--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Wed Nov 02 15:41:57 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/138/CG4036-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1991.87 -2002.53
2 -1991.98 -2001.23
--------------------------------------
TOTAL -1991.92 -2002.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.332496 0.002879 0.229203 0.433222 0.327453 1031.69 1173.30 1.000
r(A<->C){all} 0.075611 0.000730 0.026556 0.128975 0.073943 809.45 850.25 1.000
r(A<->G){all} 0.190119 0.001901 0.112214 0.280409 0.186920 843.27 845.54 1.000
r(A<->T){all} 0.108213 0.001282 0.043584 0.179724 0.105112 844.45 991.85 1.000
r(C<->G){all} 0.039748 0.000338 0.007656 0.075205 0.037530 927.97 1031.50 1.000
r(C<->T){all} 0.465573 0.003902 0.347164 0.588151 0.464846 641.75 667.88 1.000
r(G<->T){all} 0.120736 0.001116 0.059806 0.186650 0.118597 693.59 951.84 1.000
pi(A){all} 0.249578 0.000187 0.221597 0.275023 0.249467 1213.11 1244.34 1.000
pi(C){all} 0.266669 0.000202 0.239197 0.294829 0.266650 1203.42 1284.49 1.000
pi(G){all} 0.274923 0.000211 0.247489 0.303375 0.274998 1159.70 1330.35 1.000
pi(T){all} 0.208831 0.000160 0.184585 0.233665 0.208557 1281.20 1306.31 1.000
alpha{1,2} 0.041770 0.000847 0.000167 0.095557 0.038512 1381.24 1382.24 1.000
alpha{3} 2.694875 0.792477 1.216518 4.481324 2.575224 1350.70 1365.88 1.000
pinvar{all} 0.401152 0.007453 0.232133 0.559242 0.411596 1112.38 1189.21 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1889.964519
Model 2: PositiveSelection -1889.964519
Model 0: one-ratio -1895.569596
Model 3: discrete -1889.30792
Model 7: beta -1889.460509
Model 8: beta&w>1 -1889.460533
Model 0 vs 1 11.210153999999875
Model 2 vs 1 0.0
Model 8 vs 7 4.799999987881165E-5
>C1
MNTIRPCGCKGVRTCLSCEQDFHIAKTSLREQFQQLEAWSYCIQCDLLQR
GWDTNHVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQSGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGVDIQKGDPVREKSQIF
WQIN
>C2
MNTIRPCGCKGVRTCLSCEQNFQIAKTSLKEQFQQLEAWSYCIQCDLLQP
GWDTNQVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQQGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGADIQKGDPVREKSQIF
WQIN
>C3
MNTIRPCGCKGVRTCLGCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
GWDTTKVQKDHEHHKKDEGLPLPGILVQENFLSEEEGSQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQPGKYNLDLVASYENELVAPLLIEDQLVSFEGKVLRIPMPNLSLIALYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQQGDPVREKSQIF
WQIN
>C4
MNTIRPCGCKGVRTCLSCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
GWDTTKVQKDHEHHKKDEGLPLPGILVQEKFLSAEEGSRLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDAVLTLTPFEV
QPPGKYNLDLVASYEDELLAPLLNEDQLASFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQKGDPVREKSHIF
WQIN
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=304
C1 MNTIRPCGCKGVRTCLSCEQDFHIAKTSLREQFQQLEAWSYCIQCDLLQR
C2 MNTIRPCGCKGVRTCLSCEQNFQIAKTSLKEQFQQLEAWSYCIQCDLLQP
C3 MNTIRPCGCKGVRTCLGCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
C4 MNTIRPCGCKGVRTCLSCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
****************.***:*:***.**:*******************
C1 GWDTNHVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
C2 GWDTNQVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
C3 GWDTTKVQKDHEHHKKDEGLPLPGILVQENFLSEEEGSQLIADLDDLPWD
C4 GWDTTKVQKDHEHHKKDEGLPLPGILVQEKFLSAEEGSRLIADLDDLPWD
****.:******:****************:*** :**::***********
C1 ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
C2 ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
C3 ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
C4 ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
******************************************:*******
C1 QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
C2 QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
C3 QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
C4 QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDAVLTLTPFEV
****************************************:******:**
C1 QQSGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
C2 QQQGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
C3 QQPGKYNLDLVASYENELVAPLLIEDQLVSFEGKVLRIPMPNLSLIALYG
C4 QPPGKYNLDLVASYEDELLAPLLNEDQLASFEGKVLRIPMPNLSLIVLYG
* ************:**:**** :***.:****************.***
C1 PARYQFEHSVLREDVQERRVCVAYREFTPMYINGVDIQKGDPVREKSQIF
C2 PARYQFEHSVLREDVQERRVCVAYREFTPMYINGADIQKGDPVREKSQIF
C3 PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQQGDPVREKSQIF
C4 PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQKGDPVREKSHIF
********************************** ***:********:**
C1 WQIN
C2 WQIN
C3 WQIN
C4 WQIN
****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 304 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 304 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3648]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [3648]--->[3648]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/138/CG4036-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.236 Mb, Max= 30.502 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MNTIRPCGCKGVRTCLSCEQDFHIAKTSLREQFQQLEAWSYCIQCDLLQR
GWDTNHVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQSGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGVDIQKGDPVREKSQIF
WQIN
>C2
MNTIRPCGCKGVRTCLSCEQNFQIAKTSLKEQFQQLEAWSYCIQCDLLQP
GWDTNQVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQQGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGADIQKGDPVREKSQIF
WQIN
>C3
MNTIRPCGCKGVRTCLGCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
GWDTTKVQKDHEHHKKDEGLPLPGILVQENFLSEEEGSQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQPGKYNLDLVASYENELVAPLLIEDQLVSFEGKVLRIPMPNLSLIALYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQQGDPVREKSQIF
WQIN
>C4
MNTIRPCGCKGVRTCLSCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
GWDTTKVQKDHEHHKKDEGLPLPGILVQEKFLSAEEGSRLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDAVLTLTPFEV
QPPGKYNLDLVASYEDELLAPLLNEDQLASFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQKGDPVREKSHIF
WQIN
FORMAT of file /tmp/tmp1530581682032076983aln Not Supported[FATAL:T-COFFEE]
>C1
MNTIRPCGCKGVRTCLSCEQDFHIAKTSLREQFQQLEAWSYCIQCDLLQR
GWDTNHVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQSGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGVDIQKGDPVREKSQIF
WQIN
>C2
MNTIRPCGCKGVRTCLSCEQNFQIAKTSLKEQFQQLEAWSYCIQCDLLQP
GWDTNQVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQQGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGADIQKGDPVREKSQIF
WQIN
>C3
MNTIRPCGCKGVRTCLGCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
GWDTTKVQKDHEHHKKDEGLPLPGILVQENFLSEEEGSQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQPGKYNLDLVASYENELVAPLLIEDQLVSFEGKVLRIPMPNLSLIALYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQQGDPVREKSQIF
WQIN
>C4
MNTIRPCGCKGVRTCLSCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
GWDTTKVQKDHEHHKKDEGLPLPGILVQEKFLSAEEGSRLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDAVLTLTPFEV
QPPGKYNLDLVASYEDELLAPLLNEDQLASFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQKGDPVREKSHIF
WQIN
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:304 S:100 BS:304
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 97.70 C1 C2 97.70
TOP 1 0 97.70 C2 C1 97.70
BOT 0 2 92.43 C1 C3 92.43
TOP 2 0 92.43 C3 C1 92.43
BOT 0 3 92.76 C1 C4 92.76
TOP 3 0 92.76 C4 C1 92.76
BOT 1 2 92.76 C2 C3 92.76
TOP 2 1 92.76 C3 C2 92.76
BOT 1 3 93.09 C2 C4 93.09
TOP 3 1 93.09 C4 C2 93.09
BOT 2 3 95.39 C3 C4 95.39
TOP 3 2 95.39 C4 C3 95.39
AVG 0 C1 * 94.30
AVG 1 C2 * 94.52
AVG 2 C3 * 93.53
AVG 3 C4 * 93.75
TOT TOT * 94.02
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAATACAATTCGTCCTTGCGGTTGTAAGGGCGTTCGCACCTGCTTGAG
C2 ATGAATACAATTCGTCCTTGCGGTTGTAAGGGCGTGCGCACCTGCTTGAG
C3 ATGAATACAATTCGTCCTTGCGGTTGCAAGGGTGTGCGCACCTGCTTAGG
C4 ATGAATACAATTCGTCCTTGTGGTTGCAAGGGTGTGCGCACCTGCTTAAG
******************** ***** ***** ** ***********..*
C1 CTGCGAACAGGACTTTCATATAGCGAAGACCTCGCTACGGGAACAATTCC
C2 CTGCGAACAGAACTTTCAGATAGCGAAGACCTCGCTAAAGGAGCAATTCC
C3 CTGCGAACAGGACTTTCAGATAGCGAAGCCCTCGCTGCAGGAACAGTTCC
C4 CTGCGAACAGGACTTTCAGATAGCGAAGCCCTCGCTGCAGGAGCAGTTCC
**********.******* *********.*******...***.**.****
C1 AGCAACTGGAAGCATGGTCCTACTGTATCCAGTGCGACCTTCTGCAGCGC
C2 AGCAACTGGAAGCTTGGTCCTACTGTATCCAGTGCGATCTTCTGCAGCCC
C3 AGCAACTGGAAGCCTGGTCCTACTGCATCCAGTGCGACCTACTGCAGCCC
C4 AGCAACTGGAAGCCTGGTCCTACTGCATCCAGTGCGATCTTCTGCAGCCG
************* *********** *********** **:*******
C1 GGTTGGGATACCAATCATGTCCAAAAGGATCATGAAAATCACAAAAAAGA
C2 GGTTGGGATACCAATCAAGTCCAAAAGGATCATGAAAATCACAAAAAAGA
C3 GGTTGGGATACCACTAAAGTCCAAAAGGATCATGAACATCACAAAAAGGA
C4 GGTTGGGATACCACTAAAGTCCAAAAGGATCATGAACATCACAAAAAGGA
*************.*.*:******************.**********.**
C1 TGAGGGCCTCCCACTGCCGGGCATCCTGGTGCAGGAGGAATTCCTTAGCG
C2 TGAGGGCCTCCCACTGCCGGGCATCCTGGTGCAGGAGGAATTTCTTAGCG
C3 TGAGGGCCTTCCGCTGCCGGGCATCCTGGTGCAGGAGAACTTCCTCAGTG
C4 CGAGGGCCTTCCACTGCCGGGCATCCTGGTGCAGGAGAAATTCCTCAGTG
******** **.************************.*.** ** ** *
C1 TTGATGAGGGCGCCCAACTTATAGCCGACTTGGATGACCTGCCATGGGAC
C2 TGGATGAGGGCGCCCAACTTATAGCCGACTTGGATGACCTGCCATGGGAC
C3 AGGAGGAAGGCTCCCAACTGATAGCCGACCTGGACGACCTGCCATGGGAC
C4 CGGAGGAGGGCTCCCGACTGATAGCCGACCTGGATGACCTGCCATGGGAC
** **.*** ***.*** ********* **** ***************
C1 ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT
C2 ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT
C3 ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT
C4 ATCTCGCAGAGCGGCAGGCGGAAACAGAACTTCGGACCCAAGACTAACTT
********************.*********************** *****
C1 TAAAAAGCGCAAACTGCGGCTGGGATCCTTTGCCGGATTCCCCAGGACAA
C2 TAAAAAGCGGAAACTGCGGTTGGGTTCCTTTGCAGGATTTCCTAGGACTA
C3 CAAGAAACGCAAACTGCGGTTGGGATCCTTTGCAGGATTCCCCAGGACAA
C4 CAAAAAGCGCAAGCTGCGTTTGGGATCTTTTGCAGGATTCCCCAGGACAA
**.**.** **.***** ****:** *****.***** ** *****:*
C1 CGGAATATGTGCAACGGCGCTTCGAAGACGTTCCCCTGCTTCGTGGCTTT
C2 CGGAATATGTGCAACGGCGCTTCGAAGACGTTCCCCTTCTTCGTGGCTTC
C3 CGGAATACGTGCAGCGGCGCTTCGAAGAGGTTCCCCTGCTTCGTGGCTTT
C4 CGGAATACGTGCAGCGGCGCTTCGAAGAGGTTCCCCTGCTTCGTGGCTTT
******* *****.************** ******** ***********
C1 CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG
C2 CAGACCATTGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG
C3 CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGGGCCAG
C4 CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG
******** ***********************************.*****
C1 CATAGATCCGCACGTGGACGATTGCTGGATCTGGGGCGAGCGTGTGGTCA
C2 CATAGATCCGCACGTGGACGATTGCTGGATCTGGGGCGAGCGTGTGGTCA
C3 CATAGATCCGCACGTGGACGACTGCTGGATCTGGGGCGAGCGAGTGGTCA
C4 CATAGATCCGCACGTGGACGATTGCTGGATTTGGGGAGAGCGAGTGGTGA
********************* ******** *****.*****:***** *
C1 CTGTCAACTGCCTCGGCGACTCAGTGCTCACTTTGACGCCCTACGAAGTT
C2 CTGTAAACTGCCTCGGCGACTCAGTGCTCACTCTGACGCCGTACGAAGTC
C3 CTGTCAACTGCCTCGGCGACTCTGTGCTCACTCTGACTCCCTACGAAGTC
C4 CTGTCAACTGCCTCGGCGACGCCGTGCTCACGCTGACGCCCTTCGAAGTC
****.*************** * ******** **** ** *:******
C1 CAACAATCGGGCAAGTACAACTTGGACTTGGTTGCCAGCTACGAAGATGA
C2 CAACAACAGGGCAAGTACAACTTGGACCTGGTGGCCAGCTACGAAGATGA
C3 CAGCAACCGGGGAAGTATAACTTGGACTTGGTGGCTAGCTACGAAAATGA
C4 CAACCACCGGGCAAGTATAACTTGGACTTGGTGGCTAGCTACGAGGATGA
**.*.* .*** ***** ********* **** ** ********..****
C1 ACTATTGGCGCCTCTACTGACAGATGACCAACTTGCAACTTTTGAGGGAA
C2 ACTATTGGCGCCTCTGCTGACAGATGACCAACTTGCAACTTTTGAGGGAA
C3 ACTGGTGGCGCCTCTGTTGATTGAGGACCAACTTGTCAGTTTCGAAGGAA
C4 ACTGCTGGCGCCGCTGTTGAATGAGGACCAACTTGCCAGTTTCGAGGGCA
***. ******* **. *** :** ********** .* *** **.**.*
C1 AGGTGCTGCGCATACCTATGCCAAACCTCTCCTTGATAGTTTTGTATGGG
C2 AGGTGCTGCGCATACCTATGCCAAACCTCTCCCTGATAGTTTTGTATGGA
C3 AGGTGTTGCGGATTCCTATGCCAAATCTCTCCCTGATTGCGTTGTATGGA
C4 AGGTGCTGCGCATCCCTATGCCAAATCTTTCCTTGATAGTTTTGTATGGA
***** **** ** *********** ** *** ****:* ********.
C1 CCAGCGAGGTACCAGTTTGAGCATTCTGTACTACGCGAGGATGTCCAAGA
C2 CCAGCGAGGTACCAGTTTGAGCATTCTGTACTACGCGAGGATGTCCAAGA
C3 CCAGCGAGGTACCAGTTCGAGCATTCTGTACTCCGCGAGGATGTCCAGGA
C4 CCAGCGAGGTACCAGTTTGAGCATTCCGTGCTCCGCGAGGATGTCCAGGA
***************** ******** **.**.**************.**
C1 GCGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATCAATG
C2 GCGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATTAATG
C3 ACGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATCAATG
C4 ACGCCGCGTGTGTGTTGCCTACCGGGAGTTTACGCCCATGTACATCAATG
.******** *****:***************************** ****
C1 GCGTAGACATCCAAAAGGGAGATCCTGTCCGAGAAAAGTCTCAGATATTC
C2 GAGCAGACATCCAGAAGGGAGATCCTGTCCGAGAGAAGTCTCAGATATTC
C3 GAGAAGATATCCAACAGGGGGATCCTGTTCGTGAAAAGTCCCAGATATTT
C4 GAGAAGATATCCAAAAGGGGGATCCTGTCCGAGAAAAGTCCCACATATTT
*.* *** *****..****.******** **:**.***** ** *****
C1 TGGCAAATAAAC
C2 TGGCAAATAAAC
C3 TGGCAAATAAAC
C4 TGGCAAATAAAC
************
>C1
ATGAATACAATTCGTCCTTGCGGTTGTAAGGGCGTTCGCACCTGCTTGAG
CTGCGAACAGGACTTTCATATAGCGAAGACCTCGCTACGGGAACAATTCC
AGCAACTGGAAGCATGGTCCTACTGTATCCAGTGCGACCTTCTGCAGCGC
GGTTGGGATACCAATCATGTCCAAAAGGATCATGAAAATCACAAAAAAGA
TGAGGGCCTCCCACTGCCGGGCATCCTGGTGCAGGAGGAATTCCTTAGCG
TTGATGAGGGCGCCCAACTTATAGCCGACTTGGATGACCTGCCATGGGAC
ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT
TAAAAAGCGCAAACTGCGGCTGGGATCCTTTGCCGGATTCCCCAGGACAA
CGGAATATGTGCAACGGCGCTTCGAAGACGTTCCCCTGCTTCGTGGCTTT
CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG
CATAGATCCGCACGTGGACGATTGCTGGATCTGGGGCGAGCGTGTGGTCA
CTGTCAACTGCCTCGGCGACTCAGTGCTCACTTTGACGCCCTACGAAGTT
CAACAATCGGGCAAGTACAACTTGGACTTGGTTGCCAGCTACGAAGATGA
ACTATTGGCGCCTCTACTGACAGATGACCAACTTGCAACTTTTGAGGGAA
AGGTGCTGCGCATACCTATGCCAAACCTCTCCTTGATAGTTTTGTATGGG
CCAGCGAGGTACCAGTTTGAGCATTCTGTACTACGCGAGGATGTCCAAGA
GCGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATCAATG
GCGTAGACATCCAAAAGGGAGATCCTGTCCGAGAAAAGTCTCAGATATTC
TGGCAAATAAAC
>C2
ATGAATACAATTCGTCCTTGCGGTTGTAAGGGCGTGCGCACCTGCTTGAG
CTGCGAACAGAACTTTCAGATAGCGAAGACCTCGCTAAAGGAGCAATTCC
AGCAACTGGAAGCTTGGTCCTACTGTATCCAGTGCGATCTTCTGCAGCCC
GGTTGGGATACCAATCAAGTCCAAAAGGATCATGAAAATCACAAAAAAGA
TGAGGGCCTCCCACTGCCGGGCATCCTGGTGCAGGAGGAATTTCTTAGCG
TGGATGAGGGCGCCCAACTTATAGCCGACTTGGATGACCTGCCATGGGAC
ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT
TAAAAAGCGGAAACTGCGGTTGGGTTCCTTTGCAGGATTTCCTAGGACTA
CGGAATATGTGCAACGGCGCTTCGAAGACGTTCCCCTTCTTCGTGGCTTC
CAGACCATTGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG
CATAGATCCGCACGTGGACGATTGCTGGATCTGGGGCGAGCGTGTGGTCA
CTGTAAACTGCCTCGGCGACTCAGTGCTCACTCTGACGCCGTACGAAGTC
CAACAACAGGGCAAGTACAACTTGGACCTGGTGGCCAGCTACGAAGATGA
ACTATTGGCGCCTCTGCTGACAGATGACCAACTTGCAACTTTTGAGGGAA
AGGTGCTGCGCATACCTATGCCAAACCTCTCCCTGATAGTTTTGTATGGA
CCAGCGAGGTACCAGTTTGAGCATTCTGTACTACGCGAGGATGTCCAAGA
GCGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATTAATG
GAGCAGACATCCAGAAGGGAGATCCTGTCCGAGAGAAGTCTCAGATATTC
TGGCAAATAAAC
>C3
ATGAATACAATTCGTCCTTGCGGTTGCAAGGGTGTGCGCACCTGCTTAGG
CTGCGAACAGGACTTTCAGATAGCGAAGCCCTCGCTGCAGGAACAGTTCC
AGCAACTGGAAGCCTGGTCCTACTGCATCCAGTGCGACCTACTGCAGCCC
GGTTGGGATACCACTAAAGTCCAAAAGGATCATGAACATCACAAAAAGGA
TGAGGGCCTTCCGCTGCCGGGCATCCTGGTGCAGGAGAACTTCCTCAGTG
AGGAGGAAGGCTCCCAACTGATAGCCGACCTGGACGACCTGCCATGGGAC
ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT
CAAGAAACGCAAACTGCGGTTGGGATCCTTTGCAGGATTCCCCAGGACAA
CGGAATACGTGCAGCGGCGCTTCGAAGAGGTTCCCCTGCTTCGTGGCTTT
CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGGGCCAG
CATAGATCCGCACGTGGACGACTGCTGGATCTGGGGCGAGCGAGTGGTCA
CTGTCAACTGCCTCGGCGACTCTGTGCTCACTCTGACTCCCTACGAAGTC
CAGCAACCGGGGAAGTATAACTTGGACTTGGTGGCTAGCTACGAAAATGA
ACTGGTGGCGCCTCTGTTGATTGAGGACCAACTTGTCAGTTTCGAAGGAA
AGGTGTTGCGGATTCCTATGCCAAATCTCTCCCTGATTGCGTTGTATGGA
CCAGCGAGGTACCAGTTCGAGCATTCTGTACTCCGCGAGGATGTCCAGGA
ACGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATCAATG
GAGAAGATATCCAACAGGGGGATCCTGTTCGTGAAAAGTCCCAGATATTT
TGGCAAATAAAC
>C4
ATGAATACAATTCGTCCTTGTGGTTGCAAGGGTGTGCGCACCTGCTTAAG
CTGCGAACAGGACTTTCAGATAGCGAAGCCCTCGCTGCAGGAGCAGTTCC
AGCAACTGGAAGCCTGGTCCTACTGCATCCAGTGCGATCTTCTGCAGCCG
GGTTGGGATACCACTAAAGTCCAAAAGGATCATGAACATCACAAAAAGGA
CGAGGGCCTTCCACTGCCGGGCATCCTGGTGCAGGAGAAATTCCTCAGTG
CGGAGGAGGGCTCCCGACTGATAGCCGACCTGGATGACCTGCCATGGGAC
ATCTCGCAGAGCGGCAGGCGGAAACAGAACTTCGGACCCAAGACTAACTT
CAAAAAGCGCAAGCTGCGTTTGGGATCTTTTGCAGGATTCCCCAGGACAA
CGGAATACGTGCAGCGGCGCTTCGAAGAGGTTCCCCTGCTTCGTGGCTTT
CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG
CATAGATCCGCACGTGGACGATTGCTGGATTTGGGGAGAGCGAGTGGTGA
CTGTCAACTGCCTCGGCGACGCCGTGCTCACGCTGACGCCCTTCGAAGTC
CAACCACCGGGCAAGTATAACTTGGACTTGGTGGCTAGCTACGAGGATGA
ACTGCTGGCGCCGCTGTTGAATGAGGACCAACTTGCCAGTTTCGAGGGCA
AGGTGCTGCGCATCCCTATGCCAAATCTTTCCTTGATAGTTTTGTATGGA
CCAGCGAGGTACCAGTTTGAGCATTCCGTGCTCCGCGAGGATGTCCAGGA
ACGCCGCGTGTGTGTTGCCTACCGGGAGTTTACGCCCATGTACATCAATG
GAGAAGATATCCAAAAGGGGGATCCTGTCCGAGAAAAGTCCCACATATTT
TGGCAAATAAAC
>C1
MNTIRPCGCKGVRTCLSCEQDFHIAKTSLREQFQQLEAWSYCIQCDLLQR
GWDTNHVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQSGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGVDIQKGDPVREKSQIF
WQIN
>C2
MNTIRPCGCKGVRTCLSCEQNFQIAKTSLKEQFQQLEAWSYCIQCDLLQP
GWDTNQVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQQGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGADIQKGDPVREKSQIF
WQIN
>C3
MNTIRPCGCKGVRTCLGCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
GWDTTKVQKDHEHHKKDEGLPLPGILVQENFLSEEEGSQLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
QQPGKYNLDLVASYENELVAPLLIEDQLVSFEGKVLRIPMPNLSLIALYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQQGDPVREKSQIF
WQIN
>C4
MNTIRPCGCKGVRTCLSCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
GWDTTKVQKDHEHHKKDEGLPLPGILVQEKFLSAEEGSRLIADLDDLPWD
ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDAVLTLTPFEV
QPPGKYNLDLVASYEDELLAPLLNEDQLASFEGKVLRIPMPNLSLIVLYG
PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQKGDPVREKSHIF
WQIN
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 912 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1478101120
Setting output file names to "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 711987754
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 1906359323
Seed = 259620048
Swapseed = 1478101120
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 22 unique site patterns
Division 2 has 17 unique site patterns
Division 3 has 50 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2176.063817 -- -26.620141
Chain 2 -- -2286.269131 -- -26.620141
Chain 3 -- -2286.269131 -- -26.620141
Chain 4 -- -2176.063817 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2286.269131 -- -26.620141
Chain 2 -- -2288.924155 -- -26.620141
Chain 3 -- -2286.269131 -- -26.620141
Chain 4 -- -2286.269131 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2176.064] (-2286.269) (-2286.269) (-2176.064) * [-2286.269] (-2288.924) (-2286.269) (-2286.269)
500 -- (-2030.461) (-2032.618) [-2034.516] (-2042.083) * (-2032.078) (-2034.437) (-2034.453) [-2028.905] -- 0:00:00
1000 -- [-2023.652] (-2036.912) (-2025.217) (-2035.102) * (-2024.854) (-2017.745) [-2016.635] (-2018.640) -- 0:00:00
1500 -- (-2010.432) [-2008.842] (-2022.232) (-2022.951) * [-2013.221] (-2013.576) (-2007.498) (-2010.937) -- 0:00:00
2000 -- (-2001.820) [-2001.519] (-2006.161) (-2018.314) * (-2003.989) (-2003.255) (-2001.008) [-2002.269] -- 0:00:00
2500 -- (-1997.900) [-1999.059] (-2003.200) (-2011.826) * (-1999.710) (-1994.785) [-2001.770] (-2010.446) -- 0:00:00
3000 -- (-1993.288) (-2000.822) [-2002.773] (-2011.459) * (-2000.364) (-1991.664) [-1994.424] (-1996.591) -- 0:00:00
3500 -- (-1990.069) (-1998.766) [-1993.448] (-2007.270) * [-2003.506] (-1993.576) (-1997.607) (-1996.787) -- 0:00:00
4000 -- [-1994.018] (-2001.680) (-1994.888) (-1997.257) * (-1994.594) (-1997.226) (-1991.904) [-1992.679] -- 0:00:00
4500 -- (-1996.139) (-1997.753) [-1993.074] (-1996.350) * (-1998.919) [-1997.153] (-1995.124) (-2002.626) -- 0:00:00
5000 -- [-1993.782] (-2000.518) (-1993.622) (-1998.294) * (-1999.759) (-1998.296) (-1996.519) [-1997.469] -- 0:00:00
Average standard deviation of split frequencies: 0.000000
5500 -- [-1996.050] (-2004.022) (-1998.335) (-1993.707) * (-2005.421) [-1995.036] (-1996.312) (-1996.899) -- 0:03:00
6000 -- (-1994.395) (-2004.101) [-1993.931] (-1994.560) * [-1991.410] (-1993.759) (-1993.534) (-2005.868) -- 0:02:45
6500 -- (-1995.320) (-2001.909) (-1989.492) [-1990.387] * (-1996.632) (-1995.088) [-1999.906] (-2009.003) -- 0:02:32
7000 -- (-1994.723) (-1998.177) [-2002.208] (-1992.068) * (-1992.513) (-2004.757) [-1995.350] (-1996.472) -- 0:02:21
7500 -- (-1996.631) (-1990.956) (-2001.448) [-1998.851] * (-2002.407) (-1997.273) [-1995.699] (-1992.989) -- 0:02:12
8000 -- (-1998.933) (-1992.487) (-1997.051) [-1998.920] * (-1993.558) (-1998.530) [-1995.637] (-2001.053) -- 0:02:04
8500 -- (-1996.072) (-2000.294) [-1996.003] (-1993.184) * [-1995.706] (-1991.855) (-1992.202) (-1991.802) -- 0:01:56
9000 -- (-2002.454) (-1998.980) (-1995.290) [-1997.502] * [-1994.753] (-1992.125) (-1999.848) (-1993.040) -- 0:01:50
9500 -- [-1989.262] (-1996.544) (-1996.795) (-1996.254) * (-1992.190) [-1994.165] (-1993.246) (-1996.473) -- 0:01:44
10000 -- [-1993.739] (-1995.824) (-2000.289) (-1997.929) * [-1993.497] (-1990.788) (-2000.652) (-1999.243) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
10500 -- (-1999.388) (-2003.884) (-1993.783) [-1993.831] * (-1998.334) (-1993.985) [-1994.940] (-1998.814) -- 0:01:34
11000 -- (-1995.380) (-2002.683) (-1992.351) [-1996.219] * (-1994.748) (-1999.100) (-1993.466) [-1995.968] -- 0:01:29
11500 -- [-1996.985] (-1997.144) (-1991.308) (-1996.854) * (-2002.321) (-2001.657) (-1994.154) [-1996.016] -- 0:01:25
12000 -- (-1994.416) (-2002.692) (-1991.121) [-1998.630] * [-1991.776] (-2000.865) (-1995.046) (-1997.519) -- 0:02:44
12500 -- (-1997.039) (-2002.579) (-1993.883) [-1994.626] * [-1995.102] (-1998.502) (-1991.388) (-1991.416) -- 0:02:38
13000 -- (-1997.921) [-1999.333] (-1995.150) (-1993.100) * [-1993.663] (-2000.838) (-2000.453) (-1993.075) -- 0:02:31
13500 -- (-2001.783) [-1992.655] (-1990.496) (-1991.264) * (-1993.860) (-1993.782) [-1995.963] (-1995.326) -- 0:02:26
14000 -- (-1999.478) [-1993.518] (-1991.466) (-1992.456) * [-1998.389] (-1996.451) (-1997.291) (-1991.517) -- 0:02:20
14500 -- (-2001.037) (-1993.566) [-1994.992] (-1994.017) * (-1999.870) (-1994.631) (-1993.151) [-1996.143] -- 0:02:15
