -- 0:00:04
Average standard deviation of split frequencies: 0.005785
930500 -- [-643.151] (-641.574) (-647.226) (-642.170) * (-640.209) [-642.332] (-643.818) (-642.369) -- 0:00:04
931000 -- (-641.839) [-640.575] (-647.283) (-643.787) * [-644.412] (-642.170) (-641.777) (-642.483) -- 0:00:04
931500 -- (-641.953) (-643.015) (-642.956) [-642.201] * (-643.236) (-643.513) [-639.828] (-642.084) -- 0:00:04
932000 -- [-640.876] (-641.532) (-643.147) (-642.693) * (-643.513) (-644.241) (-641.886) [-644.483] -- 0:00:04
932500 -- (-641.856) (-645.463) [-642.635] (-642.088) * [-642.482] (-643.822) (-644.257) (-644.513) -- 0:00:04
933000 -- (-643.948) [-642.768] (-643.205) (-641.989) * [-642.825] (-643.201) (-641.543) (-643.826) -- 0:00:04
933500 -- (-642.111) [-641.246] (-644.383) (-642.655) * (-642.840) (-643.612) (-640.221) [-641.844] -- 0:00:04
934000 -- (-641.231) [-642.128] (-642.429) (-645.913) * (-642.210) (-644.127) (-641.917) [-642.862] -- 0:00:04
934500 -- (-642.238) (-644.986) [-641.492] (-641.293) * (-647.970) [-642.407] (-640.819) (-644.125) -- 0:00:04
935000 -- (-642.430) (-643.739) (-643.501) [-642.253] * [-642.320] (-640.363) (-644.216) (-642.500) -- 0:00:04
Average standard deviation of split frequencies: 0.005752
935500 -- (-642.508) [-644.279] (-643.197) (-642.782) * (-645.008) (-642.549) [-644.428] (-644.375) -- 0:00:04
936000 -- (-643.627) [-640.609] (-644.087) (-642.352) * (-642.761) (-654.122) [-640.568] (-645.455) -- 0:00:04
936500 -- (-643.529) (-642.681) [-642.508] (-642.509) * (-641.963) (-648.356) [-643.039] (-642.956) -- 0:00:04
937000 -- (-643.668) [-642.359] (-644.841) (-649.262) * (-644.849) (-648.723) [-642.358] (-646.645) -- 0:00:04
937500 -- (-643.830) (-644.411) [-642.583] (-642.730) * (-643.233) (-647.067) (-645.403) [-650.743] -- 0:00:04
938000 -- (-646.018) (-645.019) [-642.308] (-646.550) * (-638.992) (-642.254) (-642.677) [-648.055] -- 0:00:03
938500 -- (-642.287) (-645.887) [-643.604] (-641.570) * (-642.443) [-641.713] (-643.298) (-645.628) -- 0:00:03
939000 -- (-643.409) (-642.064) (-641.272) [-644.630] * [-641.923] (-642.395) (-641.775) (-651.566) -- 0:00:03
939500 -- [-642.637] (-642.920) (-643.600) (-644.585) * (-640.791) [-644.273] (-642.437) (-642.371) -- 0:00:03
940000 -- (-647.331) [-640.940] (-645.082) (-643.029) * (-643.694) (-642.121) [-645.265] (-644.702) -- 0:00:03
Average standard deviation of split frequencies: 0.005855
940500 -- (-644.590) [-643.031] (-642.944) (-642.688) * (-643.962) [-640.671] (-647.461) (-642.047) -- 0:00:03
941000 -- (-643.271) (-641.611) [-639.460] (-644.648) * (-642.424) (-643.965) (-644.592) [-644.154] -- 0:00:03
941500 -- (-642.623) [-641.533] (-640.684) (-642.196) * [-642.808] (-641.205) (-642.394) (-644.548) -- 0:00:03
942000 -- (-645.412) [-645.273] (-642.389) (-641.868) * (-643.173) (-643.084) [-643.695] (-642.446) -- 0:00:03
942500 -- [-642.434] (-641.799) (-642.007) (-643.236) * (-642.558) (-642.809) (-642.415) [-640.642] -- 0:00:03
943000 -- (-642.916) (-641.868) (-643.309) [-643.833] * (-643.441) [-642.870] (-642.400) (-640.793) -- 0:00:03
943500 -- (-642.582) (-642.055) (-643.155) [-643.986] * (-640.474) (-642.967) (-643.465) [-642.147] -- 0:00:03
944000 -- (-641.071) [-643.262] (-641.813) (-643.834) * (-645.034) (-641.408) (-643.166) [-641.319] -- 0:00:03
944500 -- (-643.913) (-642.741) (-639.712) [-643.844] * (-640.117) (-640.203) [-643.452] (-641.139) -- 0:00:03
945000 -- [-639.535] (-642.168) (-641.704) (-642.152) * (-644.120) (-640.728) [-644.278] (-642.919) -- 0:00:03
Average standard deviation of split frequencies: 0.006032
945500 -- (-643.872) (-641.757) [-640.621] (-643.035) * [-643.014] (-643.682) (-643.730) (-641.912) -- 0:00:03
946000 -- (-644.395) [-643.895] (-640.375) (-642.409) * [-643.143] (-642.057) (-644.650) (-642.238) -- 0:00:03
946500 -- (-642.671) (-642.489) (-640.484) [-641.824] * (-645.370) [-641.983] (-644.784) (-645.183) -- 0:00:03
947000 -- (-643.003) [-642.497] (-645.017) (-640.555) * (-644.927) [-640.324] (-643.758) (-640.528) -- 0:00:03
947500 -- (-641.819) (-642.264) (-642.620) [-641.547] * [-642.907] (-643.119) (-644.633) (-642.852) -- 0:00:03
948000 -- (-645.447) (-641.433) [-642.911] (-644.280) * (-641.705) (-642.301) (-646.207) [-641.788] -- 0:00:03
948500 -- [-644.553] (-642.768) (-641.649) (-642.027) * (-644.525) [-642.060] (-644.349) (-638.541) -- 0:00:03
949000 -- [-642.384] (-641.157) (-644.588) (-643.490) * (-644.449) (-640.661) [-641.868] (-643.991) -- 0:00:03
949500 -- (-645.521) [-642.098] (-641.538) (-641.294) * [-644.461] (-641.785) (-644.339) (-644.785) -- 0:00:03
950000 -- (-645.003) (-642.801) [-643.806] (-641.564) * (-643.781) (-646.899) (-644.389) [-643.848] -- 0:00:03
Average standard deviation of split frequencies: 0.005898
950500 -- [-642.115] (-642.859) (-644.102) (-644.310) * (-644.692) (-645.876) [-642.617] (-646.997) -- 0:00:03
951000 -- (-642.347) [-642.053] (-646.182) (-643.288) * [-639.795] (-648.321) (-643.735) (-648.465) -- 0:00:03
951500 -- [-642.037] (-644.063) (-641.963) (-642.305) * (-643.236) [-644.012] (-642.625) (-648.496) -- 0:00:03
952000 -- [-642.446] (-643.312) (-642.821) (-648.025) * (-647.221) (-644.801) (-642.333) [-645.752] -- 0:00:03
952500 -- (-645.012) (-643.492) (-642.189) [-642.967] * (-641.379) (-641.639) (-642.682) [-646.467] -- 0:00:03
953000 -- [-643.628] (-642.909) (-642.886) (-642.838) * (-641.777) (-642.887) [-641.554] (-642.302) -- 0:00:03
953500 -- (-641.196) [-643.074] (-643.639) (-643.799) * (-642.308) (-643.719) [-642.533] (-641.881) -- 0:00:02
954000 -- (-641.915) (-644.202) [-643.406] (-642.169) * [-639.346] (-645.242) (-641.892) (-647.563) -- 0:00:02
954500 -- (-643.724) (-643.742) [-642.018] (-640.753) * (-642.559) (-643.736) [-645.448] (-643.434) -- 0:00:02
955000 -- (-642.784) [-642.967] (-646.015) (-641.322) * (-643.206) (-642.391) [-645.868] (-640.350) -- 0:00:02
Average standard deviation of split frequencies: 0.006047
955500 -- (-642.094) (-644.729) (-647.610) [-640.824] * (-642.397) (-642.336) [-642.190] (-643.722) -- 0:00:02
956000 -- [-641.364] (-641.415) (-643.046) (-639.787) * [-642.061] (-646.089) (-642.828) (-643.704) -- 0:00:02
956500 -- (-643.885) (-644.524) (-650.944) [-640.795] * (-641.561) (-644.493) (-642.500) [-642.831] -- 0:00:02
957000 -- [-643.282] (-649.666) (-643.267) (-643.495) * [-644.004] (-641.656) (-642.084) (-641.397) -- 0:00:02
957500 -- [-641.924] (-651.515) (-642.315) (-643.412) * [-642.449] (-641.703) (-641.373) (-640.369) -- 0:00:02
958000 -- (-642.461) [-641.000] (-642.658) (-641.830) * [-646.030] (-643.488) (-647.193) (-639.470) -- 0:00:02
958500 -- (-645.069) (-640.267) [-643.203] (-642.310) * (-642.661) (-645.662) (-645.007) [-641.004] -- 0:00:02
959000 -- (-644.811) (-642.253) (-644.371) [-643.599] * (-641.784) (-642.381) (-647.924) [-643.195] -- 0:00:02
959500 -- (-643.481) (-642.291) [-642.221] (-643.265) * (-645.805) (-642.290) (-641.290) [-643.935] -- 0:00:02
960000 -- (-646.843) [-641.366] (-643.781) (-645.592) * (-641.275) [-641.740] (-642.068) (-644.600) -- 0:00:02
Average standard deviation of split frequencies: 0.005992
960500 -- [-644.206] (-644.289) (-640.975) (-643.255) * (-641.671) (-642.614) [-642.207] (-642.962) -- 0:00:02
961000 -- [-642.218] (-640.747) (-641.998) (-645.181) * (-643.012) [-640.780] (-643.401) (-642.883) -- 0:00:02
961500 -- (-642.744) (-643.152) [-642.931] (-642.610) * (-642.861) (-644.296) (-641.704) [-643.682] -- 0:00:02
962000 -- (-646.465) (-641.952) [-640.670] (-641.331) * (-642.591) [-641.282] (-640.836) (-645.493) -- 0:00:02
962500 -- (-641.558) [-642.737] (-643.245) (-642.456) * (-645.267) (-641.147) (-641.471) [-645.403] -- 0:00:02
963000 -- (-643.827) [-643.810] (-642.657) (-643.078) * (-643.018) (-642.829) [-642.870] (-642.043) -- 0:00:02
963500 -- [-643.870] (-645.996) (-645.179) (-642.343) * (-642.496) (-642.220) [-639.484] (-641.688) -- 0:00:02
964000 -- (-642.874) (-644.318) [-641.838] (-638.677) * (-643.538) [-641.718] (-640.758) (-642.708) -- 0:00:02
964500 -- (-641.045) (-643.098) (-642.515) [-642.481] * (-644.222) (-640.670) (-640.272) [-644.285] -- 0:00:02
965000 -- (-642.530) (-643.564) (-644.688) [-641.192] * (-647.548) [-645.509] (-642.605) (-642.997) -- 0:00:02
Average standard deviation of split frequencies: 0.005984
965500 -- (-643.047) (-641.729) [-645.208] (-641.538) * (-642.578) (-646.027) [-639.454] (-642.202) -- 0:00:02