15000 -- (-1990.175) (-1992.149) [-1994.591] (-1992.568) * [-1996.534] (-1994.820) (-1998.473) (-2002.435) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
15500 -- (-1990.062) (-1994.318) [-1996.513] (-1995.402) * (-1991.087) (-1996.782) (-1992.314) [-1995.710] -- 0:02:07
16000 -- [-1989.009] (-1997.961) (-1997.748) (-1993.403) * [-1999.388] (-1993.226) (-2002.551) (-1995.364) -- 0:02:03
16500 -- [-1991.907] (-1996.179) (-1999.511) (-1991.834) * (-1992.721) [-1996.122] (-2008.323) (-1996.189) -- 0:01:59
17000 -- (-1998.272) (-1991.774) [-1997.955] (-1990.177) * (-1993.082) (-1991.238) (-2000.560) [-2000.825] -- 0:01:55
17500 -- [-1993.659] (-1995.215) (-1997.169) (-1997.654) * (-1997.006) (-1998.064) (-2000.653) [-1991.059] -- 0:01:52
18000 -- (-2000.734) [-1994.416] (-2007.871) (-1996.644) * (-1998.720) [-1995.315] (-2001.971) (-1995.890) -- 0:01:49
18500 -- (-1998.690) (-1993.719) (-2001.664) [-1995.042] * (-1995.020) [-1991.823] (-1998.488) (-1994.978) -- 0:02:39
19000 -- (-2002.833) (-1993.053) [-1997.884] (-1996.455) * [-1995.938] (-1993.511) (-1991.853) (-1993.863) -- 0:02:34
19500 -- (-1993.530) (-1993.350) (-1992.191) [-1997.282] * (-1992.716) [-1994.882] (-2002.942) (-1995.721) -- 0:02:30
20000 -- (-1992.078) (-1991.469) [-1998.157] (-1998.643) * (-1998.008) (-1997.976) (-1998.820) [-1993.068] -- 0:02:27
Average standard deviation of split frequencies: 0.000000
20500 -- (-1992.280) (-1996.210) [-1996.422] (-2002.140) * (-1998.291) (-1995.077) (-2001.537) [-1995.360] -- 0:02:23
21000 -- (-1997.905) [-1994.373] (-1995.888) (-1995.104) * (-1994.985) (-1997.291) [-1992.032] (-1996.623) -- 0:02:19
21500 -- (-1997.614) (-1992.401) [-1996.405] (-2000.168) * (-2001.858) (-2006.842) [-1991.790] (-1996.103) -- 0:02:16
22000 -- (-1991.564) [-1998.650] (-1995.934) (-1998.458) * (-2000.815) (-2007.907) [-1991.945] (-2002.118) -- 0:02:13
22500 -- [-1996.854] (-1992.779) (-1995.612) (-1997.546) * [-1997.371] (-1992.737) (-2003.438) (-1990.201) -- 0:02:10
23000 -- (-1996.936) (-1988.327) [-1995.335] (-2004.399) * [-1996.568] (-1993.289) (-1996.421) (-1992.174) -- 0:02:07
23500 -- (-1990.564) (-2004.482) (-1991.991) [-1997.039] * (-1992.427) [-1993.196] (-1999.060) (-1996.339) -- 0:02:04
24000 -- [-1994.789] (-2003.549) (-1992.674) (-1995.194) * (-1995.854) [-1989.789] (-1992.597) (-1997.106) -- 0:02:02
24500 -- [-1989.834] (-1996.852) (-1990.773) (-2002.450) * (-1993.743) (-1996.615) [-1996.829] (-1991.847) -- 0:01:59
25000 -- (-1990.924) [-1994.838] (-2000.660) (-1997.373) * (-1997.685) [-1995.565] (-1990.654) (-1999.853) -- 0:02:36
Average standard deviation of split frequencies: 0.000000
25500 -- (-1991.311) (-1996.633) (-2009.022) [-1998.803] * (-1993.640) (-1992.296) [-1991.665] (-1996.623) -- 0:02:32
26000 -- (-1992.886) (-1997.337) [-1996.387] (-1999.770) * (-1999.413) [-1998.492] (-1997.536) (-1996.262) -- 0:02:29
26500 -- (-1992.779) (-1996.155) (-1996.214) [-1993.422] * (-1993.818) (-1998.666) (-1997.896) [-1998.398] -- 0:02:26
27000 -- (-1989.143) (-1997.369) (-2000.345) [-1991.628] * (-1999.280) (-1998.271) (-1997.847) [-1992.142] -- 0:02:24
27500 -- (-1998.024) (-1997.330) (-1995.092) [-1992.611] * (-1999.868) [-1994.732] (-1996.049) (-1995.149) -- 0:02:21
28000 -- (-1995.047) (-1991.872) (-2000.682) [-1995.120] * (-1998.713) [-1996.374] (-1998.271) (-1997.917) -- 0:02:18
28500 -- (-1994.104) [-1997.046] (-1992.551) (-1992.859) * (-1993.548) (-1993.129) (-1997.598) [-2006.710] -- 0:02:16
29000 -- [-1999.581] (-1997.090) (-1993.843) (-1995.283) * (-1996.148) [-1997.599] (-1991.153) (-2000.157) -- 0:02:13
29500 -- [-1991.804] (-1993.263) (-1993.834) (-2002.771) * (-1996.774) [-1995.197] (-1995.720) (-1991.484) -- 0:02:11
30000 -- (-1992.713) (-1997.600) (-1998.220) [-1990.723] * [-1993.268] (-1994.244) (-1994.518) (-1991.863) -- 0:02:09
Average standard deviation of split frequencies: 0.000000
30500 -- [-1990.669] (-2001.065) (-1995.195) (-2006.335) * (-1996.261) [-1990.902] (-1995.963) (-1997.450) -- 0:02:07
31000 -- [-1995.952] (-1991.939) (-1995.211) (-1995.917) * (-1995.432) (-1992.561) (-1989.336) [-1993.934] -- 0:02:05
31500 -- (-1997.712) (-1995.864) (-1994.468) [-1993.438] * (-1999.180) (-1997.004) [-1997.909] (-1994.138) -- 0:02:33
32000 -- (-2001.432) (-1996.675) [-1993.016] (-1996.445) * (-1995.015) [-1990.396] (-1992.572) (-1996.426) -- 0:02:31
32500 -- (-1991.612) [-1989.612] (-1993.780) (-1996.896) * [-1992.909] (-1993.550) (-1995.706) (-1990.685) -- 0:02:28
33000 -- (-1995.750) (-1993.332) (-1993.392) [-1993.216] * (-1995.521) (-1994.582) [-1998.047] (-1995.012) -- 0:02:26
33500 -- [-1993.296] (-2004.938) (-1991.815) (-1997.623) * (-1996.528) (-1997.389) (-1995.075) [-1989.393] -- 0:02:24
34000 -- (-1997.406) (-1995.240) (-1989.679) [-1998.906] * (-1996.400) (-2000.510) (-1996.264) [-1989.771] -- 0:02:22
34500 -- (-1991.158) (-1991.731) (-1996.076) [-1990.755] * (-1994.658) (-2001.435) (-1993.784) [-1994.660] -- 0:02:19
35000 -- (-1993.263) (-1998.547) (-1992.769) [-1996.317] * (-1992.965) [-1996.548] (-1999.115) (-1995.746) -- 0:02:17
Average standard deviation of split frequencies: 0.000000
35500 -- [-1993.094] (-1996.528) (-1996.617) (-1994.822) * [-1992.971] (-1995.654) (-1994.462) (-1991.678) -- 0:02:15
36000 -- (-1996.794) (-1998.507) (-1997.635) [-1993.382] * [-1991.343] (-1996.909) (-1995.957) (-2002.827) -- 0:02:13
36500 -- (-1993.611) (-1993.410) (-1994.578) [-1998.018] * [-1994.299] (-1990.850) (-2001.992) (-1998.541) -- 0:02:11
37000 -- (-1997.244) (-1994.973) [-1992.395] (-1998.220) * [-1991.055] (-1998.129) (-1992.289) (-1997.707) -- 0:02:10
37500 -- (-1996.066) [-1998.694] (-1995.437) (-1995.084) * (-1998.790) (-2002.085) [-1996.863] (-1993.695) -- 0:02:08
38000 -- (-1999.450) (-1993.447) [-1994.137] (-2005.592) * (-1991.378) (-1994.265) (-1993.974) [-1994.543] -- 0:02:31
38500 -- [-1994.420] (-1993.820) (-1997.771) (-2000.832) * (-1995.494) (-1992.372) [-1994.759] (-2003.848) -- 0:02:29
39000 -- (-1993.134) (-1992.256) [-1995.088] (-1998.746) * (-1996.375) (-1993.270) (-2005.980) [-1996.097] -- 0:02:27
39500 -- [-1996.726] (-1995.802) (-1993.914) (-2002.103) * (-1993.442) (-1993.410) (-1995.328) [-1993.214] -- 0:02:25
40000 -- [-2000.062] (-1998.288) (-1994.925) (-1993.640) * (-1991.104) (-1995.862) [-2000.105] (-1993.466) -- 0:02:24
Average standard deviation of split frequencies: 0.000000
40500 -- (-1993.382) [-1997.237] (-1995.366) (-1991.296) * (-1990.979) (-2001.431) [-1999.971] (-1996.367) -- 0:02:22
41000 -- (-1996.102) (-1997.080) [-2004.227] (-2002.081) * (-1999.130) [-1993.979] (-1997.516) (-1996.361) -- 0:02:20
41500 -- (-1991.280) (-1995.868) (-1995.945) [-1993.337] * (-2002.440) [-1995.841] (-1995.488) (-1996.557) -- 0:02:18
42000 -- (-1996.391) [-1994.734] (-1995.958) (-1999.377) * [-1996.636] (-1990.934) (-1996.804) (-1995.709) -- 0:02:16
42500 -- (-1996.066) (-1995.443) [-1996.339] (-1994.542) * (-1995.844) [-1995.925] (-1993.920) (-1995.292) -- 0:02:15
43000 -- [-1992.109] (-1992.630) (-1993.192) (-1994.527) * [-1996.857] (-1992.809) (-1996.295) (-1992.454) -- 0:02:13
43500 -- [-1990.060] (-1991.414) (-2001.123) (-1994.476) * (-1992.694) [-1993.990] (-1994.633) (-1998.620) -- 0:02:11
44000 -- [-1995.467] (-1994.446) (-1996.399) (-2002.119) * (-1993.032) (-1994.770) [-1997.686] (-1995.334) -- 0:02:10
44500 -- (-1998.277) (-1991.400) [-1989.169] (-1997.333) * (-1992.515) (-1998.803) [-1993.077] (-1996.811) -- 0:02:30
45000 -- (-1996.671) (-1990.487) (-1991.366) [-1995.877] * [-1990.471] (-2003.684) (-1994.919) (-1997.582) -- 0:02:28
Average standard deviation of split frequencies: 0.000000
45500 -- (-1994.534) [-1995.754] (-1996.677) (-1993.200) * (-1993.537) (-2002.972) [-1993.082] (-1994.175) -- 0:02:26
46000 -- (-1998.720) (-1994.102) (-2001.356) [-1991.465] * (-1992.277) (-2006.218) [-1993.964] (-1994.482) -- 0:02:25
46500 -- [-2000.232] (-1994.222) (-1998.021) (-1998.029) * (-1995.394) (-1997.189) [-1998.942] (-1995.539) -- 0:02:23
47000 -- (-1995.219) [-1998.767] (-1993.950) (-1988.965) * [-1997.847] (-1994.218) (-1997.963) (-1991.315) -- 0:02:21
47500 -- [-1994.674] (-1992.121) (-1998.213) (-1994.101) * (-1994.891) (-1995.452) (-2005.361) [-1995.793] -- 0:02:20
48000 -- (-1995.438) [-1996.252] (-1994.046) (-1996.236) * (-1996.925) (-1991.931) [-1992.343] (-1993.712) -- 0:02:18
48500 -- (-2005.324) (-1997.424) [-1988.338] (-1993.329) * [-1997.546] (-1994.676) (-1994.300) (-1996.601) -- 0:02:17
49000 -- (-1995.327) [-1993.228] (-1996.971) (-1992.632) * (-1999.852) (-1995.806) (-1993.439) [-1997.069] -- 0:02:15
49500 -- (-1994.954) [-1996.130] (-1998.799) (-1990.989) * (-1994.461) (-1994.877) (-1990.910) [-1996.384] -- 0:02:14
50000 -- (-1998.335) [-1993.354] (-1998.334) (-1999.785) * (-1992.267) [-1993.569] (-1995.671) (-1996.614) -- 0:02:13
Average standard deviation of split frequencies: 0.000000
50500 -- (-1998.188) [-1990.733] (-1998.859) (-1991.649) * (-2000.652) (-1999.822) [-1995.727] (-2004.270) -- 0:02:11
51000 -- (-1993.136) (-1989.805) [-1995.607] (-1993.283) * (-1995.336) [-1992.602] (-1994.527) (-1999.257) -- 0:02:28
51500 -- [-1997.680] (-1993.472) (-1994.424) (-1995.496) * (-1997.110) [-1995.913] (-1995.184) (-1995.467) -- 0:02:27
52000 -- (-2002.957) (-1991.456) [-1995.863] (-1993.783) * [-2000.181] (-1991.471) (-1992.383) (-1993.517) -- 0:02:25
52500 -- (-1999.252) [-1991.458] (-1994.253) (-1993.045) * (-2005.035) [-1990.497] (-1995.824) (-2003.431) -- 0:02:24
53000 -- (-1999.880) [-1995.572] (-1994.076) (-1998.693) * [-1994.989] (-1994.099) (-1989.180) (-1995.594) -- 0:02:22
53500 -- (-1995.427) (-2000.411) [-1997.547] (-1997.628) * (-1997.717) (-1988.512) (-1990.918) [-1996.824] -- 0:02:21
54000 -- (-1997.238) (-2001.302) [-1992.680] (-1996.781) * (-1999.264) (-1989.271) [-1993.959] (-1991.350) -- 0:02:20
54500 -- (-1991.802) [-1995.084] (-1994.030) (-1998.077) * (-1996.970) (-1997.917) [-1989.713] (-2000.264) -- 0:02:18
55000 -- (-1994.573) (-2000.067) [-1992.292] (-1993.463) * (-1998.186) [-1990.124] (-1991.182) (-2002.342) -- 0:02:17
Average standard deviation of split frequencies: 0.000000
55500 -- (-1988.147) (-1997.175) (-1995.019) [-1989.648] * (-1997.238) (-1990.467) [-1995.322] (-2001.851) -- 0:02:16
56000 -- (-1991.919) [-1987.863] (-1995.279) (-1996.721) * (-1991.878) (-1999.614) (-1994.156) [-1990.208] -- 0:02:14
56500 -- [-1999.684] (-1998.839) (-1996.008) (-1995.718) * (-1998.689) [-1994.073] (-1991.988) (-1992.696) -- 0:02:13
57000 -- (-1996.640) (-1993.022) [-1994.428] (-1993.164) * (-1999.437) (-1992.977) [-1993.711] (-2002.164) -- 0:02:12
57500 -- (-1992.959) (-1995.777) [-1992.423] (-1999.261) * (-1994.758) (-2000.212) [-1996.999] (-1992.130) -- 0:02:11
58000 -- (-1991.464) (-1994.213) [-1992.008] (-1993.800) * (-1996.485) (-1995.099) (-1997.031) [-1995.693] -- 0:02:26
58500 -- [-1994.006] (-1996.442) (-1996.869) (-1996.320) * (-1997.752) [-1993.286] (-1994.325) (-1999.918) -- 0:02:24
59000 -- (-1998.108) (-2000.223) [-1993.390] (-1994.556) * (-1994.367) (-1990.251) (-1996.192) [-1992.720] -- 0:02:23
59500 -- (-1995.013) [-1996.954] (-1993.889) (-1999.143) * (-1991.156) (-1995.025) [-1989.787] (-1993.757) -- 0:02:22
60000 -- (-1992.511) (-1995.815) (-1994.254) [-2002.470] * (-1993.888) (-1997.625) [-1992.456] (-1992.834) -- 0:02:21
Average standard deviation of split frequencies: 0.000000
60500 -- (-1991.292) (-1998.908) (-1997.184) [-1991.702] * [-1993.223] (-1997.792) (-2003.044) (-1999.382) -- 0:02:19
61000 -- [-1993.861] (-1994.343) (-1992.480) (-1994.937) * [-1994.932] (-1995.330) (-1997.686) (-1997.981) -- 0:02:18
61500 -- (-1994.861) [-1994.798] (-1998.039) (-1993.956) * [-1999.109] (-1997.949) (-1996.295) (-1993.738) -- 0:02:17
62000 -- (-1992.507) (-1993.576) (-1995.920) [-1999.524] * (-1997.045) (-1997.813) [-1990.823] (-1995.792) -- 0:02:16
62500 -- (-1989.945) [-1988.686] (-2000.147) (-1995.270) * [-1993.831] (-1995.895) (-1996.277) (-1993.171) -- 0:02:15
63000 -- (-1994.966) [-1992.435] (-1997.071) (-1998.386) * (-1996.961) (-1994.502) (-1996.154) [-1997.196] -- 0:02:13
63500 -- (-1994.765) (-1994.068) [-1994.208] (-2001.645) * (-1996.494) [-1993.925] (-1995.282) (-1994.512) -- 0:02:12
64000 -- [-1997.165] (-1996.970) (-1995.782) (-1993.813) * [-1989.376] (-1995.951) (-1997.709) (-1995.910) -- 0:02:11
64500 -- (-1995.944) (-1999.669) (-2001.489) [-1995.921] * (-1992.717) (-1994.550) [-1991.953] (-1993.052) -- 0:02:25
65000 -- [-1999.854] (-1997.741) (-1995.959) (-1992.784) * [-1989.210] (-1993.628) (-1998.338) (-1995.369) -- 0:02:23
Average standard deviation of split frequencies: 0.000000
65500 -- (-1999.470) [-1993.589] (-1994.312) (-1995.450) * (-1993.066) (-1996.491) (-1990.719) [-1988.912] -- 0:02:22
66000 -- (-1996.862) (-1995.142) [-1991.511] (-1995.158) * (-1995.210) [-1996.005] (-2000.066) (-1993.115) -- 0:02:21
66500 -- (-1990.309) (-2001.551) [-1999.992] (-1992.719) * (-2000.694) (-1996.261) (-1995.682) [-1990.796] -- 0:02:20
67000 -- (-1994.533) (-1999.303) [-1993.782] (-1995.921) * (-1996.689) (-1993.501) (-1997.699) [-1994.719] -- 0:02:19
67500 -- (-1994.233) (-1997.660) [-1991.215] (-1994.942) * [-1996.619] (-1991.410) (-1997.437) (-1994.778) -- 0:02:18
68000 -- (-1993.034) (-2008.282) [-2000.174] (-1992.763) * [-1994.812] (-1993.690) (-1999.485) (-1997.505) -- 0:02:17
68500 -- (-1999.430) (-2003.812) [-1996.538] (-1995.090) * [-1994.417] (-1992.993) (-2003.039) (-1995.127) -- 0:02:15
69000 -- (-2002.552) (-1995.899) [-1990.184] (-1995.298) * [-1997.481] (-1997.853) (-1993.610) (-1994.266) -- 0:02:14
69500 -- (-2002.756) (-1995.614) [-1999.404] (-2001.078) * (-1993.048) (-1994.729) [-1991.773] (-1996.556) -- 0:02:13
70000 -- [-2009.163] (-1993.637) (-1994.087) (-1995.566) * (-1991.768) [-1991.915] (-1994.495) (-2000.375) -- 0:02:12
Average standard deviation of split frequencies: 0.000000
70500 -- (-1995.389) (-1992.053) [-1995.131] (-2002.013) * [-1999.884] (-1990.902) (-1993.087) (-1992.209) -- 0:02:11
71000 -- (-2003.908) (-1993.394) (-1995.602) [-1994.258] * (-1993.300) (-1996.576) (-2001.708) [-1991.608] -- 0:02:23
71500 -- (-1993.807) (-1993.570) [-1997.095] (-1995.094) * (-1995.526) [-1994.097] (-2001.944) (-2002.669) -- 0:02:22
72000 -- (-2002.380) [-2000.069] (-1998.988) (-1993.455) * [-1995.638] (-1992.826) (-2006.875) (-1996.891) -- 0:02:21
72500 -- (-2003.798) (-2002.134) (-2000.087) [-1996.980] * (-1996.649) (-1999.438) (-2003.681) [-1995.849] -- 0:02:20
73000 -- (-2000.147) (-1992.936) (-1988.757) [-1997.920] * [-1998.886] (-1994.485) (-1993.609) (-2003.655) -- 0:02:19
73500 -- (-2000.968) (-1994.468) [-1994.936] (-1991.844) * (-1998.554) [-1992.842] (-1999.838) (-2000.779) -- 0:02:18
74000 -- (-1992.783) (-1997.678) [-1998.960] (-1994.758) * (-1992.247) (-1991.856) [-1992.728] (-1999.952) -- 0:02:17
74500 -- (-1993.420) (-1996.472) (-1992.049) [-1996.800] * (-1999.207) (-1994.117) [-1995.196] (-2000.093) -- 0:02:16
75000 -- (-1990.144) [-1996.548] (-1996.395) (-1991.414) * (-1994.792) [-1997.032] (-1999.923) (-1997.748) -- 0:02:15
Average standard deviation of split frequencies: 0.000000