966000 -- [-644.125] (-644.039) (-644.291) (-641.170) * [-643.901] (-644.174) (-644.915) (-642.577) -- 0:00:02
966500 -- (-648.120) (-642.994) [-642.450] (-642.765) * [-643.230] (-643.315) (-644.693) (-644.487) -- 0:00:02
967000 -- [-641.906] (-644.000) (-644.971) (-641.978) * (-646.759) (-641.660) [-643.617] (-645.199) -- 0:00:02
967500 -- (-643.569) [-641.431] (-641.209) (-643.497) * (-643.738) (-642.923) [-643.289] (-646.650) -- 0:00:02
968000 -- [-643.140] (-639.213) (-641.058) (-639.717) * (-644.091) (-643.893) (-640.887) [-641.606] -- 0:00:02
968500 -- (-640.341) (-640.120) [-643.168] (-639.759) * (-643.477) (-644.115) (-642.711) [-644.089] -- 0:00:02
969000 -- [-642.766] (-641.474) (-643.343) (-640.804) * [-644.040] (-642.960) (-640.382) (-641.534) -- 0:00:01
969500 -- (-642.360) [-638.473] (-642.870) (-644.386) * (-643.148) [-642.953] (-640.870) (-648.171) -- 0:00:01
970000 -- [-642.498] (-641.562) (-641.890) (-640.482) * (-644.273) (-645.625) [-645.808] (-644.205) -- 0:00:01
Average standard deviation of split frequencies: 0.006007
970500 -- [-641.877] (-643.308) (-642.850) (-644.581) * (-643.566) (-644.592) [-642.358] (-641.706) -- 0:00:01
971000 -- (-641.937) (-639.771) [-639.343] (-642.341) * (-644.048) (-645.011) (-641.592) [-645.170] -- 0:00:01
971500 -- (-641.230) [-639.668] (-642.741) (-644.142) * (-644.810) (-641.908) (-641.876) [-641.615] -- 0:00:01
972000 -- (-644.446) (-642.699) (-642.782) [-642.352] * (-643.458) (-644.569) [-643.667] (-642.322) -- 0:00:01
972500 -- [-641.809] (-642.436) (-641.971) (-643.922) * (-640.955) [-640.369] (-644.902) (-643.871) -- 0:00:01
973000 -- (-641.170) (-642.563) [-640.239] (-646.379) * [-643.099] (-641.818) (-642.066) (-643.842) -- 0:00:01
973500 -- (-641.853) [-644.233] (-643.277) (-643.318) * [-644.808] (-643.419) (-643.498) (-645.629) -- 0:00:01
974000 -- (-641.090) [-640.247] (-644.465) (-645.362) * (-641.184) (-642.220) [-645.008] (-643.319) -- 0:00:01
974500 -- (-641.502) (-642.647) (-642.835) [-641.492] * [-644.469] (-647.265) (-652.047) (-647.404) -- 0:00:01
975000 -- [-648.996] (-643.071) (-640.617) (-644.559) * (-644.540) (-644.836) (-645.504) [-644.075] -- 0:00:01
Average standard deviation of split frequencies: 0.005898
975500 -- (-642.252) (-641.566) (-642.131) [-642.954] * (-644.208) (-641.677) (-645.896) [-643.572] -- 0:00:01
976000 -- (-641.983) (-642.222) (-643.343) [-643.229] * (-650.271) (-641.955) (-644.509) [-644.612] -- 0:00:01
976500 -- (-641.532) (-643.456) [-641.677] (-642.583) * [-642.455] (-642.246) (-645.149) (-641.898) -- 0:00:01
977000 -- (-642.170) (-642.066) [-642.965] (-639.845) * (-642.459) (-642.778) [-642.345] (-643.467) -- 0:00:01
977500 -- (-640.451) (-644.592) (-643.025) [-642.957] * (-642.286) (-643.532) [-642.343] (-640.644) -- 0:00:01
978000 -- (-642.694) (-641.478) [-642.765] (-640.993) * [-642.684] (-642.925) (-642.438) (-645.176) -- 0:00:01
978500 -- (-642.460) (-641.632) (-641.517) [-641.219] * [-644.578] (-642.500) (-639.857) (-641.159) -- 0:00:01
979000 -- (-643.403) (-642.864) [-642.915] (-642.585) * (-643.500) (-643.072) (-641.925) [-642.486] -- 0:00:01
979500 -- [-642.907] (-649.242) (-640.958) (-647.643) * (-641.846) (-642.119) [-643.476] (-642.059) -- 0:00:01
980000 -- (-644.140) [-648.827] (-643.495) (-645.720) * (-642.497) [-642.634] (-646.940) (-644.915) -- 0:00:01
Average standard deviation of split frequencies: 0.005642
980500 -- (-644.347) [-641.582] (-641.711) (-645.958) * (-640.412) [-643.883] (-643.534) (-641.762) -- 0:00:01
981000 -- [-644.813] (-647.534) (-640.410) (-644.485) * (-642.098) [-643.274] (-643.650) (-645.072) -- 0:00:01
981500 -- (-643.395) (-641.729) [-641.296] (-642.262) * (-644.469) [-644.660] (-643.974) (-641.973) -- 0:00:01
982000 -- (-642.945) (-642.565) [-644.702] (-641.449) * (-646.142) [-642.150] (-641.627) (-647.581) -- 0:00:01
982500 -- (-645.393) [-642.166] (-643.307) (-646.161) * [-643.436] (-645.031) (-642.745) (-642.419) -- 0:00:01
983000 -- [-642.746] (-643.887) (-641.450) (-648.077) * [-645.981] (-643.838) (-643.430) (-642.014) -- 0:00:01
983500 -- (-641.942) [-642.673] (-644.266) (-647.651) * (-644.117) (-644.381) [-645.291] (-644.919) -- 0:00:01
984000 -- (-642.380) (-643.359) [-645.141] (-643.260) * (-645.933) [-641.492] (-644.869) (-646.384) -- 0:00:01
984500 -- (-642.532) (-643.997) (-645.861) [-642.321] * [-646.248] (-641.881) (-644.274) (-642.228) -- 0:00:00
985000 -- (-641.813) (-643.852) (-643.995) [-642.001] * (-646.468) (-642.447) [-642.719] (-644.866) -- 0:00:00
Average standard deviation of split frequencies: 0.005586
985500 -- [-645.163] (-643.670) (-642.122) (-644.438) * (-642.510) [-642.198] (-643.277) (-645.080) -- 0:00:00
986000 -- (-645.205) (-642.441) [-639.619] (-640.904) * (-642.885) (-642.406) [-644.463] (-640.428) -- 0:00:00
986500 -- (-644.714) [-642.262] (-642.455) (-641.896) * (-645.132) [-642.238] (-641.552) (-645.362) -- 0:00:00
987000 -- (-644.172) (-641.663) [-643.512] (-642.477) * (-644.914) [-643.561] (-644.296) (-641.213) -- 0:00:00
987500 -- (-640.613) (-647.295) (-645.602) [-641.687] * (-643.547) [-642.223] (-641.602) (-642.100) -- 0:00:00
988000 -- [-642.667] (-641.018) (-642.961) (-643.014) * (-643.242) [-643.193] (-641.378) (-642.568) -- 0:00:00
988500 -- (-641.981) [-641.531] (-644.065) (-645.113) * (-646.062) (-640.690) (-641.612) [-642.149] -- 0:00:00
989000 -- [-641.616] (-641.643) (-639.593) (-641.570) * (-647.623) (-641.937) [-642.635] (-642.528) -- 0:00:00
989500 -- [-641.211] (-643.806) (-646.560) (-641.527) * (-643.943) [-642.276] (-643.701) (-643.610) -- 0:00:00
990000 -- (-643.063) (-641.038) [-641.421] (-642.634) * (-645.149) (-645.223) (-642.069) [-642.558] -- 0:00:00
Average standard deviation of split frequencies: 0.005435
990500 -- (-645.422) (-643.300) (-642.976) [-644.721] * (-643.991) (-646.249) [-641.383] (-642.284) -- 0:00:00
991000 -- (-643.336) [-643.125] (-645.701) (-643.724) * (-643.531) (-643.881) (-642.193) [-643.906] -- 0:00:00
991500 -- (-646.358) [-641.350] (-641.250) (-641.753) * (-644.311) (-644.622) (-641.148) [-643.388] -- 0:00:00
992000 -- (-645.805) (-643.574) (-643.714) [-641.609] * (-646.275) (-643.731) [-642.277] (-644.327) -- 0:00:00
992500 -- [-643.928] (-642.771) (-645.876) (-643.302) * (-639.958) (-646.105) (-640.281) [-642.489] -- 0:00:00
993000 -- (-642.193) (-643.233) [-643.381] (-642.526) * (-644.668) (-642.485) [-641.964] (-642.492) -- 0:00:00
993500 -- (-646.073) (-642.663) [-645.242] (-644.060) * (-642.578) [-641.249] (-642.407) (-641.438) -- 0:00:00
994000 -- [-641.963] (-643.785) (-644.550) (-647.084) * [-642.826] (-642.891) (-642.425) (-645.099) -- 0:00:00
994500 -- (-640.994) (-647.246) (-642.788) [-646.634] * (-643.969) (-643.742) (-642.789) [-641.864] -- 0:00:00
995000 -- (-646.078) (-641.994) (-646.457) [-642.049] * (-645.767) (-647.547) (-644.870) [-640.456] -- 0:00:00
Average standard deviation of split frequencies: 0.005505
995500 -- (-646.279) (-642.312) (-643.383) [-643.509] * (-642.284) [-640.943] (-643.464) (-644.186) -- 0:00:00
996000 -- (-645.349) (-641.983) (-643.900) [-643.554] * (-642.346) [-641.624] (-643.382) (-643.037) -- 0:00:00
996500 -- (-643.824) (-645.603) (-641.958) [-644.676] * (-648.250) (-641.601) [-642.619] (-643.398) -- 0:00:00
997000 -- [-642.931] (-642.616) (-643.224) (-641.972) * (-644.230) (-642.553) [-640.729] (-642.648) -- 0:00:00
997500 -- (-640.910) (-641.579) (-643.407) [-644.160] * (-645.170) [-644.910] (-643.712) (-646.973) -- 0:00:00
998000 -- (-642.003) [-642.728] (-643.044) (-641.672) * [-645.348] (-639.858) (-647.844) (-646.070) -- 0:00:00
998500 -- (-642.324) (-644.602) (-643.612) [-641.297] * (-643.214) (-642.991) (-641.216) [-639.511] -- 0:00:00
999000 -- (-642.536) (-643.393) (-645.576) [-641.084] * (-643.179) [-644.076] (-643.362) (-641.905) -- 0:00:00
999500 -- (-641.453) (-641.945) [-644.596] (-643.795) * (-642.148) [-643.282] (-643.404) (-641.489) -- 0:00:00
1000000 -- [-642.954] (-648.336) (-642.035) (-644.149) * (-643.432) (-641.474) [-644.335] (-641.574) -- 0:00:00
Average standard deviation of split frequencies: 0.005504
Analysis completed in 1 mins 4 seconds
Analysis used 62.81 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -637.23
Likelihood of best state for "cold" chain of run 2 was -637.24
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 72 %) Dirichlet(Revmat{all})
98.7 % ( 96 %) Slider(Revmat{all})
32.3 % ( 22 %) Dirichlet(Pi{all})
33.7 % ( 26 %) Slider(Pi{all})
71.5 % ( 52 %) Multiplier(Alpha{1,2})
79.1 % ( 55 %) Multiplier(Alpha{3})
27.5 % ( 31 %) Slider(Pinvar{all})
89.7 % ( 95 %) ExtSPR(Tau{all},V{all})
61.6 % ( 69 %) ExtTBR(Tau{all},V{all})
89.5 % ( 91 %) NNI(Tau{all},V{all})
78.6 % ( 80 %) ParsSPR(Tau{all},V{all})
28.1 % ( 33 %) Multiplier(V{all})
93.5 % ( 93 %) Nodeslider(V{all})
30.5 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 65 %) Dirichlet(Revmat{all})
98.6 % ( 94 %) Slider(Revmat{all})
32.8 % ( 27 %) Dirichlet(Pi{all})
33.5 % ( 28 %) Slider(Pi{all})
71.0 % ( 51 %) Multiplier(Alpha{1,2})
78.9 % ( 53 %) Multiplier(Alpha{3})
28.6 % ( 32 %) Slider(Pinvar{all})
89.3 % ( 88 %) ExtSPR(Tau{all},V{all})
60.5 % ( 70 %) ExtTBR(Tau{all},V{all})
89.0 % ( 86 %) NNI(Tau{all},V{all})
78.0 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
93.4 % ( 94 %) Nodeslider(V{all})
30.7 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166031 0.82 0.66
3 | 166347 167404 0.84
4 | 166835 166786 166597
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.48
2 | 166925 0.81 0.66
3 | 166551 166902 0.83
4 | 165938 166969 166715
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -641.96
|2 2 2 2 1 2 21 |
| 1 1 |
| 2 1 21 21 1 2 1 * |
| * 21 122 22 21 1 2 1 1 2 1 2|
| 1 2 2 1 2 1 21 1 |
| 22 22 1 2 1 2 11 |
| 2 2 1 11 2 21 21 1 2 21 2 |
| 1 1 1 1 1 2 2 1 2 2 2 1|
|1 11 2 1 2 2 2 1 2 1 2 2 |
| 1 1 2 1 2 1 2 21 |
| 1 1 2 1 2 |
| 2 1 1 1 2 |
| 2 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -643.95
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -641.56 -645.72
2 -641.52 -645.34
--------------------------------------
TOTAL -641.54 -645.55
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.881049 0.087569 0.348831 1.452611 0.847222 1420.64 1423.36 1.000
r(A<->C){all} 0.148937 0.016735 0.000034 0.401195 0.112096 186.21 244.11 1.001
r(A<->G){all} 0.173601 0.021979 0.000002 0.469204 0.133880 318.39 415.09 1.011
r(A<->T){all} 0.161110 0.019125 0.000148 0.439119 0.124030 130.86 221.94 1.000
r(C<->G){all} 0.141711 0.016818 0.000277 0.410624 0.102258 142.53 151.54 1.000
r(C<->T){all} 0.220136 0.026866 0.000226 0.536899 0.183124 185.72 209.98 1.002
r(G<->T){all} 0.154504 0.017549 0.000054 0.407759 0.121540 228.99 246.78 1.000
pi(A){all} 0.182110 0.000320 0.149468 0.218763 0.181793 1004.19 1106.63 1.000
pi(C){all} 0.271323 0.000417 0.231832 0.310852 0.271094 1235.70 1325.16 1.000
pi(G){all} 0.313062 0.000481 0.273098 0.357953 0.313006 1120.39 1274.61 1.000
pi(T){all} 0.233506 0.000385 0.195785 0.272912 0.233181 1217.69 1222.43 1.000
alpha{1,2} 0.397669 0.215291 0.000310 1.268738 0.245467 1117.76 1218.02 1.002
alpha{3} 0.416522 0.225285 0.000112 1.357274 0.244786 837.71 1014.63 1.000
pinvar{all} 0.992706 0.000043 0.980603 0.999860 0.994409 882.42 993.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- ..****
9 -- ....**
10 -- .****.
11 -- .*...*
12 -- .***.*
13 -- .*..*.
14 -- ..***.
15 -- ..**.*
16 -- .*.*..
17 -- ..*..*
18 -- .*..**
19 -- ...**.
20 -- ..*.*.
21 -- .***..
22 -- .**...
23 -- ...*.*
24 -- .*.***
25 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 964 0.321119 0.000942 0.320453 0.321785 2
8 485 0.161559 0.008009 0.155896 0.167222 2
9 482 0.160560 0.007537 0.155230 0.165889 2
10 480 0.159893 0.000942 0.159227 0.160560 2
11 467 0.155563 0.001413 0.154564 0.156562 2
12 461 0.153564 0.004240 0.150566 0.156562 2
13 458 0.152565 0.007537 0.147235 0.157895 2
14 372 0.123917 0.002827 0.121919 0.125916 2
15 362 0.120586 0.004711 0.117255 0.123917 2
16 355 0.118254 0.013662 0.108594 0.127915 2
17 345 0.114923 0.012719 0.105929 0.123917 2
18 344 0.114590 0.009422 0.107928 0.121252 2
19 333 0.110926 0.000471 0.110593 0.111259 2
20 332 0.110593 0.002827 0.108594 0.112592 2
21 322 0.107262 0.000942 0.106596 0.107928 2
22 321 0.106929 0.006124 0.102598 0.111259 2
23 321 0.106929 0.001413 0.105929 0.107928 2
24 319 0.106262 0.016488 0.094604 0.117921 2
25 311 0.103598 0.002355 0.101932 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.092331 0.008580 0.000004 0.281421 0.062431 1.000 2
length{all}[2] 0.092766 0.008761 0.000004 0.285999 0.064190 1.000 2
length{all}[3] 0.102122 0.010261 0.000011 0.305222 0.070425 1.000 2
length{all}[4] 0.100647 0.010132 0.000089 0.310501 0.070030 1.000 2
length{all}[5] 0.090946 0.008553 0.000047 0.267907 0.063385 1.000 2
length{all}[6] 0.096880 0.009702 0.000101 0.298589 0.067816 1.000 2
length{all}[7] 0.144219 0.013660 0.000060 0.372066 0.117825 1.002 2
length{all}[8] 0.100281 0.009620 0.000388 0.300461 0.075343 0.999 2
length{all}[9] 0.092475 0.009027 0.000051 0.272359 0.061949 1.000 2
length{all}[10] 0.105985 0.009730 0.000384 0.304633 0.078610 0.998 2
length{all}[11] 0.094593 0.008469 0.000022 0.273620 0.061306 0.998 2
length{all}[12] 0.092872 0.008740 0.000129 0.278245 0.061223 0.998 2
length{all}[13] 0.093970 0.009202 0.000054 0.274157 0.065057 0.999 2
length{all}[14] 0.105007 0.012166 0.000092 0.290665 0.066097 0.998 2
length{all}[15] 0.090468 0.008112 0.000146 0.259201 0.063828 0.999 2
length{all}[16] 0.089896 0.008538 0.000226 0.279664 0.059358 0.998 2
length{all}[17] 0.101162 0.009317 0.000315 0.278573 0.068945 0.998 2
length{all}[18] 0.096452 0.009080 0.000004 0.284134 0.067528 0.997 2
length{all}[19] 0.091150 0.008093 0.000396 0.300558 0.065156 0.997 2
length{all}[20] 0.098893 0.008819 0.000293 0.272516 0.069340 0.998 2
length{all}[21] 0.091585 0.008044 0.000256 0.271269 0.066321 1.002 2
length{all}[22] 0.104442 0.013513 0.000349 0.317508 0.069538 1.000 2
length{all}[23] 0.099692 0.009127 0.000290 0.292428 0.063718 0.998 2
length{all}[24] 0.088373 0.008430 0.000016 0.265816 0.062512 0.997 2
length{all}[25] 0.100494 0.010791 0.000027 0.272404 0.074717 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005504
Maximum standard deviation of split frequencies = 0.016488
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 33 trees
90 % credible set contains 86 trees
95 % credible set contains 95 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 459
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 54 patterns at 153 / 153 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 54 patterns at 153 / 153 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
52704 bytes for conP
4752 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.042456 0.025259 0.016164 0.070700 0.018566 0.074547 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -667.610736
Iterating by ming2
Initial: fx= 667.610736
x= 0.04246 0.02526 0.01616 0.07070 0.01857 0.07455 0.30000 1.30000
1 h-m-p 0.0000 0.0001 342.4490 ++ 653.688968 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 3305.2928 ++ 649.883659 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 1256.0215 ++ 644.301502 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0002 140.6492 ++ 638.066920 m 0.0002 46 | 4/8
5 h-m-p 0.0026 0.1674 4.6122 ++YCYYCCC 633.665396 6 0.1410 69 | 4/8
6 h-m-p 0.3043 2.3844 2.1371 CCCC 633.514146 3 0.0732 86 | 4/8
7 h-m-p 0.2589 2.8546 0.6042 +YCYCCC 632.856097 5 1.5229 106 | 4/8
8 h-m-p 0.5791 2.8953 1.1169 YC 632.311430 1 1.0322 122 | 4/8
9 h-m-p 1.5689 8.0000 0.7348 CCCC 632.035170 3 1.5569 139 | 4/8
10 h-m-p 1.3820 8.0000 0.8278 +CYC 631.453682 2 5.2856 158 | 4/8
11 h-m-p 1.6000 8.0000 1.1684 YYCCC 631.280144 4 2.6160 179 | 4/8
12 h-m-p 1.4403 8.0000 2.1222 +YCC 631.034131 2 4.9532 194 | 4/8
13 h-m-p 1.6000 8.0000 3.2338 YYCC 630.947073 3 2.1501 209 | 4/8
14 h-m-p 1.5435 8.0000 4.5047 +CC 630.839028 1 5.7803 223 | 4/8
15 h-m-p 1.6000 8.0000 7.3494 CYC 630.800314 2 2.0945 237 | 4/8
16 h-m-p 1.5520 8.0000 9.9187 +CY 630.754028 1 6.4490 251 | 4/8
17 h-m-p 1.6000 8.0000 17.2613 CYC 630.737092 2 2.0289 265 | 4/8
18 h-m-p 1.5451 8.0000 22.6658 +YC 630.717586 1 6.8908 278 | 4/8
19 h-m-p 1.6000 8.0000 41.4045 CYC 630.710366 2 1.9567 292 | 4/8
20 h-m-p 1.5347 8.0000 52.7870 +YC 630.702293 1 7.0575 305 | 4/8
21 h-m-p 0.9538 4.7689 97.1230 YC 630.699190 1 2.0141 317 | 4/8
22 h-m-p 0.4341 2.1703 123.2890 ++ 630.697256 m 2.1703 328 | 5/8
23 h-m-p 0.3572 1.7860 145.0478 ++ 630.697000 m 1.7860 339 | 6/8
24 h-m-p 1.2608 8.0000 0.0001 C 630.696914 0 1.0317 350 | 6/8
25 h-m-p 1.6000 8.0000 0.0000 C 630.696914 0 1.4090 363
Out..