75500 -- (-1998.178) [-1994.855] (-1996.837) (-1999.122) * (-2001.720) (-1996.093) (-1992.205) [-1994.731] -- 0:02:14
76000 -- (-1997.529) [-1995.249] (-1999.776) (-1996.879) * (-1994.683) (-1994.532) [-1999.201] (-1991.181) -- 0:02:13
76500 -- (-1994.994) (-1994.929) [-1997.509] (-2000.081) * [-1991.684] (-1992.066) (-1997.630) (-1997.060) -- 0:02:12
77000 -- (-1995.937) (-2001.407) (-1994.608) [-1996.998] * [-1997.185] (-1993.068) (-1997.674) (-1992.104) -- 0:02:11
77500 -- [-1994.218] (-2002.061) (-1996.209) (-1997.619) * [-1993.254] (-1995.554) (-1999.369) (-2003.946) -- 0:02:22
78000 -- (-1991.561) (-1999.070) [-1993.873] (-1997.772) * [-1999.687] (-1994.291) (-1996.343) (-1994.468) -- 0:02:21
78500 -- (-1996.514) (-1998.460) (-2001.248) [-1999.896] * (-1997.160) [-1990.741] (-1997.597) (-1993.599) -- 0:02:20
79000 -- [-1998.702] (-1995.624) (-1995.780) (-1990.563) * (-1995.601) (-1990.949) [-1994.845] (-1994.704) -- 0:02:19
79500 -- (-1995.499) (-1993.909) (-1994.185) [-1990.610] * [-1997.209] (-1993.406) (-1998.205) (-1994.159) -- 0:02:18
80000 -- (-1994.016) [-1992.445] (-1990.827) (-1996.257) * (-1997.404) (-1993.533) (-1996.021) [-1995.327] -- 0:02:18
Average standard deviation of split frequencies: 0.000000
80500 -- (-1993.940) (-1995.169) (-1993.609) [-1995.948] * (-1996.401) (-1996.929) [-1997.544] (-1993.763) -- 0:02:17
81000 -- [-1996.745] (-1996.104) (-2006.170) (-1995.980) * (-2001.388) [-1993.652] (-1997.104) (-1997.019) -- 0:02:16
81500 -- (-1994.227) (-1991.827) [-1991.596] (-1994.856) * (-1997.969) [-1993.319] (-1996.471) (-1992.888) -- 0:02:15
82000 -- (-1995.018) (-1991.292) [-1996.819] (-1994.863) * (-1992.071) (-1993.721) [-1993.850] (-1995.804) -- 0:02:14
82500 -- (-1990.740) [-1995.880] (-1996.085) (-1998.346) * (-1998.990) [-1994.656] (-1995.040) (-1994.766) -- 0:02:13
83000 -- (-1992.622) (-2003.092) (-1997.385) [-1997.478] * (-1993.803) (-2002.593) [-1992.696] (-1996.203) -- 0:02:12
83500 -- (-1993.470) [-1992.961] (-1997.530) (-1990.720) * [-1995.425] (-1993.309) (-2001.401) (-1992.131) -- 0:02:11
84000 -- (-1996.904) (-1995.004) [-1989.835] (-1991.872) * (-1998.166) [-1992.230] (-1999.033) (-2001.487) -- 0:02:21
84500 -- (-1994.325) (-1993.504) [-1997.258] (-2002.467) * (-1991.331) [-1989.786] (-1998.037) (-1999.520) -- 0:02:20
85000 -- (-2002.004) (-1989.676) [-1994.955] (-2001.257) * (-1991.868) (-1995.538) (-2003.247) [-1992.632] -- 0:02:19
Average standard deviation of split frequencies: 0.000000
85500 -- [-1993.129] (-1990.305) (-1990.617) (-1993.938) * [-2000.259] (-1992.386) (-1991.914) (-2007.124) -- 0:02:19
86000 -- [-1990.046] (-1994.128) (-1998.426) (-2003.806) * (-1997.867) (-1995.529) [-1994.313] (-2005.810) -- 0:02:18
86500 -- [-1998.689] (-1996.605) (-1997.997) (-1998.715) * [-1994.387] (-1994.794) (-1993.183) (-2004.926) -- 0:02:17
87000 -- (-1999.843) (-1998.643) (-1997.264) [-2000.269] * [-1994.447] (-1997.641) (-1998.227) (-1991.781) -- 0:02:16
87500 -- [-1994.391] (-1996.706) (-1994.548) (-1996.628) * (-1996.450) [-1997.045] (-1995.994) (-1996.857) -- 0:02:15
88000 -- (-1998.004) (-1997.775) [-1992.179] (-1996.847) * [-1997.757] (-1993.693) (-1996.786) (-1996.239) -- 0:02:14
88500 -- (-2012.182) (-1994.648) [-1990.750] (-1992.021) * (-2001.528) (-1992.814) [-1993.493] (-1996.234) -- 0:02:13
89000 -- (-2005.909) (-1997.119) (-1992.773) [-1995.810] * (-1999.263) (-1996.799) (-1996.683) [-1996.563] -- 0:02:13
89500 -- (-2000.745) (-1996.468) [-1993.465] (-2000.519) * (-2000.599) [-1997.955] (-1990.669) (-1994.345) -- 0:02:12
90000 -- (-1993.751) [-1999.359] (-2001.414) (-1993.824) * (-2005.219) (-1993.591) [-2000.431] (-1997.210) -- 0:02:11
Average standard deviation of split frequencies: 0.000000
90500 -- (-1996.414) [-1996.969] (-1996.302) (-1999.115) * [-1996.853] (-1994.399) (-1994.514) (-1996.497) -- 0:02:20
91000 -- (-1997.147) (-1996.363) (-1997.073) [-1999.271] * (-1993.821) [-1991.591] (-1995.179) (-1997.279) -- 0:02:19
91500 -- (-1997.842) (-1998.540) (-1992.413) [-1991.762] * [-1994.270] (-1991.162) (-1994.488) (-1998.493) -- 0:02:19
92000 -- [-1992.912] (-1991.221) (-1991.387) (-1992.728) * (-1994.735) (-1996.772) (-1992.885) [-1993.818] -- 0:02:18
92500 -- (-2003.690) (-1999.518) (-1990.773) [-1994.318] * (-1995.000) (-1995.098) [-1993.077] (-1998.436) -- 0:02:17
93000 -- (-1995.132) (-1997.468) (-1994.053) [-1993.752] * (-1993.993) (-1999.018) (-1995.621) [-1994.944] -- 0:02:16
93500 -- (-1993.472) [-1992.015] (-1991.653) (-1999.305) * (-2007.906) (-2008.078) (-1991.755) [-1998.229] -- 0:02:15
94000 -- (-1993.640) (-2000.148) (-1995.448) [-2000.827] * [-2002.620] (-2004.771) (-1991.339) (-1994.680) -- 0:02:14
94500 -- [-1999.628] (-2000.690) (-2000.032) (-1993.755) * (-2001.108) (-2006.105) [-1994.545] (-1994.008) -- 0:02:14
95000 -- (-1997.989) (-1992.459) [-2000.101] (-1994.721) * (-1996.191) (-1998.139) (-1998.617) [-1994.866] -- 0:02:13
Average standard deviation of split frequencies: 0.000000
95500 -- (-1991.995) [-2000.750] (-1995.413) (-1994.185) * (-1998.259) (-1994.545) [-1998.072] (-1994.841) -- 0:02:12
96000 -- [-1992.212] (-1991.323) (-1999.798) (-2001.406) * (-1998.304) [-1995.814] (-1991.588) (-1996.137) -- 0:02:11
96500 -- (-1995.881) (-1990.043) (-1997.381) [-1995.352] * (-1994.217) [-1996.029] (-1995.976) (-2001.427) -- 0:02:11
97000 -- (-1990.537) [-1993.198] (-1995.482) (-1995.058) * (-1993.247) (-1993.417) [-1996.185] (-1996.153) -- 0:02:19
97500 -- [-1998.052] (-1996.049) (-1992.545) (-1997.303) * [-1992.855] (-1994.807) (-1996.448) (-1993.640) -- 0:02:18
98000 -- (-1997.812) (-1995.058) [-1996.355] (-1995.705) * (-1998.477) (-1991.290) [-2001.901] (-1992.726) -- 0:02:18
98500 -- (-1996.493) (-1999.528) [-1996.199] (-1999.910) * (-1993.139) [-1992.714] (-1994.341) (-1998.638) -- 0:02:17
99000 -- [-1990.886] (-2008.974) (-1996.521) (-1993.896) * (-1999.683) (-1990.013) (-1998.216) [-1995.365] -- 0:02:16
99500 -- (-1996.958) (-1998.170) (-1996.808) [-2004.052] * (-1994.230) (-1993.925) (-1997.026) [-1992.578] -- 0:02:15
100000 -- [-1991.168] (-1993.269) (-1996.721) (-1997.279) * (-1992.407) (-1993.919) [-1994.518] (-1994.941) -- 0:02:15
Average standard deviation of split frequencies: 0.000000
100500 -- [-1990.693] (-1998.335) (-2000.308) (-1993.963) * (-1992.861) [-1995.079] (-1995.647) (-1994.200) -- 0:02:14
101000 -- [-1993.456] (-1999.252) (-1995.910) (-1994.748) * [-1992.791] (-1997.264) (-1998.619) (-1993.750) -- 0:02:13
101500 -- [-1993.511] (-1994.282) (-1997.284) (-1995.751) * (-1999.641) (-1995.929) [-1995.443] (-1998.377) -- 0:02:12
102000 -- (-1996.703) (-1994.587) (-1994.949) [-1995.043] * [-1997.302] (-1993.535) (-1998.373) (-1992.230) -- 0:02:12
102500 -- (-1993.356) [-1997.313] (-1992.592) (-1999.128) * (-1992.878) [-1992.494] (-2002.373) (-1996.677) -- 0:02:11
103000 -- [-1995.224] (-1994.460) (-1992.349) (-1992.264) * [-1997.996] (-1997.163) (-2001.821) (-1997.379) -- 0:02:10
103500 -- (-1992.653) (-1996.669) [-1991.019] (-1990.975) * (-2003.244) [-1995.760] (-2000.818) (-1991.406) -- 0:02:18
104000 -- (-1996.592) (-1997.147) [-1994.847] (-1997.074) * [-2002.489] (-1994.371) (-2002.000) (-1994.057) -- 0:02:17
104500 -- [-1995.169] (-1994.545) (-1997.026) (-1998.887) * (-1993.789) (-1992.592) [-1995.850] (-1992.398) -- 0:02:17
105000 -- (-2001.845) (-1998.794) (-1992.827) [-1995.630] * (-1996.266) [-1991.225] (-1994.596) (-1992.661) -- 0:02:16
Average standard deviation of split frequencies: 0.000000
105500 -- (-2001.181) (-2001.598) (-1991.166) [-1997.931] * [-1999.924] (-1993.019) (-1996.231) (-1996.828) -- 0:02:15
106000 -- (-1992.917) (-1991.717) [-1992.673] (-1993.251) * (-2003.058) [-1991.411] (-1995.562) (-1999.181) -- 0:02:14
106500 -- (-1994.808) (-1997.959) (-1995.751) [-1997.644] * [-1996.469] (-1994.723) (-1994.235) (-1999.981) -- 0:02:14
107000 -- (-1989.887) [-1998.705] (-2001.024) (-1994.148) * [-1991.848] (-1992.232) (-1999.085) (-2006.041) -- 0:02:13
107500 -- (-2001.058) (-1997.042) (-1998.901) [-1996.589] * (-1996.958) [-1999.118] (-1994.769) (-2002.977) -- 0:02:12
108000 -- (-2002.649) (-2000.009) (-1994.702) [-1991.625] * [-1996.623] (-1996.817) (-1993.616) (-2003.299) -- 0:02:12
108500 -- (-1990.659) (-1997.999) [-1992.999] (-1998.557) * (-1994.721) (-2003.551) (-2000.074) [-1995.313] -- 0:02:11
109000 -- [-1996.370] (-1997.703) (-1994.222) (-1998.875) * [-1993.010] (-1994.497) (-1992.360) (-1996.293) -- 0:02:10
109500 -- [-1992.570] (-1997.695) (-1996.816) (-1990.554) * (-1993.134) (-1995.783) (-2009.183) [-1994.130] -- 0:02:10
110000 -- (-2001.373) (-1995.816) [-2003.130] (-1995.454) * (-1994.038) [-1991.606] (-2002.328) (-2005.196) -- 0:02:17
Average standard deviation of split frequencies: 0.000000
110500 -- (-2000.676) (-1993.660) (-1993.513) [-1996.076] * [-1990.880] (-1993.266) (-1995.723) (-1996.929) -- 0:02:16
111000 -- [-1992.303] (-2001.414) (-1993.727) (-1995.492) * [-1992.931] (-1991.196) (-1991.328) (-1997.814) -- 0:02:16
111500 -- (-1993.919) (-1994.138) (-2001.205) [-1991.145] * (-1993.888) (-1994.542) [-1992.828] (-1994.454) -- 0:02:15
112000 -- (-2001.452) (-1998.320) [-1999.265] (-1992.357) * (-1994.597) (-1996.322) (-1992.502) [-1996.648] -- 0:02:14
112500 -- (-1992.723) [-1989.245] (-1996.410) (-2000.591) * (-1994.564) (-1997.289) [-1989.895] (-1998.799) -- 0:02:14
113000 -- (-1993.764) (-1997.242) (-1993.605) [-1998.934] * (-1997.350) (-2003.241) (-2000.694) [-1995.004] -- 0:02:13
113500 -- (-2002.260) (-1999.601) [-1992.823] (-1990.471) * (-1994.447) (-1993.837) (-2001.068) [-2000.258] -- 0:02:12
114000 -- (-1994.876) [-1993.209] (-1996.056) (-1993.649) * (-1995.294) (-1998.843) (-1991.142) [-1991.442] -- 0:02:12
114500 -- (-1997.269) (-1999.761) [-1992.919] (-1994.622) * (-1998.333) [-1997.533] (-1994.446) (-1998.231) -- 0:02:11
115000 -- (-1997.550) (-1995.138) [-1992.295] (-1996.246) * (-1999.772) (-2000.900) (-1989.973) [-1989.441] -- 0:02:10
Average standard deviation of split frequencies: 0.000000
115500 -- (-1993.221) (-2000.224) [-1994.031] (-1994.027) * (-1996.472) (-1995.287) [-1990.912] (-1994.321) -- 0:02:10
116000 -- [-1995.035] (-2004.213) (-1997.814) (-1997.398) * (-1993.594) (-1995.033) [-1993.227] (-1995.913) -- 0:02:09
116500 -- (-1993.352) (-1995.402) (-1997.529) [-2000.321] * (-1998.436) (-2002.150) (-1997.490) [-1993.843] -- 0:02:16
117000 -- (-1991.988) (-1993.552) (-2002.082) [-1992.789] * (-1996.140) [-1998.650] (-1994.129) (-1994.384) -- 0:02:15
117500 -- [-1989.878] (-1999.384) (-2014.181) (-1995.747) * (-2001.622) (-1996.348) [-1992.810] (-2000.053) -- 0:02:15
118000 -- (-1994.681) (-1995.595) (-1999.290) [-1995.153] * (-1999.702) (-2001.333) (-1995.064) [-1993.391] -- 0:02:14
118500 -- [-1993.739] (-1995.830) (-1995.573) (-1997.177) * (-1999.456) [-1997.176] (-2000.545) (-1998.208) -- 0:02:13
119000 -- (-1997.379) (-2001.625) (-1999.332) [-1999.827] * (-2000.561) (-1995.408) [-1994.208] (-1998.605) -- 0:02:13
119500 -- [-1992.871] (-1994.572) (-2003.012) (-1993.859) * (-1997.777) [-1992.581] (-1993.703) (-1990.108) -- 0:02:12
120000 -- (-1996.098) (-1993.581) (-1997.188) [-1994.894] * (-2003.628) [-1994.272] (-1995.956) (-1995.492) -- 0:02:12
Average standard deviation of split frequencies: 0.000000
120500 -- (-1998.572) (-2001.101) [-1995.845] (-1991.362) * (-1995.070) (-1995.452) (-1995.933) [-1995.304] -- 0:02:11
121000 -- (-1991.978) [-1998.598] (-1998.908) (-1989.623) * (-1994.872) (-1989.526) (-1995.840) [-1997.775] -- 0:02:10
121500 -- (-1993.625) (-1993.610) [-1992.287] (-1995.707) * (-1989.624) [-1991.529] (-1994.079) (-1999.241) -- 0:02:10
122000 -- (-1996.760) (-1994.373) [-1993.407] (-1994.248) * (-1993.036) [-1991.237] (-1996.075) (-1999.793) -- 0:02:09
122500 -- (-1994.435) (-1997.197) (-1995.692) [-1996.524] * [-1996.593] (-2005.428) (-1997.519) (-1989.894) -- 0:02:08
123000 -- (-1992.381) (-1995.333) [-1995.568] (-1997.154) * (-1991.038) [-1993.683] (-1996.415) (-1998.723) -- 0:02:15
123500 -- (-1994.446) (-1996.119) (-1990.213) [-1995.153] * [-1995.467] (-1989.445) (-1995.171) (-1997.312) -- 0:02:14
124000 -- (-1994.616) (-1996.717) [-1994.528] (-1996.887) * (-1996.516) (-1994.645) (-1992.219) [-1996.835] -- 0:02:14
124500 -- [-1993.039] (-2001.896) (-1995.201) (-1997.845) * [-1993.981] (-1995.904) (-1991.659) (-1998.824) -- 0:02:13
125000 -- (-2007.260) [-1997.205] (-1992.799) (-1994.680) * (-1991.593) (-1993.612) [-1993.830] (-1997.472) -- 0:02:13
Average standard deviation of split frequencies: 0.000000
125500 -- (-1997.526) (-1993.047) (-1997.516) [-1993.845] * (-1995.525) (-2000.405) [-1993.700] (-1994.722) -- 0:02:12
126000 -- (-1995.945) [-1999.572] (-1995.171) (-1993.855) * (-1995.281) (-1997.123) (-1998.279) [-2001.421] -- 0:02:11
126500 -- (-1994.197) [-1996.124] (-1997.785) (-1991.930) * (-2007.180) (-1999.206) [-1994.987] (-1993.367) -- 0:02:11
127000 -- (-1998.711) [-2000.247] (-1995.229) (-1993.128) * (-1990.045) (-1996.475) (-1993.474) [-1994.011] -- 0:02:10
127500 -- (-1996.501) (-1996.050) [-1994.878] (-1987.789) * (-1996.259) (-1997.720) (-1995.560) [-1996.351] -- 0:02:10
128000 -- (-1997.570) (-1995.837) [-1998.437] (-1996.610) * (-2002.980) (-1994.510) [-1989.912] (-1993.927) -- 0:02:09
128500 -- [-1999.648] (-1998.301) (-1998.708) (-1997.821) * (-1993.894) (-1996.752) [-1992.768] (-1990.795) -- 0:02:08
129000 -- [-1995.644] (-1999.288) (-2004.751) (-1992.944) * (-1995.600) (-1997.547) [-1997.503] (-1991.186) -- 0:02:08
129500 -- (-1992.132) (-1997.868) [-1996.613] (-1992.807) * (-1993.714) [-2001.675] (-1995.806) (-1993.356) -- 0:02:14
130000 -- [-1993.760] (-1993.602) (-1997.507) (-1993.826) * (-2000.003) (-1996.556) (-2000.379) [-1996.407] -- 0:02:13
Average standard deviation of split frequencies: 0.000000
130500 -- (-1992.068) [-1992.617] (-1995.615) (-1996.414) * (-2000.157) [-1994.219] (-1993.322) (-1995.346) -- 0:02:13
131000 -- (-1997.738) (-1996.956) (-1995.934) [-1995.510] * (-1996.323) (-2005.951) [-2004.223] (-2001.925) -- 0:02:12
131500 -- (-1992.634) (-1994.028) [-1994.591] (-1998.910) * (-1999.991) (-1998.183) [-1992.557] (-1993.419) -- 0:02:12
132000 -- (-1989.033) (-1993.292) (-1994.747) [-1994.749] * [-2001.765] (-1995.808) (-1991.385) (-1995.100) -- 0:02:11
132500 -- (-1992.080) [-1996.689] (-1995.403) (-1998.260) * (-1998.037) (-1995.501) (-1994.485) [-1997.652] -- 0:02:10
133000 -- (-1991.739) (-1993.917) [-1999.224] (-1996.114) * (-2000.761) (-1993.395) (-1999.907) [-1991.552] -- 0:02:10
133500 -- (-1992.427) (-1996.837) (-1993.582) [-1999.071] * (-2006.787) (-2000.938) [-1996.321] (-1995.828) -- 0:02:09
134000 -- [-1995.154] (-1993.302) (-1993.505) (-1995.329) * (-1994.585) (-2005.963) [-1999.813] (-1995.220) -- 0:02:09
134500 -- (-1998.806) [-1994.465] (-1996.086) (-1993.923) * [-1992.695] (-1996.345) (-2000.930) (-1993.632) -- 0:02:08
135000 -- (-1996.563) (-1995.693) (-1992.600) [-1993.267] * (-2001.127) (-1998.343) [-1997.362] (-1996.494) -- 0:02:08
Average standard deviation of split frequencies: 0.000000
135500 -- (-1997.981) (-1997.358) (-1999.662) [-1990.083] * (-2001.492) (-1994.201) [-1994.604] (-1994.181) -- 0:02:07
136000 -- (-1996.646) (-1995.660) [-1993.649] (-1999.207) * (-2000.482) (-1995.834) (-1992.290) [-1997.719] -- 0:02:13