lnL = -630.696914
364 lfun, 364 eigenQcodon, 2184 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.101443 0.107450 0.049914 0.039215 0.092614 0.088530 999.000000 0.878707 0.268301
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.037705
np = 9
lnL0 = -697.523565
Iterating by ming2
Initial: fx= 697.523565
x= 0.10144 0.10745 0.04991 0.03922 0.09261 0.08853 951.42857 0.87871 0.26830
1 h-m-p 0.0000 0.0003 334.2076 +++ 665.679936 m 0.0003 15 | 0/9
2 h-m-p 0.0000 0.0000 2302.9603 ++ 659.044992 m 0.0000 27 | 1/9
3 h-m-p 0.0000 0.0001 469.0957 ++ 648.988354 m 0.0001 39 | 2/9
4 h-m-p 0.0001 0.0007 39.6393 YCYCCC 648.665139 5 0.0004 59 | 2/9
5 h-m-p 0.0011 0.0057 4.6751 YYYC 648.631640 3 0.0011 74 | 2/9
6 h-m-p 0.0006 0.0085 9.0887 +YCYYCCC 648.181440 6 0.0047 97 | 2/9
7 h-m-p 0.0003 0.0015 156.0385 ++ 644.620546 m 0.0015 109 | 2/9
8 h-m-p 0.0000 0.0000 15134.8802 ++ 638.819127 m 0.0000 121 | 2/9
9 h-m-p 0.0000 0.0000 6351951718.5408
h-m-p: 1.15792568e-27 5.78962840e-27 6.35195172e+09 638.819127
.. | 2/9
10 h-m-p 0.0000 0.0000 236754.1886 -YYCYCCCC 632.435049 7 0.0000 155 | 2/9
11 h-m-p 0.0000 0.0000 280.8651 ++ 631.955642 m 0.0000 167 | 3/9
12 h-m-p 0.0000 0.0000 2133.3774 ++ 631.914050 m 0.0000 179 | 4/9
13 h-m-p 0.0000 0.0015 15.8129 ++++ 631.420008 m 0.0015 193 | 5/9
14 h-m-p 0.1270 3.8220 0.1883 +CC 631.388865 1 0.5153 208 | 5/9
15 h-m-p 0.5841 3.7499 0.1661 CYC 631.329129 2 0.3929 227 | 5/9
16 h-m-p 1.6000 8.0000 0.0127 CC 631.327729 1 2.4371 245 | 5/9
17 h-m-p 1.6000 8.0000 0.0003 C 631.327726 0 1.3624 261 | 5/9
18 h-m-p 1.6000 8.0000 0.0001 C 631.327726 0 1.8634 277 | 5/9
19 h-m-p 1.6000 8.0000 0.0000 ++ 631.327726 m 8.0000 293 | 5/9
20 h-m-p 0.0160 8.0000 0.0058 +++C 631.327708 0 1.0738 312 | 5/9
21 h-m-p 1.6000 8.0000 0.0003 Y 631.327707 0 1.2697 328 | 5/9
22 h-m-p 1.6000 8.0000 0.0000 ----Y 631.327707 0 0.0016 348
Out..
lnL = -631.327707
349 lfun, 1047 eigenQcodon, 4188 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.091396 0.028591 0.086833 0.073324 0.053493 0.052435 951.435041 1.152621 0.181024 0.319354 1073.827519
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000169
np = 11
lnL0 = -649.118691
Iterating by ming2
Initial: fx= 649.118691
x= 0.09140 0.02859 0.08683 0.07332 0.05349 0.05243 951.43504 1.15262 0.18102 0.31935 951.42857
1 h-m-p 0.0000 0.0009 62.2711 ++++ 644.449509 m 0.0009 18 | 1/11
2 h-m-p 0.0021 0.0106 18.2964 ++ 641.202257 m 0.0106 32 | 2/11
3 h-m-p 0.0000 0.0001 53.1176 ++ 640.971673 m 0.0001 46 | 3/11
4 h-m-p 0.0000 0.0007 788.1324 +++YYYYYYCC 635.178258 7 0.0006 71 | 3/11
5 h-m-p 0.0002 0.0012 212.0089 ++ 631.226697 m 0.0012 85 | 4/11
6 h-m-p 0.0000 0.0001 3047.0947 +YYYYCYCYC 628.436038 8 0.0001 110 | 4/11
7 h-m-p 0.0462 0.2309 1.9483 +YCYCCC 627.921357 5 0.1397 133 | 4/11
8 h-m-p 0.9506 4.7531 0.1286 -YCC 627.915442 2 0.1088 151 | 4/11
9 h-m-p 0.0736 8.0000 0.1902 ++++ 627.249383 m 8.0000 174 | 4/11
10 h-m-p 0.3186 1.5928 3.6164 ---------------.. | 4/11
11 h-m-p 0.0000 0.0116 1.4794 +YC 627.249179 1 0.0002 224 | 4/11
12 h-m-p 0.0009 0.4325 1.5934 +++YCCC 627.138218 3 0.1329 246 | 4/11
13 h-m-p 0.0001 0.0004 1883.4518 ++ 626.523648 m 0.0004 260 | 5/11
14 h-m-p 1.1241 8.0000 0.7255 YCC 626.442540 2 0.5067 277 | 5/11
15 h-m-p 1.6000 8.0000 0.0100 YC 626.441368 1 3.2282 298 | 5/11
16 h-m-p 1.6000 8.0000 0.0027 C 626.441353 0 1.5479 318 | 5/11
17 h-m-p 1.6000 8.0000 0.0024 Y 626.441346 0 2.8790 338 | 5/11
18 h-m-p 1.4965 8.0000 0.0046 ++ 626.441286 m 8.0000 358 | 5/11
19 h-m-p 0.0369 8.0000 1.0022 +++YYC 626.439822 2 3.2065 383 | 5/11
20 h-m-p 1.6000 8.0000 0.1280 YC 626.439707 1 1.1137 398 | 5/11
21 h-m-p 0.8771 8.0000 0.1625 ++ 626.439647 m 8.0000 418 | 5/11
22 h-m-p 1.3223 8.0000 0.9831 ++ 626.439549 m 8.0000 438 | 5/11
23 h-m-p 1.6000 8.0000 3.6106 +C 626.439230 0 6.1131 459 | 5/11
24 h-m-p 0.5770 2.8849 22.2930 ++ 626.438158 m 2.8849 473 | 5/11
25 h-m-p -0.0000 -0.0000 4409.0248
h-m-p: -0.00000000e+00 -0.00000000e+00 4.40902475e+03 626.438158
.. | 5/11
26 h-m-p 0.0026 1.2935 0.7869 -C 626.438092 0 0.0002 499 | 5/11
27 h-m-p 0.0160 8.0000 0.1237 --C 626.438091 0 0.0002 521 | 5/11
28 h-m-p 0.0160 8.0000 0.0088 +++C 626.438046 0 1.1342 544 | 5/11
29 h-m-p 1.6000 8.0000 0.0002 +C 626.438046 0 6.4673 565 | 5/11
30 h-m-p 0.9849 8.0000 0.0011 ++ 626.438045 m 8.0000 585 | 5/11
31 h-m-p 0.0160 8.0000 1.1601 +++YC 626.437852 1 2.1591 609 | 5/11
32 h-m-p 1.6000 8.0000 1.1330 ++ 626.436366 m 8.0000 623 | 5/11
33 h-m-p 0.0098 0.0488 530.7052 ++ 626.432323 m 0.0488 637 | 6/11
34 h-m-p 0.0735 2.8968 15.6919 Y 626.432323 0 0.0114 651 | 6/11
35 h-m-p 1.6000 8.0000 0.1101 ------------C 626.432323 0 0.0000 677 | 6/11
36 h-m-p 0.0160 8.0000 1.4637 +YC 626.432235 1 0.1359 698 | 6/11
37 h-m-p 0.1439 8.0000 1.3819 ++C 626.432224 0 2.2161 714 | 6/11
38 h-m-p 1.6000 8.0000 1.6658 ++ 626.432133 m 8.0000 728 | 6/11
39 h-m-p 0.0129 0.0644 445.2344 ++ 626.431944 m 0.0644 742 | 7/11
40 h-m-p 0.1656 8.0000 0.0031 +C 626.431855 0 0.7859 757 | 7/11
41 h-m-p 1.6000 8.0000 0.0005 Y 626.431855 0 1.0580 775 | 7/11
42 h-m-p 1.6000 8.0000 0.0001 Y 626.431855 0 0.9344 793 | 7/11
43 h-m-p 1.6000 8.0000 0.0000 ---C 626.431855 0 0.0063 814
Out..
lnL = -626.431855
815 lfun, 3260 eigenQcodon, 14670 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -631.003630 S = -627.830511 -4.971143
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:05
did 20 / 54 patterns 0:05
did 30 / 54 patterns 0:05
did 40 / 54 patterns 0:05
did 50 / 54 patterns 0:06
did 54 / 54 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.027671 0.028327 0.105620 0.088612 0.084028 0.074115 999.000000 1.042972 1.244623
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.033567
np = 9
lnL0 = -685.137859
Iterating by ming2
Initial: fx= 685.137859
x= 0.02767 0.02833 0.10562 0.08861 0.08403 0.07412 951.42857 1.04297 1.24462
1 h-m-p 0.0000 0.0002 344.2011 +++ 662.558131 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0003 248.3594 +YCYYCYCYC 652.057492 8 0.0003 39 | 1/9
3 h-m-p 0.0001 0.0004 122.1611 +YYYYYCC 649.913978 6 0.0003 59 | 1/9
4 h-m-p 0.0022 0.0659 15.8167 ------------.. | 1/9
5 h-m-p 0.0000 0.0000 263.2723 ++ 647.236491 m 0.0000 93 | 2/9
6 h-m-p 0.0000 0.0000 7305.3552 ++ 633.553422 m 0.0000 105 | 3/9
7 h-m-p 0.0000 0.0000 30254.8273 ++ 632.040467 m 0.0000 117 | 4/9
8 h-m-p 0.0066 3.2779 0.4703 +YCCC 631.952626 3 0.0485 135 | 4/9
9 h-m-p 0.0494 3.1639 0.4613 +++YCCC 631.574755 3 2.1762 160 | 4/9
10 h-m-p 0.2214 1.1071 0.3589 ++ 631.474316 m 1.1071 177 | 5/9
11 h-m-p 1.6000 8.0000 0.0586 CCC 631.465983 2 1.6835 198 | 5/9
12 h-m-p 1.6000 8.0000 0.0072 C 631.465320 0 1.6000 214 | 5/9
13 h-m-p 1.6000 8.0000 0.0014 Y 631.465318 0 0.8748 230 | 5/9
14 h-m-p 1.6000 8.0000 0.0000 ---Y 631.465318 0 0.0063 249
Out..
lnL = -631.465318
250 lfun, 2750 eigenQcodon, 15000 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 2
0.099201 0.027614 0.078780 0.067541 0.109476 0.095473 951.428603 0.900000 0.269643 1.176783 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000315
np = 11
lnL0 = -641.375426
Iterating by ming2
Initial: fx= 641.375426
x= 0.09920 0.02761 0.07878 0.06754 0.10948 0.09547 951.42860 0.90000 0.26964 1.17678 951.42857
1 h-m-p 0.0000 0.0008 119.4517 +++YYYYYYCYCC 633.782000 10 0.0007 31 | 0/11
2 h-m-p 0.0007 0.0036 12.7568 ++ 633.173031 m 0.0036 45 | 1/11
3 h-m-p 0.0005 0.0023 40.9693 +YYCYCCC 632.688500 6 0.0015 69 | 1/11
4 h-m-p 0.0004 0.0020 33.1356 +YYCYCCC 632.312709 6 0.0013 93 | 0/11
5 h-m-p 0.0000 0.0001 376.0080 CYCCC 632.241348 4 0.0000 114 | 0/11
6 h-m-p 0.0001 0.0004 9.5573 ++ 632.222472 m 0.0004 128 | 0/11
7 h-m-p 0.0005 0.0119 7.2753 +++ 631.324535 m 0.0119 143 | 1/11
8 h-m-p 0.0006 0.0031 16.6797 ++ 629.054829 m 0.0031 157 | 2/11
9 h-m-p 0.0128 0.0638 0.4752 ++ 628.030566 m 0.0638 171 | 3/11
10 h-m-p 0.0122 0.0978 1.9031 ++ 627.321173 m 0.0978 194 | 4/11
11 h-m-p 0.0383 0.2057 1.0672 CCCCC 627.248236 4 0.0522 216 | 4/11
12 h-m-p 0.9369 8.0000 0.0595 ----------------.. | 4/11
13 h-m-p 0.0000 0.0001 85.3555 ++ 626.734577 m 0.0001 265 | 5/11
14 h-m-p 0.0000 0.0007 41.0680 +Y 626.693702 0 0.0001 280 | 5/11
15 h-m-p 0.0004 0.0035 9.8166 +YYYYCYCYCC 626.543396 10 0.0021 308 | 5/11
16 h-m-p 1.6000 8.0000 0.0033 ----------------.. | 5/11
17 h-m-p 0.0000 0.0006 22.6125 ++YYCC 626.508275 3 0.0001 362 | 5/11
18 h-m-p 0.0002 0.0013 14.6452 +YYCCC 626.439882 4 0.0006 383 | 5/11
19 h-m-p 0.0490 0.2448 0.1064 ---C 626.439880 0 0.0002 400 | 5/11
20 h-m-p 0.0715 8.0000 0.0003 ++YC 626.439709 1 0.7712 423 | 5/11
21 h-m-p 1.3736 8.0000 0.0002 C 626.439708 0 0.3561 443 | 5/11
22 h-m-p 0.3777 8.0000 0.0002 +Y 626.439708 0 2.7581 464 | 5/11
23 h-m-p 0.8361 8.0000 0.0006 ++ 626.439708 m 8.0000 484 | 5/11
24 h-m-p 0.0501 8.0000 0.0884 +++Y 626.439693 0 2.2182 507 | 5/11
25 h-m-p 1.6000 8.0000 0.0979 ++ 626.439564 m 8.0000 527 | 5/11
26 h-m-p 0.0016 0.0957 487.2749 +++ 626.432204 m 0.0957 548 | 6/11
27 h-m-p 0.9865 6.0040 2.0812 Y 626.432182 0 0.4833 562 | 6/11
28 h-m-p 1.6000 8.0000 0.4972 YC 626.432175 1 0.8238 577 | 6/11
29 h-m-p 1.6000 8.0000 0.1990 ++ 626.432164 m 8.0000 596 | 6/11
30 h-m-p 0.0286 0.8044 55.7491
QuantileBeta(0.15, 0.00500, 2.45742) = 1.040618e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.81694) = 4.760609e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
+ 626.431910 m 0.8044 616
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.175191e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20844) = 3.068084e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.20843) = 3.068085e-161 2000 rounds
| 7/11
31 h-m-p 0.2401 1.2003 6.0011
QuantileBeta(0.15, 0.00500, 5.76775) = 3.904561e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.60652) = 6.600662e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.52603) = 1.006093e-160 2000 rounds
Y 626.431855 1 0.9603 632 | 7/11
32 h-m-p 1.6000 8.0000 0.0511 C 626.431855 0 1.5670 646 | 7/11
33 h-m-p 0.3807 8.0000 0.2103 +
QuantileBeta(0.15, 0.00500, 2.64698) = 9.504632e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.04833) = 8.028923e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
Y 626.431855 0 4.8524 666
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.116665e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38639) = 1.078927e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38614) = 1.079068e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38626) = 1.078998e-160 2000 rounds
| 7/11
34 h-m-p 1.6000 8.0000 0.2163
QuantileBeta(0.15, 0.00500, 2.73234) = 9.147400e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.77055) = 6.272413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
C 626.431855 0 1.4555 684
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.598818e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70122) = 9.274474e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70096) = 9.275587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.70109) = 9.275030e-161 2000 rounds
| 7/11
35 h-m-p 1.1763 8.0000 0.2676
QuantileBeta(0.15, 0.00500, 3.01592) = 8.130978e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.96040) = 5.930929e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.84221) = 4.733032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
Y 626.431855 0 5.4276 703
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.815447e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15390) = 5.619023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15356) = 5.619536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.15373) = 5.619280e-161 2000 rounds
| 7/11
36 h-m-p 1.6000 8.0000 0.3122
QuantileBeta(0.15, 0.00500, 4.65328) = 4.947207e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.15195) = 3.639965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
C 626.431855 0 2.0391 721
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.957136e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79057) = 4.789720e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79020) = 4.790123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79039) = 4.789922e-161 2000 rounds
| 7/11
37 h-m-p 0.8453 8.0000 0.7531
QuantileBeta(0.15, 0.00500, 5.42704) = 4.173539e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.33701) = 3.010509e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
+ 626.431854 m 8.0000 739
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 2.066263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81584) = 1.996507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81526) = 1.996620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.81555) = 1.996564e-161 2000 rounds
| 7/11
38 h-m-p 1.6000 8.0000 1.0151
QuantileBeta(0.15, 0.00500, 12.43977) = 1.725189e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.31244) = 1.225437e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
C 626.431854 0 1.9352 757
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.735974e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677415e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.78009) = 1.677416e-161 2000 rounds
| 7/11
39 h-m-p 0.1763 7.7366 11.1444
QuantileBeta(0.15, 0.00500, 14.74462) = 1.446220e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.27122) = 1.612955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
C 626.431854 0 0.0462 771
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.666231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.29448) = 1.610025e-161 2000 rounds
| 7/11
40 h-m-p 1.6000 8.0000 0.2726
QuantileBeta(0.15, 0.00500, 12.85831) = 1.666807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18544) = 1.623855e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
C 626.431854 0 0.6141 785
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.688304e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12741) = 1.631311e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12675) = 1.631396e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.12708) = 1.631354e-161 2000 rounds
| 7/11
41 h-m-p 0.8309 8.0000 0.2015
QuantileBeta(0.15, 0.00500, 12.95969) = 1.653255e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.08523) = 1.636775e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
Y 626.431854 0 0.1591 803
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.692597e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09536) = 1.635460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09470) = 1.635545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09503) = 1.635502e-161 2000 rounds
| 7/11
42 h-m-p 0.5097 8.0000 0.0629
QuantileBeta(0.15, 0.00500, 13.06298) = 1.639672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.08702) = 1.636543e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09303) = 1.635762e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
Y 626.431854 0 0.0169 822
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.692740e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09430) = 1.635597e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09364) = 1.635683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
| 7/11
43 h-m-p 0.0160 8.0000 0.3433
QuantileBeta(0.15, 0.00500, 13.08848) = 1.636353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09260) = 1.635818e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09342) = 1.635711e-161 2000 rounds
Y 626.431854 0 0.0010 841
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.692786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09396) = 1.635642e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09330) = 1.635727e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
| 7/11
44 h-m-p 0.0533 8.0000 0.0064
QuantileBeta(0.15, 0.00500, 13.09329) = 1.635729e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09226) = 1.635863e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
Y 626.431854 0 0.0303 859
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.692812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09376) = 1.635667e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09310) = 1.635752e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09343) = 1.635710e-161 2000 rounds
| 7/11
45 h-m-p 0.0255 8.0000 0.0077
QuantileBeta(0.15, 0.00500, 13.09363) = 1.635684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09421) = 1.635608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
Y 626.431854 0 0.0486 877
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.692762e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09414) = 1.635619e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09348) = 1.635704e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
| 7/11
46 h-m-p 0.0274 8.0000 0.0136
QuantileBeta(0.15, 0.00500, 13.09418) = 1.635613e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09530) = 1.635468e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
Y 626.431854 0 0.0164 895
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.692732e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09436) = 1.635590e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09370) = 1.635675e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
| 7/11
47 h-m-p 0.0338 8.0000 0.0066
QuantileBeta(0.15, 0.00500, 13.09381) = 1.635661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09401) = 1.635634e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
Y 626.431854 0 0.0005 915
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.692732e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09435) = 1.635590e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09370) = 1.635676e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
| 7/11
48 h-m-p 0.0160 8.0000 0.0035
QuantileBeta(0.15, 0.00500, 13.09397) = 1.635640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09401) = 1.635635e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
N 626.431854 0 0.0000 939
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.692732e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09435) = 1.635590e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09370) = 1.635676e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
| 7/11
49 h-m-p 0.0160 8.0000 0.0005
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635634e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.692732e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09435) = 1.635590e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09370) = 1.635676e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
| 7/11
50 h-m-p 0.0160 8.0000 0.0033
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
N 626.431854 0 0.0000 997
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.692732e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09435) = 1.635590e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09370) = 1.635676e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
| 7/11
51 h-m-p 0.0158 7.9013 0.0041
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
Y 626.431854 0 0.0001 1018
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.692732e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09435) = 1.635590e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09370) = 1.635676e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
| 7/11
52 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
C 626.431854 0 0.0000 1041
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.692732e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09435) = 1.635590e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09370) = 1.635676e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
| 7/11
53 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 13.09403) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
Y 626.431854 0 0.0000 1068
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
Out..