136500 -- [-1992.455] (-1996.401) (-2002.668) (-1992.692) * (-2000.914) (-1995.456) [-1997.708] (-1998.346) -- 0:02:12
137000 -- (-1996.143) (-1993.907) (-2001.954) [-1991.999] * [-1995.657] (-1990.852) (-1996.836) (-1997.344) -- 0:02:12
137500 -- (-1997.393) [-1990.703] (-2002.861) (-1996.946) * [-1999.851] (-1996.150) (-1994.903) (-1993.255) -- 0:02:11
138000 -- [-1994.184] (-1992.848) (-1993.482) (-1993.589) * (-1996.610) (-1998.988) [-1993.464] (-1998.233) -- 0:02:11
138500 -- (-1996.727) [-1991.610] (-1991.904) (-1997.931) * [-1995.124] (-1991.902) (-1996.377) (-1997.814) -- 0:02:10
139000 -- [-1996.644] (-1993.881) (-1997.096) (-1999.802) * (-1994.348) (-1996.052) [-1995.097] (-1994.869) -- 0:02:10
139500 -- [-1994.654] (-1995.690) (-1997.458) (-1992.128) * [-1996.786] (-1993.910) (-1992.711) (-1994.647) -- 0:02:09
140000 -- (-1997.017) (-1999.845) [-1994.805] (-2000.893) * (-1996.422) (-1996.802) (-1995.695) [-1991.413] -- 0:02:09
Average standard deviation of split frequencies: 0.000000
140500 -- [-1995.552] (-1997.273) (-2003.747) (-1993.764) * (-1992.680) (-2001.360) (-1993.702) [-1992.777] -- 0:02:08
141000 -- [-1997.560] (-1998.490) (-1993.866) (-1993.583) * (-1995.183) (-1997.907) (-1994.299) [-1992.008] -- 0:02:07
141500 -- (-1994.914) (-1994.547) (-1997.071) [-1994.691] * (-1994.590) [-1999.112] (-1999.126) (-1994.483) -- 0:02:07
142000 -- (-1994.073) [-1993.357] (-1999.237) (-1996.291) * (-1996.061) [-1996.790] (-1995.698) (-1996.978) -- 0:02:06
142500 -- (-1993.465) [-1990.735] (-1995.702) (-1998.026) * [-1992.776] (-1998.598) (-1993.245) (-1997.741) -- 0:02:12
143000 -- [-1992.101] (-1992.658) (-1992.114) (-2007.178) * (-1997.285) [-1994.479] (-1997.685) (-2001.150) -- 0:02:11
143500 -- (-1990.981) [-1992.800] (-1999.534) (-1998.303) * [-1991.763] (-1998.202) (-1997.906) (-2007.887) -- 0:02:11
144000 -- [-1995.431] (-1997.224) (-1996.686) (-2000.428) * (-1999.411) (-1998.286) [-1993.644] (-2000.912) -- 0:02:10
144500 -- (-1993.089) (-1992.669) [-1993.544] (-1993.937) * [-1994.934] (-2002.120) (-1992.682) (-1999.027) -- 0:02:10
145000 -- [-1995.864] (-1993.551) (-2007.464) (-2001.245) * (-1995.122) (-1999.148) [-1997.037] (-1998.518) -- 0:02:09
Average standard deviation of split frequencies: 0.000000
145500 -- [-1994.594] (-1994.569) (-2000.415) (-2000.898) * (-1993.573) (-1993.539) [-1993.402] (-1993.383) -- 0:02:09
146000 -- [-1997.760] (-1994.914) (-1997.289) (-2006.756) * (-1989.464) [-1998.427] (-1991.121) (-2001.794) -- 0:02:08
146500 -- (-1998.597) [-1992.569] (-1995.034) (-1998.887) * (-1998.429) (-2007.098) [-1993.039] (-1992.280) -- 0:02:08
147000 -- (-1994.783) [-1990.413] (-1995.817) (-1991.732) * [-1999.489] (-1994.170) (-1994.728) (-1998.151) -- 0:02:07
147500 -- (-1995.910) [-2000.832] (-1994.828) (-1994.204) * (-1999.553) [-1997.825] (-1994.603) (-1991.331) -- 0:02:07
148000 -- [-1994.085] (-1997.490) (-1996.768) (-1996.230) * [-1990.644] (-1999.118) (-2000.343) (-1995.798) -- 0:02:06
148500 -- (-1992.029) (-1996.366) (-1992.424) [-1995.954] * (-1994.364) (-1994.334) [-1998.558] (-1997.135) -- 0:02:06
149000 -- (-1999.647) (-1998.964) [-1989.568] (-1997.175) * (-1998.823) [-1992.927] (-1993.657) (-2000.978) -- 0:02:11
149500 -- [-1991.602] (-1992.338) (-1996.182) (-2000.569) * (-2004.171) [-1994.177] (-1992.987) (-1996.240) -- 0:02:10
150000 -- (-2003.870) [-1994.808] (-1993.455) (-1996.088) * (-1996.182) [-1995.096] (-2008.805) (-1997.098) -- 0:02:10
Average standard deviation of split frequencies: 0.000000
150500 -- (-1998.390) [-2002.942] (-1996.497) (-2002.040) * (-1998.751) (-1996.055) [-1996.174] (-1991.174) -- 0:02:09
151000 -- [-1999.391] (-1993.242) (-1993.911) (-1997.309) * (-1998.402) (-1994.458) [-1999.375] (-2000.846) -- 0:02:09
151500 -- (-1993.193) [-1993.138] (-1992.716) (-2001.772) * (-2005.787) (-1998.202) (-1997.897) [-1994.629] -- 0:02:08
152000 -- (-1996.507) (-1992.749) (-2003.681) [-1994.985] * (-1996.762) [-1997.217] (-1994.389) (-1995.667) -- 0:02:08
152500 -- (-1992.391) (-1996.377) (-1995.822) [-1993.976] * (-1995.928) [-1995.509] (-1992.850) (-1991.648) -- 0:02:07
153000 -- (-1992.974) (-1995.032) (-1992.224) [-2000.788] * (-1996.862) [-1997.782] (-1996.968) (-1992.747) -- 0:02:07
153500 -- [-1989.250] (-1994.530) (-1994.972) (-1997.375) * [-1997.747] (-1997.550) (-1992.466) (-1998.964) -- 0:02:06
154000 -- [-1996.690] (-1991.665) (-1990.019) (-1995.644) * (-1990.801) (-2002.673) [-1997.240] (-1990.721) -- 0:02:06
154500 -- (-2000.332) (-1991.777) [-1993.077] (-1991.556) * [-1993.893] (-1999.882) (-1996.080) (-1992.243) -- 0:02:05
155000 -- [-1994.945] (-1989.691) (-2000.242) (-1992.777) * (-1993.353) (-2000.809) [-1992.252] (-1993.671) -- 0:02:05
Average standard deviation of split frequencies: 0.000000
155500 -- (-1994.750) (-1994.827) [-1990.861] (-1996.432) * [-1994.386] (-2000.071) (-1994.434) (-2002.840) -- 0:02:10
156000 -- (-1994.437) (-1997.641) (-1995.590) [-1993.348] * [-1995.817] (-2006.606) (-1994.590) (-1995.262) -- 0:02:09
156500 -- (-1995.922) (-1998.338) [-1992.437] (-1991.927) * (-1992.743) (-2000.438) [-2000.157] (-1998.035) -- 0:02:09
157000 -- [-1997.937] (-1997.713) (-1995.499) (-2000.576) * (-1993.617) (-2001.833) [-1994.525] (-1996.390) -- 0:02:08
157500 -- (-2002.529) (-1996.803) [-1996.766] (-1997.880) * (-1997.816) [-1997.924] (-1999.185) (-1995.866) -- 0:02:08
158000 -- (-1996.344) (-1994.705) (-1991.089) [-1991.924] * [-1998.347] (-1992.841) (-1994.531) (-1992.083) -- 0:02:07
158500 -- (-2001.734) [-1991.755] (-1995.491) (-1991.551) * (-1993.125) (-1997.147) [-1993.141] (-1993.641) -- 0:02:07
159000 -- (-1992.606) (-1997.030) [-1997.293] (-1992.080) * [-2000.730] (-1996.448) (-1991.880) (-1990.126) -- 0:02:06
159500 -- (-1995.661) [-1996.836] (-1995.416) (-1994.203) * (-2005.217) [-1998.494] (-1995.195) (-1988.852) -- 0:02:06
160000 -- [-1991.242] (-1994.352) (-1996.517) (-1994.951) * (-1991.495) (-1997.936) (-1999.447) [-1989.173] -- 0:02:05
Average standard deviation of split frequencies: 0.000000
160500 -- (-1993.653) (-1996.427) [-1993.324] (-2001.188) * (-1994.667) (-1999.142) (-1996.335) [-1993.136] -- 0:02:05
161000 -- (-1994.047) [-1992.819] (-1998.254) (-1993.996) * (-1997.201) [-1993.958] (-1996.822) (-1994.491) -- 0:02:05
161500 -- [-1992.318] (-2002.965) (-1991.841) (-2000.323) * [-1998.597] (-1997.700) (-1997.418) (-2002.223) -- 0:02:04
162000 -- (-1990.822) (-1988.788) (-1997.804) [-1998.051] * [-2000.729] (-1995.960) (-2001.356) (-2001.941) -- 0:02:09
162500 -- (-1996.499) (-1989.905) [-1995.967] (-1994.791) * (-2008.138) (-1992.194) (-1996.913) [-1993.562] -- 0:02:08
163000 -- (-1998.548) (-1991.314) [-1996.002] (-2003.521) * (-2001.453) [-1993.064] (-2000.400) (-1992.597) -- 0:02:08
163500 -- (-2001.588) (-1997.130) [-1994.124] (-1995.428) * (-1994.197) [-1993.615] (-2001.431) (-1998.705) -- 0:02:07
164000 -- (-2000.431) (-1998.172) (-1997.952) [-1993.528] * (-1993.656) [-1992.608] (-1999.177) (-2002.168) -- 0:02:07
164500 -- (-1996.856) (-2002.304) (-1990.900) [-1995.691] * (-1996.081) (-1996.605) (-1999.915) [-1991.799] -- 0:02:06
165000 -- [-2002.814] (-1993.751) (-1995.842) (-1992.742) * (-1995.354) (-1991.709) (-2003.257) [-1992.718] -- 0:02:06
Average standard deviation of split frequencies: 0.000000
165500 -- (-1995.399) [-1993.451] (-1989.761) (-1997.570) * (-1993.855) (-1993.485) [-1998.208] (-1996.241) -- 0:02:06
166000 -- (-1997.705) (-1992.620) [-1993.366] (-1999.942) * [-1993.273] (-1994.663) (-1994.600) (-1992.674) -- 0:02:05
166500 -- (-1999.304) [-1998.463] (-1989.804) (-1995.598) * [-1993.109] (-1987.969) (-1996.373) (-1994.164) -- 0:02:05
167000 -- [-2000.024] (-1997.940) (-1992.878) (-1994.702) * (-1993.308) (-1996.353) [-1996.069] (-2001.511) -- 0:02:04
167500 -- (-1990.840) (-1999.415) [-1993.090] (-1994.259) * [-1994.418] (-1992.443) (-1996.577) (-1999.556) -- 0:02:04
168000 -- [-1991.269] (-1994.544) (-1992.852) (-1997.577) * (-1992.841) (-1994.526) [-1995.489] (-1990.610) -- 0:02:03
168500 -- (-1993.683) (-1997.024) [-1998.339] (-2004.482) * (-2002.058) (-1993.694) (-2001.249) [-1993.986] -- 0:02:08
169000 -- (-2001.379) (-1991.459) [-1993.959] (-1995.017) * [-1999.821] (-1992.078) (-1989.594) (-1994.236) -- 0:02:07
169500 -- (-1991.868) (-1995.245) [-1994.798] (-1995.090) * (-1996.685) [-1989.146] (-1991.050) (-1991.151) -- 0:02:07
170000 -- (-2001.140) (-1994.600) [-1994.932] (-1996.869) * [-1988.990] (-1994.882) (-1997.019) (-1998.731) -- 0:02:06
Average standard deviation of split frequencies: 0.000000
170500 -- (-1993.226) [-1997.060] (-1995.846) (-1997.255) * [-1991.723] (-1994.660) (-1996.198) (-1997.017) -- 0:02:06
171000 -- [-1993.412] (-1996.896) (-1996.283) (-2006.433) * [-1996.759] (-1995.033) (-2000.212) (-1997.274) -- 0:02:06
171500 -- (-1990.569) (-1993.116) (-1994.829) [-1994.728] * (-2000.307) (-1991.555) (-1994.548) [-1995.374] -- 0:02:05
172000 -- [-1994.866] (-1999.069) (-1993.550) (-1991.825) * (-1995.029) (-1991.704) [-1991.340] (-1996.211) -- 0:02:05
172500 -- (-1991.996) (-1994.504) (-1997.702) [-1994.051] * [-1994.873] (-1993.060) (-1992.806) (-1992.801) -- 0:02:04
173000 -- (-1991.966) (-2002.060) [-1995.297] (-1999.714) * (-2002.316) [-1996.142] (-1998.148) (-1997.960) -- 0:02:04
173500 -- (-1993.958) (-2006.104) (-1993.521) [-1993.294] * (-2003.516) [-1992.786] (-1995.210) (-1993.934) -- 0:02:03
174000 -- (-1996.671) [-1993.178] (-1993.995) (-1998.721) * [-1999.238] (-1994.514) (-1996.880) (-1994.339) -- 0:02:03
174500 -- (-2000.118) (-1999.045) (-1993.960) [-1990.919] * [-1991.041] (-2001.962) (-1993.849) (-1993.318) -- 0:02:02
175000 -- [-1994.249] (-1993.806) (-1997.904) (-2002.758) * (-1991.825) [-1992.591] (-1996.892) (-1993.159) -- 0:02:07
Average standard deviation of split frequencies: 0.000000
175500 -- [-1996.915] (-1995.270) (-1990.981) (-1993.874) * (-1993.994) [-1993.175] (-1993.729) (-1998.234) -- 0:02:06
176000 -- [-1993.056] (-1996.127) (-2001.788) (-1990.881) * [-1992.502] (-1995.870) (-1991.771) (-1998.854) -- 0:02:06
176500 -- (-1996.493) (-1993.955) [-1997.985] (-2002.432) * [-1999.130] (-1996.745) (-1992.661) (-1997.277) -- 0:02:05
177000 -- (-1990.548) [-1996.372] (-1992.682) (-1996.762) * [-1992.951] (-1995.362) (-1993.859) (-1992.838) -- 0:02:05
177500 -- (-1997.141) (-1997.910) [-1992.735] (-1997.233) * (-1995.603) (-1993.347) (-1995.797) [-1993.040] -- 0:02:05
178000 -- (-2003.506) (-2000.033) [-1995.116] (-1990.759) * (-1992.285) (-1995.529) (-1993.574) [-1992.282] -- 0:02:04
178500 -- (-1994.707) (-2000.979) [-1990.734] (-1994.602) * (-1990.818) (-1995.875) (-1993.150) [-1998.465] -- 0:02:04
179000 -- (-2006.225) (-1996.730) [-1992.136] (-1997.241) * [-1995.269] (-1993.792) (-1994.529) (-1990.141) -- 0:02:03
179500 -- (-1992.258) (-1993.613) (-1997.699) [-1994.061] * (-1995.952) [-1989.151] (-1995.400) (-1994.885) -- 0:02:03
180000 -- (-1994.090) (-1996.843) [-1992.162] (-2000.328) * (-1996.228) [-1993.002] (-2000.495) (-1995.681) -- 0:02:02
Average standard deviation of split frequencies: 0.000000
180500 -- (-1995.502) (-1997.985) [-1993.631] (-1994.541) * (-1992.278) [-1997.708] (-1999.633) (-1992.979) -- 0:02:02
181000 -- (-1997.211) [-2002.048] (-1997.177) (-1998.462) * (-1996.409) [-1995.861] (-1998.557) (-1995.802) -- 0:02:02
181500 -- (-1994.434) (-1998.025) [-1994.337] (-1997.321) * (-2001.048) [-1995.539] (-1998.128) (-1998.639) -- 0:02:01
182000 -- (-1994.731) (-2001.887) [-1991.482] (-1992.369) * (-1994.470) (-1995.832) (-1993.265) [-1993.055] -- 0:02:05
182500 -- (-1996.050) (-1997.069) (-1997.558) [-1994.435] * (-1997.241) (-1995.647) [-2000.484] (-1994.422) -- 0:02:05
183000 -- (-1994.715) (-1991.715) (-1995.062) [-1991.078] * [-1997.008] (-1996.701) (-1993.002) (-1996.708) -- 0:02:05
183500 -- (-1998.155) [-1992.753] (-1992.156) (-1995.561) * [-1990.958] (-1991.548) (-1991.890) (-1993.166) -- 0:02:04
184000 -- (-1993.534) (-1992.142) (-1997.939) [-1991.660] * (-1995.544) (-1996.094) [-1993.989] (-1999.334) -- 0:02:04
184500 -- [-1991.861] (-1989.828) (-1994.946) (-1997.407) * (-1999.978) [-1993.559] (-1996.770) (-1996.261) -- 0:02:03
185000 -- (-1993.715) [-1992.356] (-1994.324) (-1988.829) * [-1994.366] (-1997.181) (-1992.129) (-2000.239) -- 0:02:03
Average standard deviation of split frequencies: 0.000000
185500 -- (-2002.694) (-1989.770) [-1991.647] (-1998.580) * (-1995.348) (-1999.087) [-1993.782] (-1999.121) -- 0:02:02
186000 -- (-2003.218) (-1995.284) (-1997.432) [-1992.128] * (-1999.050) (-1994.281) (-1999.001) [-1994.732] -- 0:02:02
186500 -- (-1999.611) (-1997.815) (-1999.664) [-1991.170] * (-1996.294) [-1992.361] (-1998.016) (-1992.722) -- 0:02:02
187000 -- (-1994.729) [-1996.926] (-1999.769) (-2001.581) * (-1997.397) (-1995.760) (-2000.294) [-1991.167] -- 0:02:01
187500 -- (-1997.026) [-1993.448] (-1993.455) (-1993.461) * (-1997.748) (-1993.507) (-1994.852) [-1995.326] -- 0:02:01
188000 -- (-1993.259) (-1997.260) (-1994.367) [-1990.699] * (-2016.891) (-1999.854) (-1996.698) [-1991.130] -- 0:02:00
188500 -- (-1999.275) (-1995.172) [-1991.726] (-2005.594) * (-1993.042) (-1998.547) [-1994.826] (-1995.372) -- 0:02:04
189000 -- (-1995.846) [-1990.195] (-2000.603) (-1997.418) * (-1999.582) (-1991.457) [-1996.350] (-1997.021) -- 0:02:04
189500 -- (-1999.125) (-1995.899) [-1995.283] (-1999.617) * (-1995.768) [-1993.142] (-1994.946) (-1994.299) -- 0:02:04
190000 -- (-2000.749) (-1990.000) (-1994.517) [-1993.508] * (-1991.085) (-1992.888) [-1988.881] (-1993.094) -- 0:02:03
Average standard deviation of split frequencies: 0.000000
190500 -- (-2000.525) [-1991.780] (-1997.700) (-1993.734) * (-1999.498) (-1992.281) [-1994.830] (-2010.437) -- 0:02:03
191000 -- [-1993.717] (-1996.648) (-1996.402) (-1990.333) * [-1994.329] (-1992.357) (-1990.545) (-1995.993) -- 0:02:02
191500 -- (-1992.549) (-1996.427) (-2008.437) [-1993.749] * (-2001.491) (-1993.289) [-1993.763] (-2001.484) -- 0:02:02
192000 -- (-1995.585) (-1995.429) (-1998.666) [-1994.734] * (-2007.814) (-1995.456) [-1992.512] (-2003.169) -- 0:02:02
192500 -- (-1990.369) (-1990.120) (-2000.907) [-1992.839] * (-1994.059) (-1995.239) [-1997.532] (-2001.255) -- 0:02:01
193000 -- (-1994.054) [-1995.047] (-1996.383) (-1996.623) * (-1992.137) [-1996.204] (-1994.561) (-1997.547) -- 0:02:01
193500 -- (-1995.460) (-1994.699) [-1996.737] (-1996.256) * (-1996.846) (-1997.042) [-1998.703] (-1998.513) -- 0:02:00
194000 -- [-1990.880] (-1995.075) (-1991.354) (-2001.626) * (-1997.161) (-1998.559) [-1992.601] (-1990.912) -- 0:02:00
194500 -- (-1995.669) [-1989.843] (-1999.494) (-1996.988) * [-1994.217] (-1992.765) (-1992.551) (-1996.122) -- 0:02:00
195000 -- (-1991.645) [-1994.706] (-1992.608) (-1995.660) * (-1997.550) (-1994.064) (-1994.066) [-1998.556] -- 0:02:03
Average standard deviation of split frequencies: 0.000000
195500 -- (-1994.887) (-1997.943) (-2008.904) [-1994.165] * (-1994.097) (-1996.491) [-1994.393] (-1995.143) -- 0:02:03
196000 -- [-1999.319] (-1990.901) (-1999.299) (-1991.931) * [-1994.576] (-1998.612) (-1996.312) (-1994.977) -- 0:02:03