lnL = -626.431854
1069 lfun, 12828 eigenQcodon, 70554 P(t)
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -630.925983 S = -627.830547 -4.360482
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 54 patterns 0:28
did 20 / 54 patterns 0:28
did 30 / 54 patterns 0:28
did 40 / 54 patterns 0:29
did 50 / 54 patterns 0:29
did 54 / 54 patterns 0:29
QuantileBeta(0.15, 0.00500, 13.09402) = 1.635633e-161 2000 rounds
Time used: 0:29
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=153
NC_011896_1_WP_010908218_1_1309_MLBR_RS06155 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
NC_002677_1_NP_301897_1_769_ML1243 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM
**************************************************
NC_011896_1_WP_010908218_1_1309_MLBR_RS06155 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
NC_002677_1_NP_301897_1_769_ML1243 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910 ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA
**************************************************
NC_011896_1_WP_010908218_1_1309_MLBR_RS06155 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
NC_002677_1_NP_301897_1_769_ML1243 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL
NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910 APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP
*************************************************
NC_011896_1_WP_010908218_1_1309_MLBR_RS06155 RRD
NC_002677_1_NP_301897_1_769_ML1243 RRD
NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740 RRD
NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590 RRD
NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760 RRD
NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910 RRD
***
>NC_011896_1_WP_010908218_1_1309_MLBR_RS06155 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC CGACGAGAC >NC_002677_1_NP_301897_1_769_ML1243 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC CGACGAGAC >NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCTC CGACGAGAC >NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCTC CGACGAGAC >NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC CGACGAGAC >NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910 TTGGTGGCGTCATGTCTCCCCCGCAAGTGGGAAGGACTCCCAGACGTCTG TCTGGCTGTCAGGAGCCGGTGTTGGTACAGGTTCTTCGTGTGGCATTGGT CTATCAACATCAAACGGGGGCAAGCCTATTCATTGCCGAACAGGGGGATG GAACTTAGCGGGATTTGTGTCTTGGTCAACGGACAGCAAGGGTTCGCGCT TTGTTTGGCCGGCTCACATCTTCGATTGAAAAGGTTATCGCGTGGGTACG CGATAACATTGCTGACTGCCGCCGCCGACTCCGAGCGGTTCAACGCGGCT GCGCCGATCTCGTACACGCAAAGCGAGGCTTCGTCGTGTTTGATGCTGCA CGGTGAGGAAAAAAATCCTTTGGCTCCGAGCGCGAAGGCTCACGCCTTCT GCGCGGCGCTGCTCACGGTTGGAGTCCGCACGGGCCCTTGTCGGCATCCC CGACGAGAC
>NC_011896_1_WP_010908218_1_1309_MLBR_RS06155 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP RRD >NC_002677_1_NP_301897_1_769_ML1243 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP RRD >NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL RRD >NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHL RRD >NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP RRD >NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910 LVASCLPRKWEGLPDVCLAVRSRCWYRFFVWHWSINIKRGQAYSLPNRGM ELSGICVLVNGQQGFALCLAGSHLRLKRLSRGYAITLLTAAADSERFNAA APISYTQSEASSCLMLHGEEKNPLAPSAKAHAFCAALLTVGVRTGPCRHP RRD
#NEXUS
[ID: 5752035642]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908218_1_1309_MLBR_RS06155
NC_002677_1_NP_301897_1_769_ML1243
NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740
NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590
NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760
NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908218_1_1309_MLBR_RS06155,
2 NC_002677_1_NP_301897_1_769_ML1243,
3 NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740,
4 NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590,
5 NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760,
6 NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06243145,2:0.06419015,3:0.07042466,4:0.07002967,5:0.06338509,6:0.06781601);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06243145,2:0.06419015,3:0.07042466,4:0.07002967,5:0.06338509,6:0.06781601);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -641.56 -645.72
2 -641.52 -645.34
--------------------------------------
TOTAL -641.54 -645.55
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1243/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.881049 0.087569 0.348831 1.452611 0.847222 1420.64 1423.36 1.000
r(A<->C){all} 0.148937 0.016735 0.000034 0.401195 0.112096 186.21 244.11 1.001
r(A<->G){all} 0.173601 0.021979 0.000002 0.469204 0.133880 318.39 415.09 1.011
r(A<->T){all} 0.161110 0.019125 0.000148 0.439119 0.124030 130.86 221.94 1.000
r(C<->G){all} 0.141711 0.016818 0.000277 0.410624 0.102258 142.53 151.54 1.000
r(C<->T){all} 0.220136 0.026866 0.000226 0.536899 0.183124 185.72 209.98 1.002
r(G<->T){all} 0.154504 0.017549 0.000054 0.407759 0.121540 228.99 246.78 1.000
pi(A){all} 0.182110 0.000320 0.149468 0.218763 0.181793 1004.19 1106.63 1.000
pi(C){all} 0.271323 0.000417 0.231832 0.310852 0.271094 1235.70 1325.16 1.000
pi(G){all} 0.313062 0.000481 0.273098 0.357953 0.313006 1120.39 1274.61 1.000
pi(T){all} 0.233506 0.000385 0.195785 0.272912 0.233181 1217.69 1222.43 1.000
alpha{1,2} 0.397669 0.215291 0.000310 1.268738 0.245467 1117.76 1218.02 1.002
alpha{3} 0.416522 0.225285 0.000112 1.357274 0.244786 837.71 1014.63 1.000
pinvar{all} 0.992706 0.000043 0.980603 0.999860 0.994409 882.42 993.97 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1243/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 153
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 7 7 7 7 7 7
TTC 5 5 5 5 5 5 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 2 2 2 2 2 2 | His CAT 3 3 3 3 3 3 | Arg CGT 1 1 1 1 1 1
CTC 3 3 4 4 3 3 | CCC 2 2 1 1 2 2 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 3 3 3 3 3 3 | CGA 3 3 3 3 3 3
CTG 4 4 4 4 4 4 | CCG 3 3 3 3 3 3 | CAG 1 1 1 1 1 1 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 0 0 0 0 0 0 | AAC 4 4 4 4 4 4 | AGC 4 4 4 4 4 4
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 3 3 3 3 3 3 | AAG 2 2 2 2 2 2 | AGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 5 5 5 5 5 5 | Asp GAT 0 0 0 0 0 0 | Gly GGT 1 1 1 1 1 1
GTC 5 5 5 5 5 5 | GCC 6 6 6 6 6 6 | GAC 3 3 3 3 3 3 | GGC 2 2 2 2 2 2
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 3 3 3 3 3 3 | GGA 3 3 3 3 3 3
GTG 2 2 2 2 2 2 | GCG 8 8 8 8 8 8 | GAG 3 3 3 3 3 3 | GGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155
position 1: T:0.25490 C:0.24183 A:0.19608 G:0.30719
position 2: T:0.25490 C:0.26797 A:0.20915 G:0.26797
position 3: T:0.18301 C:0.30065 A:0.14379 G:0.37255
Average T:0.23094 C:0.27015 A:0.18301 G:0.31590
#2: NC_002677_1_NP_301897_1_769_ML1243
position 1: T:0.25490 C:0.24183 A:0.19608 G:0.30719
position 2: T:0.25490 C:0.26797 A:0.20915 G:0.26797
position 3: T:0.18301 C:0.30065 A:0.14379 G:0.37255
Average T:0.23094 C:0.27015 A:0.18301 G:0.31590
#3: NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740
position 1: T:0.25490 C:0.24183 A:0.19608 G:0.30719
position 2: T:0.26144 C:0.26144 A:0.20915 G:0.26797
position 3: T:0.18301 C:0.30065 A:0.14379 G:0.37255
Average T:0.23312 C:0.26797 A:0.18301 G:0.31590
#4: NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590
position 1: T:0.25490 C:0.24183 A:0.19608 G:0.30719
position 2: T:0.26144 C:0.26144 A:0.20915 G:0.26797
position 3: T:0.18301 C:0.30065 A:0.14379 G:0.37255
Average T:0.23312 C:0.26797 A:0.18301 G:0.31590
#5: NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760
position 1: T:0.25490 C:0.24183 A:0.19608 G:0.30719
position 2: T:0.25490 C:0.26797 A:0.20915 G:0.26797
position 3: T:0.18301 C:0.30065 A:0.14379 G:0.37255
Average T:0.23094 C:0.27015 A:0.18301 G:0.31590
#6: NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910
position 1: T:0.25490 C:0.24183 A:0.19608 G:0.30719
position 2: T:0.25490 C:0.26797 A:0.20915 G:0.26797
position 3: T:0.18301 C:0.30065 A:0.14379 G:0.37255
Average T:0.23094 C:0.27015 A:0.18301 G:0.31590
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 42
TTC 30 | TCC 6 | TAC 18 | TGC 6
Leu L TTA 6 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 24 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 12 | His H CAT 18 | Arg R CGT 6
CTC 20 | CCC 10 | CAC 12 | CGC 12
CTA 0 | CCA 6 | Gln Q CAA 18 | CGA 18
CTG 24 | CCG 18 | CAG 6 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 0
ATC 18 | ACC 0 | AAC 24 | AGC 24
ATA 6 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 18 | AAG 12 | AGG 24
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 30 | Asp D GAT 0 | Gly G GGT 6
GTC 30 | GCC 36 | GAC 18 | GGC 12
GTA 0 | GCA 0 | Glu E GAA 18 | GGA 18
GTG 12 | GCG 48 | GAG 18 | GGG 30
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.25490 C:0.24183 A:0.19608 G:0.30719
position 2: T:0.25708 C:0.26580 A:0.20915 G:0.26797
position 3: T:0.18301 C:0.30065 A:0.14379 G:0.37255
Average T:0.23166 C:0.26943 A:0.18301 G:0.31590
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 8): -630.696914 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006688 0.006688 0.000004 0.000004 999.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.013393
(1: 0.000004, 2: 0.000004, 3: 0.006688, 4: 0.006688, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908218_1_1309_MLBR_RS06155: 0.000004, NC_002677_1_NP_301897_1_769_ML1243: 0.000004, NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740: 0.006688, NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590: 0.006688, NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760: 0.000004, NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 318.3 140.7 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 318.3 140.7 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.007 318.3 140.7 999.0000 0.0032 0.0000 1.0 0.0
7..4 0.007 318.3 140.7 999.0000 0.0032 0.0000 1.0 0.0
7..5 0.000 318.3 140.7 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 318.3 140.7 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0064
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -631.327707 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006502 0.006502 0.000004 0.000004 951.435041 0.525846 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.013020
(1: 0.000004, 2: 0.000004, 3: 0.006502, 4: 0.006502, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908218_1_1309_MLBR_RS06155: 0.000004, NC_002677_1_NP_301897_1_769_ML1243: 0.000004, NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740: 0.006502, NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590: 0.006502, NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760: 0.000004, NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.43504
MLEs of dN/dS (w) for site classes (K=2)
p: 0.52585 0.47415
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 318.4 140.6 0.4742 0.0000 0.0000 0.0 0.0
7..2 0.000 318.4 140.6 0.4742 0.0000 0.0000 0.0 0.0
7..3 0.007 318.4 140.6 0.4742 0.0016 0.0034 0.5 0.5
7..4 0.007 318.4 140.6 0.4742 0.0016 0.0034 0.5 0.5
7..5 0.000 318.4 140.6 0.4742 0.0000 0.0000 0.0 0.0
7..6 0.000 318.4 140.6 0.4742 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -626.431855 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.009877 0.009877 0.000004 0.000004 999.000000 0.991275 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.019769
(1: 0.000004, 2: 0.000004, 3: 0.009877, 4: 0.009877, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908218_1_1309_MLBR_RS06155: 0.000004, NC_002677_1_NP_301897_1_769_ML1243: 0.000004, NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740: 0.009877, NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590: 0.009877, NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760: 0.000004, NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
MLEs of dN/dS (w) for site classes (K=3)
p: 0.99128 0.00000 0.00872
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 318.3 140.7 8.7160 0.0000 0.0000 0.0 0.0
7..2 0.000 318.3 140.7 8.7160 0.0000 0.0000 0.0 0.0
7..3 0.010 318.3 140.7 8.7160 0.0045 0.0005 1.4 0.1
7..4 0.010 318.3 140.7 8.7160 0.0045 0.0005 1.4 0.1
7..5 0.000 318.3 140.7 8.7160 0.0000 0.0000 0.0 0.0
7..6 0.000 318.3 140.7 8.7160 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 0.945 7.226 +- 2.746
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.103 0.102 0.101 0.101 0.100 0.099 0.099 0.098 0.098 0.098
w2: 0.019 0.035 0.054 0.073 0.093 0.112 0.130 0.147 0.162 0.175
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.004
0.008 0.005 0.004
0.011 0.009 0.008 0.005 0.004
0.012 0.011 0.011 0.009 0.008 0.005 0.004
0.012 0.012 0.012 0.011 0.011 0.009 0.008 0.005 0.003
0.012 0.012 0.013 0.012 0.012 0.012 0.011 0.009 0.008 0.005 0.003
0.012 0.012 0.012 0.013 0.013 0.013 0.012 0.012 0.011 0.009 0.008 0.005 0.003
0.011 0.012 0.012 0.012 0.013 0.013 0.013 0.013 0.013 0.012 0.011 0.010 0.008 0.005 0.003
0.010 0.011 0.011 0.012 0.012 0.013 0.013 0.013 0.013 0.013 0.013 0.012 0.011 0.010 0.008 0.005 0.003
0.010 0.010 0.011 0.011 0.011 0.012 0.012 0.013 0.013 0.013 0.013 0.013 0.013 0.012 0.011 0.010 0.008 0.005 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 9): -631.465318 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006561 0.006561 0.000004 0.000004 951.428603 1.601202 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.013137
(1: 0.000004, 2: 0.000004, 3: 0.006561, 4: 0.006561, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908218_1_1309_MLBR_RS06155: 0.000004, NC_002677_1_NP_301897_1_769_ML1243: 0.000004, NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740: 0.006561, NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590: 0.006561, NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760: 0.000004, NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.42860
Parameters in M7 (beta):
p = 1.60120 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99998 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 318.4 140.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 318.4 140.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.007 318.4 140.6 1.0000 0.0022 0.0022 0.7 0.3
7..4 0.007 318.4 140.6 1.0000 0.0022 0.0022 0.7 0.3
7..5 0.000 318.4 140.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 318.4 140.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 2
lnL(ntime: 6 np: 11): -626.431854 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.009877 0.009877 0.000004 0.000004 999.000000 0.991275 0.005000 13.094025 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.019769
(1: 0.000004, 2: 0.000004, 3: 0.009877, 4: 0.009877, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908218_1_1309_MLBR_RS06155: 0.000004, NC_002677_1_NP_301897_1_769_ML1243: 0.000004, NZ_LVXE01000053_1_WP_064430415_1_2176_A3216_RS11740: 0.009877, NZ_LYPH01000060_1_WP_064430415_1_2217_A8144_RS10590: 0.009877, NZ_CP029543_1_WP_010908218_1_1331_DIJ64_RS06760: 0.000004, NZ_AP014567_1_WP_010908218_1_1361_JK2ML_RS06910: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
Parameters in M8 (beta&w>1):
p0 = 0.99128 p = 0.00500 q = 13.09402
(p1 = 0.00872) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09913 0.09913 0.09913 0.09913 0.09913 0.09913 0.09913 0.09913 0.09913 0.09913 0.00872
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 318.3 140.7 8.7162 0.0000 0.0000 0.0 0.0
7..2 0.000 318.3 140.7 8.7162 0.0000 0.0000 0.0 0.0
7..3 0.010 318.3 140.7 8.7162 0.0045 0.0005 1.4 0.1
7..4 0.010 318.3 140.7 8.7162 0.0045 0.0005 1.4 0.1
7..5 0.000 318.3 140.7 8.7162 0.0000 0.0000 0.0 0.0
7..6 0.000 318.3 140.7 8.7162 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
1 L 0.522 3.938 +- 3.757
2 V 0.521 3.923 +- 3.754
3 A 0.521 3.923 +- 3.754
4 S 0.523 3.942 +- 3.758
5 C 0.523 3.940 +- 3.757
6 L 0.521 3.929 +- 3.755
7 P 0.521 3.929 +- 3.755
8 R 0.522 3.931 +- 3.756
9 K 0.521 3.927 +- 3.755
10 W 0.523 3.939 +- 3.757
11 E 0.523 3.943 +- 3.758
12 G 0.523 3.943 +- 3.758
13 L 0.521 3.929 +- 3.755
14 P 0.523 3.942 +- 3.758
15 D 0.522 3.931 +- 3.756
16 V 0.521 3.929 +- 3.755
17 C 0.523 3.940 +- 3.757
18 L 0.523 3.939 +- 3.757
19 A 0.523 3.939 +- 3.757
20 V 0.521 3.929 +- 3.755
21 R 0.521 3.925 +- 3.755
22 S 0.522 3.931 +- 3.756
23 R 0.521 3.926 +- 3.755
24 C 0.523 3.940 +- 3.757
25 W 0.523 3.939 +- 3.757
26 Y 0.522 3.931 +- 3.756
27 R 0.521 3.925 +- 3.755
28 F 0.521 3.929 +- 3.755
29 F 0.521 3.929 +- 3.755