196500 -- (-1992.837) [-1995.795] (-2000.217) (-1996.467) * (-1996.577) (-1996.906) (-1999.908) [-1996.988] -- 0:02:02
197000 -- [-1991.498] (-1991.820) (-1999.173) (-1997.588) * [-1995.733] (-1991.376) (-1997.073) (-2000.056) -- 0:02:02
197500 -- (-1993.024) [-1996.128] (-2000.013) (-1997.951) * (-1994.832) (-1991.618) [-1991.941] (-2001.145) -- 0:02:01
198000 -- (-1996.881) [-1993.482] (-1992.648) (-1999.255) * (-1994.438) (-1998.645) [-1994.445] (-1995.406) -- 0:02:01
198500 -- [-1997.362] (-1995.652) (-1996.427) (-1994.786) * [-1994.269] (-1992.836) (-1996.680) (-1999.122) -- 0:02:01
199000 -- (-1999.840) (-1997.301) [-1994.638] (-1997.871) * (-1994.604) (-1999.226) [-1990.313] (-1996.527) -- 0:02:00
199500 -- [-1998.114] (-1998.756) (-1995.144) (-1992.122) * [-1995.905] (-2000.863) (-1992.759) (-2003.049) -- 0:02:00
200000 -- (-1992.507) (-1994.415) [-1990.811] (-1992.719) * (-1998.630) [-1991.202] (-1996.014) (-1996.843) -- 0:01:59
Average standard deviation of split frequencies: 0.000000
200500 -- [-1994.745] (-1992.517) (-1999.644) (-1993.489) * (-1997.589) (-1995.749) (-2004.860) [-1995.467] -- 0:01:59
201000 -- (-1996.295) (-1993.410) (-1997.059) [-1992.018] * (-1991.455) [-1997.790] (-2006.617) (-1995.988) -- 0:01:59
201500 -- [-1997.844] (-1997.054) (-1992.791) (-1988.357) * [-1996.233] (-2000.987) (-1998.357) (-1997.256) -- 0:02:02
202000 -- [-1994.322] (-1996.365) (-1994.808) (-1994.429) * (-1994.606) (-2001.119) (-1995.253) [-1995.222] -- 0:02:02
202500 -- (-1995.618) (-1999.370) (-1995.083) [-1991.567] * (-1999.735) [-1995.274] (-1996.404) (-1994.442) -- 0:02:02
203000 -- (-1995.227) [-1994.920] (-1999.575) (-1993.139) * (-1993.072) [-1995.036] (-1997.623) (-1993.776) -- 0:02:01
203500 -- (-1995.901) (-2001.820) (-1994.080) [-1994.125] * [-1992.245] (-1998.843) (-1994.433) (-2002.174) -- 0:02:01
204000 -- (-1994.884) (-2002.107) (-1997.253) [-1993.628] * (-1999.427) (-1998.170) (-1994.953) [-1995.880] -- 0:02:00
204500 -- [-1991.957] (-1995.189) (-1993.771) (-1990.685) * (-2005.416) (-1999.783) (-2000.474) [-1994.280] -- 0:02:00
205000 -- (-1999.502) [-2006.713] (-1994.176) (-1994.084) * (-2000.624) (-1991.069) (-1995.755) [-1989.852] -- 0:02:00
Average standard deviation of split frequencies: 0.000000
205500 -- (-1996.167) (-2003.524) (-1994.124) [-1996.302] * (-1993.147) [-1998.835] (-1996.575) (-1995.451) -- 0:01:59
206000 -- (-1990.050) (-1997.097) [-1994.970] (-1996.316) * [-1998.070] (-1995.635) (-1995.307) (-1994.118) -- 0:01:59
206500 -- [-1991.381] (-2000.782) (-1997.627) (-1997.965) * (-1994.269) (-1997.370) (-1998.624) [-1997.723] -- 0:01:59
207000 -- [-1996.159] (-2001.181) (-1990.790) (-1994.690) * (-1990.587) [-1994.212] (-1993.277) (-1995.643) -- 0:01:58
207500 -- (-1994.950) (-2000.297) [-2005.539] (-1990.207) * (-1999.990) [-1993.047] (-1995.588) (-1994.323) -- 0:01:58
208000 -- (-1992.588) (-1996.396) [-1990.405] (-1992.320) * (-1993.527) (-1998.864) [-1994.911] (-1998.872) -- 0:02:01
208500 -- (-2002.440) (-1997.813) (-1999.552) [-1994.550] * (-1995.460) (-1994.153) (-1996.710) [-1997.779] -- 0:02:01
209000 -- (-2001.907) [-1997.753] (-1990.108) (-1996.506) * (-1994.246) (-1995.646) (-1996.091) [-1999.042] -- 0:02:01
209500 -- (-1996.266) (-1992.420) (-2000.874) [-1991.316] * (-1994.610) (-1993.425) (-2001.204) [-1997.048] -- 0:02:00
210000 -- (-1999.259) (-1995.363) [-1989.485] (-1998.520) * [-1995.900] (-1992.401) (-1994.470) (-1996.737) -- 0:02:00
Average standard deviation of split frequencies: 0.000000
210500 -- [-1988.830] (-1994.803) (-1996.961) (-1996.164) * (-1996.246) [-1994.325] (-2002.453) (-1993.901) -- 0:02:00
211000 -- (-1992.486) [-1995.415] (-1993.670) (-2000.455) * (-1995.613) [-1991.737] (-1987.796) (-1993.314) -- 0:01:59
211500 -- (-1995.731) (-1995.135) (-1994.426) [-1998.968] * [-1994.781] (-1994.978) (-2009.568) (-1991.608) -- 0:01:59
212000 -- (-2001.280) (-1998.488) (-1996.210) [-1997.582] * [-1989.160] (-1997.448) (-1999.075) (-1991.211) -- 0:01:58
212500 -- (-2001.071) [-1993.978] (-1993.587) (-1995.563) * (-1995.555) [-1994.134] (-1995.123) (-1993.365) -- 0:01:58
213000 -- [-1997.193] (-1999.026) (-1992.525) (-1998.923) * (-1996.487) (-1992.779) [-1993.211] (-1995.047) -- 0:01:58
213500 -- (-1993.776) (-1993.440) [-1994.537] (-1997.469) * (-1995.164) (-1997.138) (-1991.535) [-1995.707] -- 0:01:57
214000 -- (-1998.159) [-1996.470] (-1997.125) (-1995.824) * (-2002.351) [-2000.338] (-1995.784) (-1994.661) -- 0:01:57
214500 -- (-1991.022) (-1998.136) (-1990.591) [-2004.527] * (-1997.477) [-1996.777] (-1999.222) (-1996.869) -- 0:02:00
215000 -- (-2000.332) (-1992.992) [-1992.560] (-1995.623) * (-1990.980) [-1994.240] (-1994.370) (-2000.182) -- 0:02:00
Average standard deviation of split frequencies: 0.000000
215500 -- [-1997.607] (-1992.052) (-1991.711) (-1996.753) * (-1994.834) (-1991.658) (-2005.223) [-1996.647] -- 0:02:00
216000 -- (-2003.470) (-1994.321) (-1995.734) [-1995.636] * [-1993.775] (-1992.825) (-1996.113) (-1994.427) -- 0:01:59
216500 -- [-1998.428] (-1997.635) (-1999.270) (-2000.190) * (-1998.057) (-1997.100) [-1995.809] (-1995.069) -- 0:01:59
217000 -- (-1998.883) (-1992.692) (-1998.009) [-1996.630] * (-2000.630) (-2001.798) [-1991.090] (-1995.704) -- 0:01:59
217500 -- (-2000.415) (-2006.409) (-1992.495) [-1999.885] * (-1995.460) [-1996.337] (-1994.572) (-1997.511) -- 0:01:58
218000 -- (-2005.184) (-2000.102) [-1995.508] (-2000.656) * [-1993.469] (-1997.148) (-1993.648) (-1992.913) -- 0:01:58
218500 -- (-1993.587) (-1992.986) [-1994.758] (-2000.658) * [-1995.154] (-1993.957) (-1996.840) (-1996.690) -- 0:01:58
219000 -- (-1995.918) (-1993.568) (-1991.939) [-1992.709] * [-1992.870] (-1993.348) (-1996.993) (-1998.358) -- 0:01:57
219500 -- [-1992.439] (-2001.539) (-1993.090) (-1994.996) * (-1993.440) (-1993.022) [-1995.119] (-1996.584) -- 0:01:57
220000 -- (-2003.945) (-2003.689) (-1998.341) [-1994.193] * [-1994.022] (-1994.639) (-2002.671) (-1993.281) -- 0:01:56
Average standard deviation of split frequencies: 0.000000
220500 -- (-1997.000) (-1995.732) [-1993.072] (-1994.393) * (-1994.216) (-1991.703) (-2001.579) [-1994.710] -- 0:01:56
221000 -- [-1993.568] (-1997.312) (-1995.321) (-1995.920) * (-1995.957) (-1994.339) [-1991.377] (-1991.796) -- 0:01:59
221500 -- [-2002.057] (-1991.248) (-1993.311) (-1991.378) * (-1993.859) (-1997.601) (-1997.244) [-1995.031] -- 0:01:59
222000 -- [-1999.087] (-1995.364) (-1998.841) (-1993.509) * (-1998.863) [-2000.014] (-2000.238) (-1999.811) -- 0:01:59
222500 -- (-1998.277) [-1995.222] (-2000.743) (-1993.633) * (-1993.875) (-2004.998) [-1999.381] (-1994.270) -- 0:01:58
223000 -- (-1999.884) (-1993.113) (-1990.239) [-1996.263] * (-1994.712) (-2003.846) (-1997.291) [-1997.545] -- 0:01:58
223500 -- (-1995.659) (-1994.814) [-1989.296] (-1988.352) * (-1991.846) (-1997.657) (-1996.545) [-1997.179] -- 0:01:58
224000 -- (-2000.229) (-1995.925) [-1991.207] (-1996.379) * (-1995.823) (-1993.566) [-1992.605] (-1993.995) -- 0:01:57
224500 -- (-1997.201) [-1991.749] (-1993.111) (-1996.424) * (-1989.611) (-1998.832) (-1996.004) [-1993.175] -- 0:01:57
225000 -- (-1995.294) (-1995.336) [-2002.493] (-1995.842) * (-1989.827) [-2000.717] (-1993.109) (-1995.041) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
225500 -- [-1994.090] (-1992.625) (-1995.618) (-1998.087) * (-1997.425) [-1995.043] (-1996.637) (-1999.333) -- 0:01:56
226000 -- [-1995.055] (-1995.436) (-1994.800) (-2000.933) * (-1997.544) (-1993.179) [-1990.783] (-1997.224) -- 0:01:56
226500 -- (-1993.214) (-1997.909) [-1997.480] (-1996.523) * (-1997.373) [-1990.880] (-1997.137) (-2000.180) -- 0:01:56
227000 -- (-1996.598) (-1995.838) [-1994.793] (-2001.221) * (-1994.378) (-1997.548) (-1999.869) [-1993.855] -- 0:01:55
227500 -- (-1989.712) [-1999.660] (-1995.905) (-2001.644) * (-1996.445) (-1997.004) (-1995.544) [-1995.573] -- 0:01:58
228000 -- [-1996.222] (-1998.522) (-1998.909) (-1999.285) * (-1996.187) [-1995.352] (-1993.254) (-1997.815) -- 0:01:58
228500 -- (-1990.836) [-1992.746] (-2000.524) (-1993.722) * [-1995.747] (-1999.715) (-1997.845) (-2000.731) -- 0:01:58
229000 -- (-1991.312) (-2004.215) (-1991.691) [-1993.975] * [-1993.783] (-1997.180) (-1995.790) (-1996.207) -- 0:01:57
229500 -- (-1997.262) (-1991.950) [-2000.807] (-1995.284) * (-2001.702) [-1997.909] (-1995.000) (-1998.895) -- 0:01:57
230000 -- (-1992.665) [-1991.527] (-1992.621) (-1994.880) * (-2005.003) (-1995.553) [-1999.428] (-2004.255) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
230500 -- (-1992.368) [-2005.691] (-1999.641) (-1994.498) * (-1993.535) (-1995.057) [-1992.384] (-1995.285) -- 0:01:56
231000 -- (-1997.420) (-2006.793) [-1993.040] (-1993.684) * [-1991.903] (-1999.943) (-1999.306) (-1992.531) -- 0:01:56
231500 -- (-2001.153) (-1999.983) [-1995.627] (-1990.928) * [-1994.407] (-1992.454) (-1996.152) (-1992.542) -- 0:01:56
232000 -- (-1996.932) [-1999.858] (-2000.801) (-1994.060) * (-1997.323) [-1993.008] (-1996.259) (-2004.266) -- 0:01:55
232500 -- (-1992.635) (-2000.203) (-1994.539) [-1992.185] * (-2001.843) (-1993.710) [-1994.261] (-2001.264) -- 0:01:55
233000 -- (-1993.713) (-1993.748) (-2002.858) [-1995.275] * [-1994.476] (-2012.461) (-1995.744) (-1992.397) -- 0:01:55
233500 -- (-1994.951) (-1998.591) (-2001.015) [-1995.044] * (-1998.711) (-1997.444) (-1995.948) [-1998.867] -- 0:01:54
234000 -- (-1996.890) [-2000.624] (-2007.530) (-1998.695) * (-1994.048) (-1990.738) [-1997.269] (-1992.796) -- 0:01:57
234500 -- (-1992.664) (-1995.916) (-1995.960) [-1993.897] * (-1994.708) (-1997.345) (-1992.909) [-1997.659] -- 0:01:57
235000 -- (-1995.453) (-2001.780) [-1994.046] (-1991.870) * [-1992.648] (-1997.930) (-1994.644) (-1994.679) -- 0:01:57
Average standard deviation of split frequencies: 0.000000
235500 -- [-2000.027] (-1995.633) (-2004.582) (-1993.297) * (-1996.205) (-1995.859) [-1997.764] (-1994.962) -- 0:01:56
236000 -- (-1994.767) (-1995.724) [-1993.129] (-1993.092) * [-1995.921] (-1993.689) (-2003.067) (-1997.702) -- 0:01:56
236500 -- (-1997.941) (-1990.181) [-1993.032] (-1996.148) * (-1994.739) [-1989.209] (-1995.255) (-1996.452) -- 0:01:56
237000 -- [-2001.487] (-1993.268) (-1995.104) (-1997.421) * [-1997.557] (-1993.895) (-1999.713) (-1995.923) -- 0:01:55
237500 -- [-1992.332] (-1991.401) (-2000.371) (-2003.912) * (-1992.034) (-2001.586) [-1992.749] (-1998.712) -- 0:01:55
238000 -- [-1998.702] (-1992.714) (-1994.987) (-1997.342) * (-1992.796) [-1996.307] (-1997.313) (-1993.289) -- 0:01:55
238500 -- [-1990.974] (-1995.188) (-1996.832) (-1998.841) * (-1994.437) (-2000.867) (-1997.022) [-1992.808] -- 0:01:54
239000 -- (-1995.229) (-1995.142) [-1994.851] (-2002.658) * (-1998.780) (-1999.628) (-1995.410) [-1991.420] -- 0:01:54
239500 -- (-1993.525) [-2004.913] (-1995.152) (-1992.002) * (-1995.293) (-1998.702) (-2002.465) [-1994.740] -- 0:01:54
240000 -- [-1997.198] (-1999.051) (-1997.187) (-1990.793) * [-1994.910] (-2001.025) (-1998.602) (-1995.610) -- 0:01:53
Average standard deviation of split frequencies: 0.000000
240500 -- (-1997.959) (-1995.235) (-1998.092) [-1997.602] * (-1998.936) (-2004.683) [-1998.212] (-2000.943) -- 0:01:56
241000 -- [-1996.828] (-1996.137) (-1996.053) (-1996.494) * (-1995.515) (-1997.610) [-1994.221] (-2000.535) -- 0:01:56
241500 -- [-1998.042] (-1990.026) (-1998.405) (-2004.073) * [-2000.342] (-1993.248) (-1997.563) (-1994.088) -- 0:01:56
242000 -- [-1993.703] (-1987.864) (-2002.108) (-1999.113) * (-1998.169) (-1995.421) [-1998.377] (-1999.528) -- 0:01:55
242500 -- (-2004.061) [-1994.200] (-1997.507) (-2000.497) * (-1998.620) (-1998.583) (-2000.531) [-1997.134] -- 0:01:55
243000 -- (-2002.582) (-1990.099) (-1993.727) [-1993.355] * (-1995.408) [-2006.465] (-2001.139) (-1995.526) -- 0:01:55
243500 -- (-1993.813) (-1995.485) [-1997.377] (-2000.166) * (-1992.122) (-2007.491) [-1995.329] (-1994.611) -- 0:01:54
244000 -- (-2001.785) (-1993.947) [-1996.572] (-1998.129) * [-1996.913] (-2000.479) (-1992.028) (-1997.119) -- 0:01:54
244500 -- (-2006.878) (-1993.493) [-1994.577] (-1994.058) * [-2001.698] (-2002.580) (-1994.860) (-1991.714) -- 0:01:54
245000 -- (-1994.708) [-1996.402] (-1994.929) (-1993.900) * [-1991.462] (-2005.716) (-1994.744) (-2003.234) -- 0:01:54
Average standard deviation of split frequencies: 0.000000
245500 -- (-1997.973) (-1995.223) [-1997.323] (-1993.400) * (-1994.260) (-1998.032) (-1996.445) [-2001.748] -- 0:01:53
246000 -- (-1993.363) (-1999.672) [-1995.591] (-1995.461) * (-1994.795) [-1994.330] (-1996.571) (-2005.228) -- 0:01:53
246500 -- (-1996.496) [-2000.854] (-1995.146) (-1992.617) * (-1992.277) (-2003.942) [-1993.205] (-1993.452) -- 0:01:53
247000 -- (-1995.885) [-1999.949] (-1997.449) (-2000.365) * (-1991.989) [-1996.666] (-1998.423) (-1990.667) -- 0:01:55
247500 -- (-1995.255) (-1994.996) [-1999.216] (-1992.379) * (-1991.091) (-2002.284) (-1997.010) [-1996.255] -- 0:01:55
248000 -- (-1999.469) (-2007.634) [-1998.008] (-1995.185) * (-1996.653) [-1994.577] (-1995.298) (-1994.828) -- 0:01:55
248500 -- (-1994.124) [-1991.554] (-1999.463) (-1997.699) * (-1992.263) [-1990.750] (-1996.105) (-1995.113) -- 0:01:54
249000 -- (-1995.372) [-1993.194] (-2001.164) (-1996.798) * (-1991.902) (-1998.083) (-1997.338) [-1997.097] -- 0:01:54
249500 -- (-2003.471) (-1994.219) (-1992.683) [-1996.013] * (-1992.738) [-1993.279] (-1993.492) (-1996.637) -- 0:01:54
250000 -- [-1995.854] (-1998.109) (-1991.943) (-1995.463) * (-1994.742) (-1991.097) (-1995.471) [-1994.600] -- 0:01:54
Average standard deviation of split frequencies: 0.000000
250500 -- (-1997.000) (-2005.298) [-1991.110] (-1996.199) * [-1994.748] (-1990.707) (-1997.442) (-1997.779) -- 0:01:53
251000 -- (-1996.534) [-1994.691] (-1999.585) (-1998.671) * (-1996.226) [-2000.227] (-1998.419) (-2000.067) -- 0:01:53
251500 -- [-1995.289] (-1992.498) (-1992.547) (-1993.928) * (-2000.080) (-2000.555) [-1997.096] (-2003.605) -- 0:01:53
252000 -- (-1992.751) [-1990.477] (-1998.283) (-1996.209) * (-1998.122) (-1997.959) (-1992.319) [-1992.040] -- 0:01:52
252500 -- [-1994.591] (-1994.025) (-1996.188) (-1996.823) * (-1994.871) (-2001.610) [-1991.399] (-1994.926) -- 0:01:52
253000 -- (-1995.201) (-1993.296) (-1993.737) [-1990.314] * (-1996.460) [-1992.586] (-1988.826) (-2000.693) -- 0:01:52
253500 -- (-1995.742) (-1996.667) (-1996.892) [-1998.886] * (-1991.197) (-1998.147) (-2002.702) [-2000.700] -- 0:01:54
254000 -- (-1996.288) (-1994.171) [-1992.917] (-1995.311) * (-1992.619) (-1994.401) [-1995.413] (-1994.968) -- 0:01:54
254500 -- (-1995.404) (-1993.035) (-1994.139) [-1996.211] * (-1996.961) (-1992.304) [-1995.738] (-1998.089) -- 0:01:54
255000 -- (-1997.466) (-1998.007) (-1998.144) [-1998.515] * [-1995.269] (-1991.552) (-1995.030) (-2001.362) -- 0:01:53
Average standard deviation of split frequencies: 0.000000
255500 -- (-2007.037) (-1997.178) [-2001.327] (-1993.167) * (-1994.497) [-1994.742] (-1993.171) (-2009.257) -- 0:01:53
256000 -- (-1995.966) (-2003.166) (-1991.318) [-1994.986] * [-1994.050] (-1992.530) (-1994.832) (-1999.295) -- 0:01:53
256500 -- (-1994.670) (-2005.822) (-1998.028) [-2000.767] * (-1994.331) (-1996.647) [-1994.057] (-1993.844) -- 0:01:53
257000 -- [-1996.658] (-1996.566) (-2001.871) (-1994.431) * (-2001.227) [-2001.105] (-1993.722) (-1991.279) -- 0:01:52