30 V 0.521 3.923 +- 3.754
31 W 0.523 3.939 +- 3.757
32 H 0.523 3.940 +- 3.757
33 W 0.523 3.939 +- 3.757
34 S 0.523 3.939 +- 3.757
35 I 0.521 3.929 +- 3.755
36 N 0.522 3.932 +- 3.756
37 I 0.521 3.929 +- 3.755
38 K 0.523 3.943 +- 3.758
39 R 0.521 3.926 +- 3.755
40 G 0.521 3.927 +- 3.755
41 Q 0.524 3.948 +- 3.759
42 A 0.521 3.929 +- 3.755
43 Y 0.523 3.940 +- 3.757
44 S 0.523 3.942 +- 3.758
45 L 0.522 3.938 +- 3.757
46 P 0.521 3.924 +- 3.754
47 N 0.522 3.932 +- 3.756
48 R 0.521 3.925 +- 3.755
49 G 0.521 3.927 +- 3.755
50 M 0.520 3.919 +- 3.753
51 E 0.523 3.943 +- 3.758
52 L 0.523 3.939 +- 3.757
53 S 0.522 3.931 +- 3.756
54 G 0.521 3.927 +- 3.755
55 I 0.523 3.939 +- 3.757
56 C 0.523 3.940 +- 3.757
57 V 0.521 3.929 +- 3.755
58 L 0.522 3.938 +- 3.757
59 V 0.521 3.929 +- 3.755
60 N 0.522 3.932 +- 3.756
61 G 0.523 3.943 +- 3.758
62 Q 0.523 3.939 +- 3.757
63 Q 0.524 3.948 +- 3.759
64 G 0.521 3.927 +- 3.755
65 F 0.521 3.929 +- 3.755
66 A 0.521 3.923 +- 3.754
67 L 0.523 3.939 +- 3.757
68 C 0.523 3.940 +- 3.757
69 L 0.522 3.938 +- 3.757
70 A 0.521 3.929 +- 3.755
71 G 0.522 3.932 +- 3.756
72 S 0.523 3.942 +- 3.758
73 H 0.523 3.940 +- 3.757
74 L 0.523 3.939 +- 3.757
75 R 0.524 3.949 +- 3.759
76 L 0.522 3.938 +- 3.757
77 K 0.523 3.943 +- 3.758
78 R 0.521 3.925 +- 3.755
79 L 0.524 3.948 +- 3.759
80 S 0.521 3.924 +- 3.754
81 R 0.523 3.940 +- 3.757
82 G 0.521 3.927 +- 3.755
83 Y 0.522 3.931 +- 3.756
84 A 0.521 3.923 +- 3.754
85 I 0.521 3.930 +- 3.755
86 T 0.523 3.942 +- 3.758
87 L 0.522 3.938 +- 3.757
88 L 0.523 3.939 +- 3.757
89 T 0.523 3.939 +- 3.757
90 A 0.521 3.929 +- 3.755
91 A 0.521 3.929 +- 3.755
92 A 0.521 3.929 +- 3.755
93 D 0.522 3.931 +- 3.756
94 S 0.521 3.929 +- 3.755
95 E 0.521 3.925 +- 3.755
96 R 0.521 3.926 +- 3.755
97 F 0.521 3.929 +- 3.755
98 N 0.522 3.932 +- 3.756
99 A 0.521 3.923 +- 3.754
100 A 0.523 3.939 +- 3.757
101 A 0.521 3.923 +- 3.754
102 P 0.521 3.924 +- 3.754
103 I 0.521 3.929 +- 3.755
104 S 0.521 3.924 +- 3.754
105 Y 0.522 3.931 +- 3.756
106 T 0.521 3.923 +- 3.754
107 Q 0.524 3.948 +- 3.759
108 S 0.522 3.931 +- 3.756
109 E 0.521 3.925 +- 3.755
110 A 0.523 3.939 +- 3.757
111 S 0.521 3.924 +- 3.754
112 S 0.521 3.924 +- 3.754
113 C 0.523 3.940 +- 3.757
114 L 0.522 3.938 +- 3.757
115 M 0.520 3.919 +- 3.753
116 L 0.523 3.939 +- 3.757
117 H 0.522 3.932 +- 3.756
118 G 0.523 3.940 +- 3.757
119 E 0.521 3.925 +- 3.755
120 E 0.523 3.943 +- 3.758
121 K 0.523 3.943 +- 3.758
122 N 0.523 3.940 +- 3.757
123 P 0.523 3.939 +- 3.757
124 L 0.522 3.938 +- 3.757
125 A 0.523 3.939 +- 3.757
126 P 0.521 3.924 +- 3.754
127 S 0.522 3.931 +- 3.756
128 A 0.521 3.923 +- 3.754
129 K 0.521 3.927 +- 3.755
130 A 0.523 3.939 +- 3.757
131 H 0.522 3.932 +- 3.756
132 A 0.521 3.929 +- 3.755
133 F 0.521 3.929 +- 3.755
134 C 0.522 3.932 +- 3.756
135 A 0.521 3.923 +- 3.754
136 A 0.521 3.923 +- 3.754
137 L 0.523 3.939 +- 3.757
138 L 0.521 3.929 +- 3.755
139 T 0.521 3.923 +- 3.754
140 V 0.523 3.939 +- 3.757
141 G 0.523 3.943 +- 3.758
142 V 0.521 3.929 +- 3.755
143 R 0.522 3.931 +- 3.756
144 T 0.521 3.923 +- 3.754
145 G 0.522 3.932 +- 3.756
146 P 0.523 3.939 +- 3.757
147 C 0.523 3.940 +- 3.757
148 R 0.521 3.926 +- 3.755
149 H 0.523 3.940 +- 3.757
150 P 0.980* 7.211 +- 2.570
151 R 0.524 3.949 +- 3.759
152 R 0.524 3.949 +- 3.759
153 D 0.522 3.931 +- 3.756
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.089 0.097 0.106 0.113 0.119 0.122 0.120 0.109 0.085 0.040
p : 0.104 0.102 0.101 0.100 0.100 0.099 0.099 0.099 0.098 0.098
q : 0.097 0.098 0.099 0.100 0.100 0.101 0.101 0.101 0.101 0.102
ws: 0.019 0.039 0.061 0.082 0.101 0.117 0.131 0.142 0.151 0.158
Time used: 0:29
Model 1: NearlyNeutral -631.327707
Model 2: PositiveSelection -626.431855
Model 0: one-ratio -630.696914
Model 7: beta -631.465318
Model 8: beta&w>1 -626.431854
Model 0 vs 1 1.2615860000000794
Model 2 vs 1 9.791703999999982
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 0.945 7.226 +- 2.746
Model 8 vs 7 10.066927999999962
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
150 P 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908218_1_1309_MLBR_RS06155)
Pr(w>1) post mean +- SE for w
1 L 0.522 3.938 +- 3.757
2 V 0.521 3.923 +- 3.754
3 A 0.521 3.923 +- 3.754
4 S 0.523 3.942 +- 3.758
5 C 0.523 3.940 +- 3.757
6 L 0.521 3.929 +- 3.755
7 P 0.521 3.929 +- 3.755
8 R 0.522 3.931 +- 3.756
9 K 0.521 3.927 +- 3.755
10 W 0.523 3.939 +- 3.757
11 E 0.523 3.943 +- 3.758
12 G 0.523 3.943 +- 3.758
13 L 0.521 3.929 +- 3.755
14 P 0.523 3.942 +- 3.758
15 D 0.522 3.931 +- 3.756
16 V 0.521 3.929 +- 3.755
17 C 0.523 3.940 +- 3.757
18 L 0.523 3.939 +- 3.757
19 A 0.523 3.939 +- 3.757
20 V 0.521 3.929 +- 3.755
21 R 0.521 3.925 +- 3.755
22 S 0.522 3.931 +- 3.756
23 R 0.521 3.926 +- 3.755
24 C 0.523 3.940 +- 3.757
25 W 0.523 3.939 +- 3.757
26 Y 0.522 3.931 +- 3.756
27 R 0.521 3.925 +- 3.755
28 F 0.521 3.929 +- 3.755
29 F 0.521 3.929 +- 3.755
30 V 0.521 3.923 +- 3.754
31 W 0.523 3.939 +- 3.757
32 H 0.523 3.940 +- 3.757
33 W 0.523 3.939 +- 3.757
34 S 0.523 3.939 +- 3.757
35 I 0.521 3.929 +- 3.755
36 N 0.522 3.932 +- 3.756
37 I 0.521 3.929 +- 3.755
38 K 0.523 3.943 +- 3.758
39 R 0.521 3.926 +- 3.755
40 G 0.521 3.927 +- 3.755
41 Q 0.524 3.948 +- 3.759
42 A 0.521 3.929 +- 3.755
43 Y 0.523 3.940 +- 3.757
44 S 0.523 3.942 +- 3.758
45 L 0.522 3.938 +- 3.757
46 P 0.521 3.924 +- 3.754
47 N 0.522 3.932 +- 3.756
48 R 0.521 3.925 +- 3.755
49 G 0.521 3.927 +- 3.755
50 M 0.520 3.919 +- 3.753
51 E 0.523 3.943 +- 3.758
52 L 0.523 3.939 +- 3.757
53 S 0.522 3.931 +- 3.756
54 G 0.521 3.927 +- 3.755
55 I 0.523 3.939 +- 3.757
56 C 0.523 3.940 +- 3.757
57 V 0.521 3.929 +- 3.755
58 L 0.522 3.938 +- 3.757
59 V 0.521 3.929 +- 3.755
60 N 0.522 3.932 +- 3.756
61 G 0.523 3.943 +- 3.758
62 Q 0.523 3.939 +- 3.757
63 Q 0.524 3.948 +- 3.759
64 G 0.521 3.927 +- 3.755
65 F 0.521 3.929 +- 3.755
66 A 0.521 3.923 +- 3.754
67 L 0.523 3.939 +- 3.757
68 C 0.523 3.940 +- 3.757
69 L 0.522 3.938 +- 3.757
70 A 0.521 3.929 +- 3.755
71 G 0.522 3.932 +- 3.756
72 S 0.523 3.942 +- 3.758
73 H 0.523 3.940 +- 3.757
74 L 0.523 3.939 +- 3.757
75 R 0.524 3.949 +- 3.759
76 L 0.522 3.938 +- 3.757
77 K 0.523 3.943 +- 3.758
78 R 0.521 3.925 +- 3.755
79 L 0.524 3.948 +- 3.759
80 S 0.521 3.924 +- 3.754
81 R 0.523 3.940 +- 3.757
82 G 0.521 3.927 +- 3.755
83 Y 0.522 3.931 +- 3.756
84 A 0.521 3.923 +- 3.754
85 I 0.521 3.930 +- 3.755
86 T 0.523 3.942 +- 3.758
87 L 0.522 3.938 +- 3.757
88 L 0.523 3.939 +- 3.757
89 T 0.523 3.939 +- 3.757
90 A 0.521 3.929 +- 3.755
91 A 0.521 3.929 +- 3.755
92 A 0.521 3.929 +- 3.755
93 D 0.522 3.931 +- 3.756
94 S 0.521 3.929 +- 3.755
95 E 0.521 3.925 +- 3.755
96 R 0.521 3.926 +- 3.755
97 F 0.521 3.929 +- 3.755
98 N 0.522 3.932 +- 3.756
99 A 0.521 3.923 +- 3.754
100 A 0.523 3.939 +- 3.757
101 A 0.521 3.923 +- 3.754
102 P 0.521 3.924 +- 3.754
103 I 0.521 3.929 +- 3.755
104 S 0.521 3.924 +- 3.754
105 Y 0.522 3.931 +- 3.756
106 T 0.521 3.923 +- 3.754
107 Q 0.524 3.948 +- 3.759
108 S 0.522 3.931 +- 3.756
109 E 0.521 3.925 +- 3.755
110 A 0.523 3.939 +- 3.757
111 S 0.521 3.924 +- 3.754
112 S 0.521 3.924 +- 3.754
113 C 0.523 3.940 +- 3.757
114 L 0.522 3.938 +- 3.757
115 M 0.520 3.919 +- 3.753
116 L 0.523 3.939 +- 3.757
117 H 0.522 3.932 +- 3.756
118 G 0.523 3.940 +- 3.757
119 E 0.521 3.925 +- 3.755
120 E 0.523 3.943 +- 3.758
121 K 0.523 3.943 +- 3.758
122 N 0.523 3.940 +- 3.757
123 P 0.523 3.939 +- 3.757
124 L 0.522 3.938 +- 3.757
125 A 0.523 3.939 +- 3.757
126 P 0.521 3.924 +- 3.754
127 S 0.522 3.931 +- 3.756
128 A 0.521 3.923 +- 3.754
129 K 0.521 3.927 +- 3.755
130 A 0.523 3.939 +- 3.757
131 H 0.522 3.932 +- 3.756
132 A 0.521 3.929 +- 3.755
133 F 0.521 3.929 +- 3.755
134 C 0.522 3.932 +- 3.756
135 A 0.521 3.923 +- 3.754
136 A 0.521 3.923 +- 3.754
137 L 0.523 3.939 +- 3.757
138 L 0.521 3.929 +- 3.755
139 T 0.521 3.923 +- 3.754
140 V 0.523 3.939 +- 3.757
141 G 0.523 3.943 +- 3.758
142 V 0.521 3.929 +- 3.755
143 R 0.522 3.931 +- 3.756
144 T 0.521 3.923 +- 3.754
145 G 0.522 3.932 +- 3.756
146 P 0.523 3.939 +- 3.757
147 C 0.523 3.940 +- 3.757
148 R 0.521 3.926 +- 3.755
149 H 0.523 3.940 +- 3.757
150 P 0.980* 7.211 +- 2.570
151 R 0.524 3.949 +- 3.759
152 R 0.524 3.949 +- 3.759
153 D 0.522 3.931 +- 3.756
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