257500 -- (-2001.454) (-1993.504) [-1996.827] (-1998.401) * [-1993.779] (-1994.045) (-1998.231) (-1995.572) -- 0:01:52
258000 -- [-1998.751] (-1994.996) (-1991.996) (-1999.316) * (-1995.154) [-1996.182] (-1995.741) (-1996.884) -- 0:01:52
258500 -- (-2000.253) (-2000.622) [-1994.141] (-1991.842) * (-1999.086) [-1999.198] (-1992.883) (-2000.785) -- 0:01:51
259000 -- (-1998.328) (-1997.969) [-1992.815] (-2004.157) * (-1997.072) (-1993.413) (-1995.425) [-1992.588] -- 0:01:51
259500 -- (-1996.168) (-1997.642) [-1989.956] (-2000.706) * (-2000.093) (-1990.608) [-1988.414] (-1999.366) -- 0:01:51
260000 -- (-1993.515) (-1991.264) [-1993.557] (-1998.694) * (-1997.828) (-1993.712) (-1992.667) [-1993.784] -- 0:01:53
Average standard deviation of split frequencies: 0.000000
260500 -- (-1993.565) [-1993.374] (-1991.680) (-1994.868) * (-1995.010) (-1999.333) (-1994.913) [-1994.130] -- 0:01:53
261000 -- (-2000.579) (-1993.344) [-1993.430] (-1994.781) * [-1992.270] (-1995.402) (-2001.493) (-1993.845) -- 0:01:53
261500 -- (-1997.287) [-1998.090] (-1993.355) (-1993.068) * (-1994.466) [-1994.938] (-1997.399) (-1991.330) -- 0:01:52
262000 -- (-2002.909) [-1996.405] (-1992.023) (-1995.376) * [-1993.666] (-1991.195) (-1998.250) (-1991.568) -- 0:01:52
262500 -- (-1991.810) (-1993.759) [-2000.414] (-1993.201) * [-1996.814] (-1994.068) (-1997.263) (-1997.601) -- 0:01:52
263000 -- [-1997.110] (-1997.100) (-1992.886) (-1992.767) * (-1996.326) (-1994.712) (-1995.557) [-1993.420] -- 0:01:52
263500 -- (-1991.186) (-1996.388) [-1996.973] (-1998.787) * [-1994.019] (-1993.002) (-1993.422) (-1994.816) -- 0:01:51
264000 -- (-1998.190) (-2002.061) (-1989.692) [-1992.350] * (-1996.058) (-1992.661) [-1995.360] (-1992.871) -- 0:01:51
264500 -- (-1994.227) (-1993.369) (-2000.118) [-1998.888] * (-2003.451) [-1997.766] (-1999.325) (-1994.080) -- 0:01:51
265000 -- (-2000.697) (-1993.773) [-1992.625] (-1994.945) * (-2004.738) (-1995.333) (-1999.777) [-1999.252] -- 0:01:50
Average standard deviation of split frequencies: 0.000000
265500 -- (-1998.404) (-1992.499) (-1993.550) [-1991.611] * (-1994.963) (-1994.162) (-1988.788) [-1993.701] -- 0:01:50
266000 -- (-1993.455) [-1990.890] (-1998.983) (-1991.471) * [-1994.691] (-1994.564) (-1997.469) (-1993.174) -- 0:01:50
266500 -- [-1990.998] (-1995.691) (-1993.267) (-1991.572) * (-1997.627) (-1994.017) [-1994.939] (-1996.964) -- 0:01:52
267000 -- [-1994.505] (-1993.390) (-1995.800) (-1989.727) * (-1993.418) [-1992.845] (-1997.483) (-1995.907) -- 0:01:52
267500 -- (-1996.116) (-1998.528) [-1994.355] (-2003.989) * (-1995.826) (-1992.871) [-1992.706] (-1996.874) -- 0:01:52
268000 -- (-1991.507) (-1996.636) [-1995.707] (-1995.574) * (-1993.278) [-1994.575] (-1994.175) (-1992.927) -- 0:01:51
268500 -- [-1990.134] (-1991.651) (-1993.841) (-2001.980) * [-1995.049] (-1996.902) (-1996.846) (-1994.760) -- 0:01:51
269000 -- (-1993.822) (-1994.891) (-2003.812) [-1988.744] * (-2000.363) [-1994.260] (-1999.750) (-1992.791) -- 0:01:51
269500 -- (-1991.914) (-1997.113) [-1992.935] (-1994.950) * (-2001.415) (-1992.626) [-2001.650] (-1990.997) -- 0:01:51
270000 -- [-1991.024] (-1995.598) (-2001.486) (-1995.346) * (-1995.805) (-1989.456) (-1995.300) [-1990.718] -- 0:01:50
Average standard deviation of split frequencies: 0.000000
270500 -- (-1995.656) (-1997.093) [-1993.617] (-1996.632) * (-2010.122) [-1991.100] (-1996.369) (-1989.516) -- 0:01:50
271000 -- (-1997.922) (-1997.381) [-1992.596] (-1990.571) * (-1994.340) (-1999.221) (-1997.845) [-1992.352] -- 0:01:50
271500 -- [-1989.365] (-2001.924) (-1999.403) (-1993.723) * [-1995.133] (-1991.621) (-2006.171) (-1995.113) -- 0:01:50
272000 -- [-1996.384] (-1994.752) (-1995.431) (-1997.032) * (-1994.892) (-1996.487) [-2005.486] (-1995.500) -- 0:01:49
272500 -- [-1993.222] (-1997.762) (-1992.947) (-1997.819) * (-1989.405) (-1990.601) (-2000.477) [-1994.789] -- 0:01:49
273000 -- [-1995.550] (-1997.295) (-1994.089) (-1992.345) * [-1992.638] (-1998.250) (-1993.221) (-1995.532) -- 0:01:51
273500 -- (-1997.581) (-1992.307) [-1991.869] (-1997.003) * (-1990.293) (-2003.342) [-1998.503] (-1998.947) -- 0:01:51
274000 -- (-1999.215) (-2002.349) (-1993.429) [-1990.579] * (-1998.756) [-1998.318] (-1992.158) (-1997.960) -- 0:01:51
274500 -- (-2004.227) (-1991.240) (-1997.861) [-1996.780] * [-1993.613] (-1992.669) (-1997.728) (-1991.576) -- 0:01:51
275000 -- [-1997.698] (-2000.060) (-1996.782) (-1993.965) * (-1999.977) (-1996.056) (-1998.106) [-1999.755] -- 0:01:50
Average standard deviation of split frequencies: 0.000000
275500 -- (-1992.024) (-2001.065) (-2000.436) [-1992.461] * (-1997.097) (-1997.842) (-1995.548) [-1993.642] -- 0:01:50
276000 -- [-1999.356] (-2001.811) (-1994.244) (-1999.602) * (-1997.229) (-1997.323) [-2005.462] (-1993.144) -- 0:01:50
276500 -- (-1994.698) (-1999.533) (-1991.413) [-1993.275] * (-1994.145) (-1992.042) (-1998.606) [-1998.182] -- 0:01:49
277000 -- (-1992.839) (-1993.357) [-1990.487] (-2001.368) * (-2000.411) (-1993.574) [-1994.573] (-1993.037) -- 0:01:49
277500 -- (-1999.815) (-1992.780) [-1994.486] (-1998.590) * (-1995.194) [-1992.532] (-1999.689) (-2000.415) -- 0:01:49
278000 -- (-1998.965) [-1992.346] (-1995.947) (-2001.043) * [-1995.441] (-1997.361) (-1992.908) (-1997.437) -- 0:01:49
278500 -- (-1995.807) (-1993.880) [-1994.995] (-1995.560) * [-1998.188] (-1992.570) (-1997.373) (-1997.760) -- 0:01:48
279000 -- (-1991.755) [-1996.483] (-1994.823) (-1999.544) * (-1993.336) (-1992.948) (-1994.362) [-1992.650] -- 0:01:48
279500 -- (-1993.396) (-2000.875) (-1999.322) [-1995.688] * (-1991.550) (-1995.233) (-1995.531) [-1997.773] -- 0:01:50
280000 -- (-1999.525) [-1997.083] (-1997.320) (-2004.363) * (-1997.386) [-1992.695] (-1992.639) (-1994.284) -- 0:01:50
Average standard deviation of split frequencies: 0.000000
280500 -- (-1997.682) (-1993.770) [-1989.865] (-1995.900) * (-1995.251) [-1993.236] (-1995.492) (-1994.604) -- 0:01:50
281000 -- [-1997.742] (-2000.653) (-1995.839) (-1994.816) * (-1990.160) (-1995.826) (-1995.583) [-2000.621] -- 0:01:50
281500 -- (-2006.542) (-1993.096) [-1994.075] (-2000.982) * [-1998.964] (-2000.338) (-1992.865) (-1992.265) -- 0:01:49
282000 -- (-1996.913) (-1998.045) [-1993.743] (-1993.925) * (-2000.666) (-1997.496) [-1992.888] (-1999.885) -- 0:01:49
282500 -- (-1995.295) [-1992.219] (-1995.891) (-1997.361) * (-1997.777) (-2000.296) [-1994.858] (-1991.415) -- 0:01:49
283000 -- (-2005.670) [-1992.859] (-1999.746) (-1995.244) * (-1999.710) (-2001.742) (-2000.151) [-1996.451] -- 0:01:48
283500 -- (-2000.793) (-1991.667) (-1997.592) [-1995.126] * (-1999.394) (-1997.617) [-1991.594] (-1996.581) -- 0:01:48
284000 -- (-2000.040) (-1994.384) (-1999.236) [-1998.082] * (-1997.297) (-1998.609) (-1994.287) [-2001.421] -- 0:01:48
284500 -- (-1996.042) (-2002.971) (-1991.402) [-1995.872] * (-1994.875) (-1995.051) [-1997.624] (-1992.156) -- 0:01:48
285000 -- [-1993.178] (-1993.234) (-1991.905) (-1996.209) * [-1994.906] (-1999.583) (-1994.322) (-1993.029) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
285500 -- (-1994.780) (-1996.648) [-1998.473] (-1993.604) * (-1996.550) (-1992.242) [-1990.889] (-1998.263) -- 0:01:47
286000 -- (-1997.383) [-1991.674] (-1998.848) (-1995.658) * (-1999.718) (-2000.220) (-1989.994) [-1990.629] -- 0:01:49
286500 -- (-2000.998) (-1990.926) (-1999.654) [-1996.826] * [-1992.293] (-1992.595) (-1997.064) (-1993.023) -- 0:01:49
287000 -- (-1997.350) (-1994.706) (-1998.883) [-1995.732] * (-1994.261) (-1990.760) [-1994.683] (-1997.874) -- 0:01:49
287500 -- (-2003.015) [-1991.092] (-1989.556) (-1994.699) * [-1996.947] (-1997.079) (-1994.112) (-1991.657) -- 0:01:49
288000 -- (-1993.602) [-1992.717] (-1991.356) (-1995.541) * [-1999.329] (-1997.027) (-1992.605) (-1992.570) -- 0:01:48
288500 -- (-1999.186) (-1996.757) [-1994.715] (-1991.308) * (-1992.570) (-2004.305) [-1993.426] (-1996.543) -- 0:01:48
289000 -- (-1997.649) [-1992.707] (-1995.606) (-1994.999) * (-1996.216) (-1995.185) [-1997.108] (-1993.084) -- 0:01:48
289500 -- (-1999.695) (-2006.570) (-1992.939) [-1996.477] * (-1988.786) [-1997.722] (-2000.298) (-1991.109) -- 0:01:47
290000 -- (-2001.335) (-2001.515) (-1996.183) [-1990.258] * (-1989.626) (-1996.566) [-2000.023] (-1997.362) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
290500 -- (-2003.349) (-1995.462) [-1994.330] (-1990.310) * (-1997.165) (-2001.109) (-1998.430) [-1996.165] -- 0:01:47
291000 -- (-1999.863) (-1994.663) (-1992.223) [-1992.113] * (-1995.531) (-1999.883) [-1997.297] (-1997.191) -- 0:01:47
291500 -- (-1993.419) (-2000.888) (-1993.311) [-1989.278] * (-2002.393) [-1991.791] (-1996.478) (-1995.360) -- 0:01:46
292000 -- (-1991.922) (-1992.851) (-1998.625) [-1998.483] * (-2002.503) (-1996.377) [-1990.390] (-2000.370) -- 0:01:46
292500 -- (-1992.817) [-1995.405] (-1998.595) (-2001.888) * [-2001.182] (-1994.465) (-1998.530) (-1996.049) -- 0:01:48
293000 -- [-1995.585] (-1996.103) (-1994.954) (-1996.217) * (-1997.945) (-1991.941) [-1996.657] (-2000.157) -- 0:01:48
293500 -- (-1995.319) [-1993.503] (-1995.210) (-1996.128) * (-1994.255) (-1998.153) (-1991.442) [-1990.726] -- 0:01:48
294000 -- [-1992.684] (-1991.804) (-1988.382) (-1997.719) * [-1992.804] (-1996.190) (-1994.871) (-1994.634) -- 0:01:48
294500 -- (-1992.912) (-1997.204) [-1996.357] (-1995.217) * (-1996.842) (-1999.048) (-1997.646) [-1994.057] -- 0:01:47
295000 -- (-1991.305) (-1993.804) [-1996.385] (-1999.024) * (-1995.445) [-1996.043] (-1989.304) (-1992.938) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
295500 -- [-1995.408] (-2003.281) (-1995.647) (-1997.719) * (-1997.996) (-1994.742) [-1992.584] (-1998.548) -- 0:01:47
296000 -- [-1992.922] (-1994.025) (-1999.061) (-1995.070) * (-1993.840) (-1995.510) [-1994.213] (-2003.118) -- 0:01:47
296500 -- (-1996.979) [-1997.833] (-1995.697) (-1999.553) * (-1997.600) (-1992.943) (-1998.206) [-1996.518] -- 0:01:46
297000 -- (-1993.059) (-1995.653) [-2001.122] (-1995.109) * [-1991.807] (-1992.855) (-1991.918) (-1992.731) -- 0:01:46
297500 -- (-1994.127) (-1994.766) (-2003.889) [-1996.564] * (-1996.857) (-1996.704) [-1998.942] (-1993.763) -- 0:01:46
298000 -- (-1994.981) (-2003.145) (-2004.283) [-1992.143] * (-1998.131) (-1997.325) (-1996.404) [-1999.028] -- 0:01:46
298500 -- (-2000.935) [-1997.321] (-2001.553) (-1993.231) * (-2004.178) (-2003.299) [-1995.203] (-1995.442) -- 0:01:45
299000 -- (-1994.596) (-1993.296) (-1995.699) [-1990.904] * (-2004.607) (-1992.099) (-2000.763) [-1993.322] -- 0:01:47
299500 -- (-1992.660) (-1998.397) [-1993.621] (-1994.686) * (-2003.752) (-1999.399) (-1996.243) [-1996.965] -- 0:01:47
300000 -- (-1996.097) (-1992.182) (-1993.238) [-1993.694] * [-2000.970] (-1995.377) (-1995.320) (-1992.996) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
300500 -- (-2000.655) (-1994.556) [-1992.544] (-1998.188) * [-1992.895] (-1995.486) (-1999.952) (-1995.257) -- 0:01:47
301000 -- (-1995.545) (-2001.553) [-1988.168] (-1997.788) * (-1994.104) (-1996.362) [-1992.996] (-1995.163) -- 0:01:46
301500 -- [-1995.238] (-1998.594) (-1997.260) (-1995.168) * (-1997.436) (-1997.007) [-1990.954] (-2005.224) -- 0:01:46
302000 -- (-1995.553) (-1994.147) [-2000.603] (-2000.028) * (-1991.235) [-1992.421] (-1997.220) (-1994.716) -- 0:01:46
302500 -- [-1991.157] (-1997.155) (-2003.833) (-2007.033) * [-1991.633] (-1998.841) (-1997.066) (-1995.509) -- 0:01:46
303000 -- (-1997.992) (-1996.762) (-1998.060) [-2002.014] * (-1994.182) [-2001.738] (-1991.596) (-1996.773) -- 0:01:45
303500 -- (-1993.978) (-1991.452) (-2006.150) [-1997.415] * (-1999.127) (-2004.388) (-1993.420) [-1994.304] -- 0:01:45
304000 -- (-1992.134) [-1993.347] (-1992.895) (-1994.819) * (-2001.816) (-1996.761) [-1997.128] (-1993.247) -- 0:01:45
304500 -- (-1994.024) [-1994.327] (-1996.695) (-1998.971) * [-2002.155] (-2005.161) (-1989.992) (-2004.068) -- 0:01:45
305000 -- (-1994.261) (-1996.315) (-1996.627) [-1993.676] * [-1998.896] (-1992.762) (-1992.981) (-2006.205) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
305500 -- (-1991.783) (-1993.362) [-1994.755] (-2000.318) * (-1998.809) [-1997.083] (-1991.935) (-1996.255) -- 0:01:44
306000 -- (-1998.322) (-1992.435) [-1994.978] (-1998.121) * (-2003.779) (-1995.015) [-1987.968] (-1993.322) -- 0:01:46
306500 -- (-1996.207) [-1989.632] (-1996.058) (-1998.645) * [-1996.909] (-1993.601) (-1997.518) (-1992.014) -- 0:01:46
307000 -- (-1992.619) (-1995.116) [-1996.755] (-1994.436) * [-1992.784] (-1998.049) (-1995.149) (-1992.434) -- 0:01:46
307500 -- (-1992.401) (-1991.140) [-1996.374] (-1994.708) * (-1996.042) (-1991.806) (-2005.818) [-1992.123] -- 0:01:45
308000 -- (-2001.688) [-1993.201] (-1998.118) (-1992.326) * (-1995.463) (-1998.194) [-1996.898] (-1993.845) -- 0:01:45
308500 -- (-1998.823) (-1998.102) (-1997.940) [-1993.117] * (-2001.723) (-1997.445) [-1993.593] (-1994.509) -- 0:01:45
309000 -- (-1994.459) (-1996.511) [-1993.977] (-1993.087) * (-1997.513) (-1994.391) [-1999.820] (-1995.395) -- 0:01:45
309500 -- (-1995.448) (-1998.624) (-1995.714) [-1993.553] * (-2000.007) (-1995.521) [-1997.622] (-1993.631) -- 0:01:44
310000 -- (-1993.770) [-1992.867] (-2001.128) (-1993.255) * (-1999.696) (-2000.738) [-1992.012] (-1994.757) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
310500 -- (-1999.173) (-1993.006) [-1994.151] (-1995.093) * (-1996.801) [-1992.730] (-2000.466) (-1993.482) -- 0:01:44
311000 -- (-1999.919) (-1995.093) (-1999.962) [-1997.298] * (-1992.416) (-1994.753) [-1992.435] (-1995.067) -- 0:01:44
311500 -- [-1995.176] (-1991.894) (-1995.590) (-1992.525) * (-2001.729) (-2000.069) (-1995.605) [-1989.500] -- 0:01:43
312000 -- (-1997.449) [-1995.721] (-2002.905) (-1993.892) * (-1997.248) (-2002.124) [-1993.166] (-1998.308) -- 0:01:43
312500 -- (-1995.536) [-1990.363] (-1999.570) (-1999.201) * (-1998.555) (-1993.660) [-1991.988] (-1994.283) -- 0:01:45
313000 -- (-1997.023) (-1995.588) [-1992.888] (-1995.830) * [-1997.324] (-1993.490) (-1999.748) (-1992.005) -- 0:01:45
313500 -- (-1994.491) [-1991.572] (-1997.071) (-1999.445) * (-1995.063) [-1994.231] (-1997.693) (-2000.314) -- 0:01:45
314000 -- [-1995.810] (-1996.956) (-1994.915) (-1999.814) * (-2000.403) (-1998.649) [-1994.327] (-1991.647) -- 0:01:44
314500 -- (-1996.080) (-1993.789) [-1999.964] (-1996.308) * (-1993.144) (-1995.763) (-1995.221) [-1996.414] -- 0:01:44
315000 -- [-1997.299] (-1995.805) (-2000.739) (-1993.697) * [-1997.907] (-1991.665) (-1997.150) (-1995.472) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
315500 -- [-1998.126] (-1997.292) (-1998.148) (-1994.353) * (-1996.616) (-1996.494) (-1997.283) [-1995.763] -- 0:01:44
316000 -- (-1995.786) [-1997.609] (-1999.302) (-1998.206) * (-1997.857) (-1994.018) (-1996.381) [-1995.698] -- 0:01:43
316500 -- (-1995.264) [-2003.056] (-1999.560) (-2001.340) * (-2000.775) [-1990.858] (-2000.056) (-1997.377) -- 0:01:43
317000 -- [-1993.098] (-1998.714) (-2003.579) (-1996.673) * [-1997.238] (-1990.674) (-1997.997) (-1995.205) -- 0:01:43
317500 -- (-2001.490) (-1993.001) (-1993.389) [-1990.609] * (-1997.602) (-2002.646) (-1996.118) [-1994.071] -- 0:01:43
318000 -- (-1993.896) [-1994.257] (-1999.122) (-1997.878) * (-1995.590) (-1996.062) [-1998.375] (-1996.484) -- 0:01:42
318500 -- [-1997.186] (-1995.682) (-1996.009) (-1999.197) * (-1993.191) (-2003.494) [-1992.602] (-1995.644) -- 0:01:42
319000 -- (-2000.510) [-1990.820] (-1994.785) (-1997.843) * [-1992.295] (-1998.755) (-1993.888) (-1995.835) -- 0:01:44
319500 -- [-1998.570] (-1994.914) (-2002.958) (-2001.083) * (-1988.834) (-2007.234) [-1999.103] (-1992.681) -- 0:01:44
320000 -- (-1993.442) (-1996.709) (-1995.394) [-1998.990] * [-1992.493] (-1995.500) (-1999.532) (-1997.938) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
320500 -- [-1992.706] (-1994.554) (-2002.566) (-1995.472) * (-1995.684) [-1994.103] (-1995.407) (-1997.044) -- 0:01:43
321000 -- (-1996.112) (-1998.943) (-2000.466) [-1994.896] * (-1992.570) [-1992.462] (-1994.899) (-1997.784) -- 0:01:43
321500 -- [-1995.538] (-1992.326) (-2003.849) (-1993.951) * (-2000.080) (-1993.027) [-1993.348] (-1992.288) -- 0:01:43
322000 -- (-1989.111) [-1996.683] (-2004.050) (-1995.190) * (-1997.360) (-1992.035) [-1994.777] (-1992.960) -- 0:01:43
322500 -- (-1993.438) (-1994.820) [-1998.029] (-1995.523) * (-1991.102) (-1998.547) [-1991.335] (-1997.405) -- 0:01:42
323000 -- (-1994.773) (-1998.602) (-1994.168) [-1988.352] * [-1994.873] (-1994.574) (-1995.060) (-1992.450) -- 0:01:42
323500 -- (-1998.963) (-1994.026) (-2004.293) [-1997.350] * (-1999.179) (-1992.663) (-2001.548) [-1997.546] -- 0:01:42
324000 -- (-1997.720) [-1995.933] (-2001.733) (-1993.842) * [-1996.794] (-1999.125) (-1994.853) (-1995.246) -- 0:01:42
324500 -- [-1994.543] (-1996.312) (-1996.418) (-1994.781) * (-1996.138) (-1992.500) (-1993.199) [-1989.949] -- 0:01:42
325000 -- (-1991.351) [-1996.502] (-1990.566) (-1997.574) * [-1991.509] (-1996.678) (-1998.530) (-1990.569) -- 0:01:41
Average standard deviation of split frequencies: 0.000000
325500 -- [-1988.759] (-1998.197) (-1997.973) (-2001.375) * (-1996.596) (-1991.505) (-1993.815) [-1991.254] -- 0:01:43
326000 -- [-1993.691] (-1997.114) (-1995.112) (-1989.169) * [-1998.632] (-1992.156) (-1995.690) (-2000.181) -- 0:01:43
326500 -- (-1995.444) [-1996.063] (-1997.438) (-1996.020) * [-1995.976] (-2000.019) (-1992.931) (-1995.218) -- 0:01:43
327000 -- [-1993.412] (-2000.500) (-1999.402) (-1993.074) * [-2000.071] (-1999.027) (-1995.063) (-1993.408) -- 0:01:42
327500 -- (-1991.599) (-1989.461) [-1991.157] (-1993.424) * (-1995.211) (-1992.786) (-1992.170) [-1990.633] -- 0:01:42
328000 -- (-1994.938) (-1993.697) [-1996.591] (-1998.561) * (-1993.550) [-1993.473] (-1999.650) (-2003.526) -- 0:01:42
328500 -- (-1996.310) [-1993.172] (-1989.119) (-1996.138) * [-1994.003] (-1998.698) (-2000.618) (-1999.963) -- 0:01:42
329000 -- (-1998.787) (-1990.756) [-1994.783] (-1996.178) * [-1990.735] (-2000.735) (-1996.269) (-2001.066) -- 0:01:41
329500 -- (-1997.146) [-1996.377] (-1992.909) (-1999.025) * (-1996.875) (-1999.243) (-1993.152) [-2001.924] -- 0:01:41
330000 -- [-1993.361] (-1995.839) (-1989.966) (-1994.782) * [-1992.540] (-2006.400) (-1996.919) (-1997.824) -- 0:01:41
Average standard deviation of split frequencies: 0.000000
330500 -- (-1994.675) [-1994.938] (-1990.837) (-1995.891) * (-1997.304) (-1998.242) [-1993.399] (-2001.273) -- 0:01:41
331000 -- [-2001.675] (-1996.672) (-1992.144) (-1997.593) * (-1993.654) [-1996.485] (-1996.471) (-2001.199) -- 0:01:41
331500 -- (-1999.830) (-2000.101) (-1995.075) [-1995.974] * (-1994.346) (-1995.005) (-1995.943) [-1998.553] -- 0:01:40
332000 -- (-1998.181) [-1990.967] (-1994.368) (-1993.932) * (-1992.713) (-1996.097) [-1991.352] (-1997.768) -- 0:01:42
332500 -- (-2000.116) (-1999.334) (-1997.504) [-1995.449] * (-2000.649) (-2001.201) [-1993.547] (-1990.931) -- 0:01:42
333000 -- [-1994.940] (-2001.772) (-1998.484) (-1997.704) * (-2003.689) (-1992.876) [-1993.290] (-1997.885) -- 0:01:42
333500 -- (-1992.230) (-1995.763) (-1994.670) [-1993.758] * (-2010.887) (-1995.320) (-1996.173) [-1998.659] -- 0:01:41
334000 -- (-1996.434) (-1994.391) [-1991.961] (-1994.525) * (-1999.010) (-1994.533) [-1993.204] (-2000.638) -- 0:01:41
334500 -- (-1994.220) (-1994.942) [-1994.289] (-1991.420) * [-1995.384] (-1992.668) (-1992.548) (-2001.087) -- 0:01:41
335000 -- (-1992.574) (-1997.552) [-1989.199] (-1995.223) * (-1996.198) [-1990.974] (-1992.821) (-1995.905) -- 0:01:41
Average standard deviation of split frequencies: 0.000000
335500 -- [-1999.947] (-1992.888) (-1999.972) (-2002.036) * (-1994.267) (-1997.910) [-1995.618] (-1995.146) -- 0:01:41
336000 -- (-1996.042) (-1988.794) (-1995.089) [-1990.797] * (-1994.390) (-1994.400) [-1994.687] (-1994.453) -- 0:01:40
336500 -- [-1990.334] (-1996.682) (-2002.590) (-1993.220) * (-1992.110) (-1992.368) (-1992.691) [-1992.440] -- 0:01:40
337000 -- [-1994.461] (-1995.897) (-1997.256) (-2002.143) * (-1994.780) (-1993.880) [-1995.272] (-1996.597) -- 0:01:40
337500 -- (-1992.689) (-2001.851) (-1989.848) [-1997.871] * [-1991.163] (-1995.300) (-1997.718) (-1997.086) -- 0:01:40
338000 -- [-2004.378] (-2002.284) (-1995.769) (-1998.572) * [-1993.508] (-1998.384) (-1991.184) (-1996.755) -- 0:01:39
338500 -- [-1997.250] (-2000.095) (-1997.301) (-1997.409) * (-2004.438) (-1993.866) [-1993.299] (-1996.574) -- 0:01:41
339000 -- (-2001.782) (-2005.632) [-1995.247] (-2002.258) * (-1995.395) (-1998.401) (-2000.718) [-1998.345] -- 0:01:41
339500 -- (-1995.487) (-1997.494) (-1992.710) [-1998.536] * (-1998.108) (-1995.391) [-2000.923] (-1993.060) -- 0:01:41
340000 -- [-2000.355] (-2003.030) (-1997.479) (-1995.866) * (-1993.482) (-1999.349) [-1997.930] (-2009.006) -- 0:01:40
Average standard deviation of split frequencies: 0.000000
340500 -- (-1997.477) (-1996.580) [-1995.469] (-1999.304) * (-1993.201) (-1997.754) [-1994.219] (-1992.991) -- 0:01:40
341000 -- (-2000.554) [-1991.991] (-1998.823) (-2012.239) * [-1992.287] (-1997.851) (-1998.091) (-1990.923) -- 0:01:40
341500 -- (-2000.188) [-1998.579] (-1995.880) (-2006.487) * (-1995.306) (-1990.786) (-1997.561) [-1995.519] -- 0:01:40
342000 -- (-1994.488) [-1995.516] (-1996.415) (-2001.514) * (-1998.196) [-1993.691] (-1992.637) (-1991.584) -- 0:01:40
342500 -- (-1998.240) [-1995.072] (-1994.159) (-1994.139) * (-1995.458) (-1990.108) (-1992.155) [-1996.444] -- 0:01:39
343000 -- (-1994.938) (-2000.987) (-1992.533) [-1999.710] * [-1997.240] (-1995.912) (-2002.434) (-1998.779) -- 0:01:39
343500 -- (-1994.391) (-1994.389) [-1998.341] (-1999.279) * [-1993.075] (-2004.083) (-1998.629) (-1996.198) -- 0:01:39
344000 -- [-1992.257] (-1993.062) (-1994.811) (-1994.611) * [-1992.262] (-1997.588) (-1994.090) (-2002.147) -- 0:01:39
344500 -- (-1994.503) [-1994.563] (-2003.948) (-1994.571) * [-1990.369] (-1996.316) (-1995.206) (-2005.483) -- 0:01:38
345000 -- (-1996.424) (-1995.602) [-1993.419] (-1996.197) * (-1998.477) (-2000.308) (-1993.848) [-2002.596] -- 0:01:40
Average standard deviation of split frequencies: 0.000000
345500 -- [-1993.349] (-1996.504) (-1996.553) (-2018.518) * (-1998.390) [-1999.191] (-1996.698) (-1995.240) -- 0:01:40
346000 -- [-1989.221] (-1994.036) (-1994.612) (-1992.612) * (-1991.409) (-1996.978) [-1993.628] (-1994.954) -- 0:01:40
346500 -- (-1995.503) (-1992.838) (-1993.300) [-1995.441] * (-1993.700) (-1995.990) (-1991.039) [-1996.599] -- 0:01:39
347000 -- (-1997.683) [-2002.712] (-2001.193) (-1995.087) * (-1992.818) (-2006.427) [-1993.259] (-1996.110) -- 0:01:39
347500 -- (-1993.656) (-1988.938) (-1998.122) [-1994.021] * (-1995.573) [-2006.626] (-1994.343) (-2001.719) -- 0:01:39
348000 -- (-1992.227) [-1991.914] (-1995.199) (-1997.956) * [-1994.843] (-2001.256) (-1991.825) (-1990.473) -- 0:01:39
348500 -- [-1991.876] (-1996.197) (-1994.876) (-2005.032) * (-1998.998) (-1997.029) (-1990.147) [-1995.856] -- 0:01:39
349000 -- (-1991.608) (-1996.122) [-2000.016] (-1994.594) * [-1993.896] (-2002.071) (-1997.981) (-1999.594) -- 0:01:38
349500 -- (-1991.635) (-1998.493) (-1998.018) [-1993.826] * (-1991.038) (-1996.822) [-1994.296] (-1993.270) -- 0:01:38
350000 -- [-1992.525] (-1998.185) (-1997.424) (-1996.741) * (-1999.433) [-1998.403] (-1995.086) (-1993.084) -- 0:01:38
Average standard deviation of split frequencies: 0.000000
350500 -- (-1997.698) [-1996.467] (-1998.033) (-2001.321) * (-1992.268) (-1999.025) (-1998.152) [-1994.299] -- 0:01:38
351000 -- (-2005.240) (-1995.232) (-1997.015) [-1999.953] * (-1998.902) (-1997.976) [-1993.792] (-1994.003) -- 0:01:37
351500 -- (-2008.910) (-1994.696) (-1996.170) [-1993.419] * (-1992.910) (-1993.060) [-1993.039] (-1992.647) -- 0:01:39
352000 -- (-1993.431) [-1992.397] (-1994.764) (-1999.343) * [-1993.791] (-1996.625) (-2001.117) (-1993.658) -- 0:01:39
352500 -- (-1996.064) (-1995.228) (-2003.919) [-1995.584] * [-1996.636] (-1993.908) (-2004.585) (-1996.796) -- 0:01:39
353000 -- [-1996.068] (-1992.367) (-1996.182) (-2000.655) * (-1996.421) (-1995.056) (-1997.878) [-1999.697] -- 0:01:38
353500 -- (-1994.341) (-1995.014) [-1997.310] (-2005.393) * (-1998.174) (-1992.635) (-1996.601) [-1995.444] -- 0:01:38
354000 -- (-1997.840) [-1996.775] (-1994.477) (-1996.208) * (-2002.750) (-1989.141) (-1994.809) [-1995.323] -- 0:01:38
354500 -- (-1995.099) [-1997.096] (-1995.200) (-1996.019) * [-1999.816] (-1992.126) (-1995.460) (-1992.482) -- 0:01:38
355000 -- (-1996.892) (-1996.029) [-1996.809] (-1996.944) * (-1995.658) (-1992.754) (-2000.485) [-1993.667] -- 0:01:38
Average standard deviation of split frequencies: 0.000000
355500 -- (-1996.293) (-1998.349) [-1997.695] (-1997.053) * (-2002.922) [-1991.028] (-1997.978) (-1993.671) -- 0:01:37
356000 -- (-1996.710) (-1998.402) [-1999.004] (-1994.196) * (-2001.368) (-1994.793) (-1999.053) [-1994.485] -- 0:01:37
356500 -- [-1995.407] (-1993.806) (-1992.942) (-1993.432) * (-1994.501) [-1990.849] (-2001.916) (-2005.494) -- 0:01:37
357000 -- (-1997.580) (-2004.202) [-1995.588] (-1991.803) * (-1998.739) (-1998.247) [-1996.363] (-1997.681) -- 0:01:37
357500 -- (-1992.776) (-2000.209) [-1996.447] (-1993.758) * (-1998.278) (-1995.291) (-1997.965) [-1993.794] -- 0:01:37
358000 -- [-1992.799] (-1992.946) (-1999.175) (-1996.175) * [-1993.900] (-1998.153) (-1999.986) (-1993.740) -- 0:01:38
358500 -- [-1992.053] (-1995.641) (-1994.116) (-1992.577) * (-2000.620) (-1995.206) (-2004.482) [-1995.131] -- 0:01:38
359000 -- (-1991.066) (-1996.899) [-1998.757] (-1998.244) * (-1994.599) (-1990.008) (-1999.243) [-1994.379] -- 0:01:38
359500 -- (-1996.766) (-1994.568) [-1995.422] (-2002.038) * (-1996.352) (-1996.310) [-1993.101] (-1994.256) -- 0:01:37
360000 -- [-1996.416] (-2001.704) (-1991.565) (-2000.517) * [-1995.769] (-1995.077) (-1995.546) (-1999.294) -- 0:01:37
Average standard deviation of split frequencies: 0.000000
360500 -- (-1990.623) [-1995.551] (-1993.176) (-1990.723) * (-1999.393) [-2005.497] (-1998.772) (-1994.317) -- 0:01:37
361000 -- (-2003.571) (-1998.783) (-1992.759) [-1999.378] * [-1994.200] (-1992.590) (-1997.556) (-1992.917) -- 0:01:37
361500 -- (-1995.044) (-1993.846) (-2000.197) [-1998.265] * (-1993.762) (-1999.006) (-1997.252) [-1997.113] -- 0:01:37
362000 -- (-1996.583) (-1993.952) [-1996.810] (-1991.809) * (-1994.443) [-1992.631] (-1998.851) (-1994.735) -- 0:01:36
362500 -- (-2005.440) (-2001.495) [-1993.771] (-1995.916) * (-1999.255) [-1998.333] (-1991.987) (-1997.296) -- 0:01:36
363000 -- (-1998.251) (-2003.053) [-1996.773] (-1994.961) * [-1996.352] (-1996.575) (-2001.696) (-1995.089) -- 0:01:36
363500 -- (-1999.397) (-1998.185) (-1999.303) [-1998.200] * (-2002.299) (-1995.382) [-1996.931] (-1995.857) -- 0:01:36
364000 -- (-1993.631) (-1991.181) [-1991.001] (-1995.957) * (-2010.983) (-1995.053) (-1992.191) [-1995.109] -- 0:01:36
364500 -- (-1993.964) (-1994.601) [-1990.085] (-1993.588) * [-1992.448] (-1994.986) (-1995.636) (-1997.041) -- 0:01:37
365000 -- (-1994.695) [-1995.759] (-1993.336) (-1995.352) * (-1990.477) (-1998.246) [-1993.623] (-1999.785) -- 0:01:37
Average standard deviation of split frequencies: 0.000000
365500 -- (-1992.077) (-1996.395) [-2000.890] (-1996.525) * (-1993.823) [-1996.685] (-1994.478) (-1995.200) -- 0:01:37
366000 -- (-2001.963) (-1996.552) (-1997.373) [-2004.153] * (-1988.727) [-1996.112] (-1995.444) (-1996.581) -- 0:01:37
366500 -- [-1992.271] (-1994.404) (-1997.429) (-1993.233) * [-1991.725] (-1997.657) (-1989.038) (-1998.910) -- 0:01:36
367000 -- (-1993.109) [-1994.244] (-1991.269) (-1995.214) * (-1995.841) [-1993.323] (-1998.452) (-2002.060) -- 0:01:36
367500 -- (-1995.020) (-1993.529) (-1992.919) [-1994.876] * [-1998.645] (-1995.520) (-2001.209) (-1992.912) -- 0:01:36
368000 -- (-1990.241) (-1990.591) [-1995.655] (-1997.514) * (-1991.103) [-1994.698] (-1996.266) (-2006.938) -- 0:01:36
368500 -- (-1996.110) (-1995.151) [-1994.791] (-1996.936) * [-1993.527] (-1992.109) (-1994.802) (-1999.674) -- 0:01:35
369000 -- (-1999.379) [-1997.678] (-1993.180) (-1997.855) * (-1991.544) (-1990.864) (-1997.782) [-1994.980] -- 0:01:35
369500 -- (-1996.173) (-1995.286) (-1998.172) [-1997.642] * (-1992.062) (-1995.934) [-1992.655] (-1997.298) -- 0:01:35
370000 -- (-2002.241) [-1993.981] (-1997.464) (-1997.737) * (-1999.850) (-1998.461) (-1992.221) [-2000.030] -- 0:01:35
Average standard deviation of split frequencies: 0.000000
370500 -- (-1998.316) (-1994.147) (-1992.510) [-1999.215] * (-1993.613) (-1991.365) [-1994.881] (-1995.037) -- 0:01:35
371000 -- (-1998.305) (-1996.388) [-1995.331] (-1995.470) * (-1994.363) [-1998.544] (-1990.864) (-1988.886) -- 0:01:36
371500 -- (-1995.622) [-1993.494] (-2000.707) (-1995.341) * (-2002.165) (-1998.985) (-2002.184) [-1991.265] -- 0:01:36
372000 -- (-1997.261) (-2001.882) (-1994.958) [-1993.559] * (-1995.058) [-1993.747] (-1993.912) (-1994.553) -- 0:01:36
372500 -- (-1997.586) [-2000.817] (-1995.148) (-1992.079) * (-1991.692) [-1995.797] (-1999.797) (-1993.084) -- 0:01:36
373000 -- (-1992.606) (-1991.256) [-2002.481] (-1999.018) * (-2001.928) (-1996.799) [-1996.365] (-1989.933) -- 0:01:35
373500 -- (-1998.422) (-1988.943) [-2000.311] (-1994.381) * [-1990.827] (-1996.935) (-1994.153) (-1997.307) -- 0:01:35
374000 -- [-1994.103] (-1995.101) (-2000.139) (-1993.183) * (-1996.741) [-1997.960] (-1993.307) (-1997.513) -- 0:01:35
374500 -- (-1994.864) (-1995.159) (-2005.365) [-1995.892] * (-1995.144) (-1993.782) [-1994.581] (-1991.974) -- 0:01:35
375000 -- (-1992.994) (-1995.213) (-1996.749) [-1996.118] * (-1994.108) [-1997.693] (-1999.575) (-1993.531) -- 0:01:35
Average standard deviation of split frequencies: 0.000000
375500 -- (-1999.250) (-1997.172) [-1994.128] (-1998.982) * [-1994.195] (-1993.471) (-1991.371) (-1996.653) -- 0:01:34
376000 -- [-1997.113] (-1996.058) (-1994.090) (-1995.824) * (-1997.271) [-1996.447] (-1992.901) (-1994.969) -- 0:01:34
376500 -- (-2000.330) (-1997.340) [-1994.710] (-2001.234) * (-1997.965) [-1992.860] (-1994.633) (-1998.571) -- 0:01:34
377000 -- (-1994.954) (-1998.134) (-2003.028) [-1993.073] * (-1996.329) [-1991.968] (-1997.189) (-1988.800) -- 0:01:34
377500 -- [-1997.066] (-1995.487) (-2007.933) (-1996.678) * (-1994.624) [-2000.878] (-1994.898) (-1994.076) -- 0:01:35
378000 -- [-1997.295] (-2000.610) (-1999.746) (-1993.901) * (-1994.736) (-1993.132) [-1991.318] (-1996.291) -- 0:01:35
378500 -- (-2003.855) [-1991.985] (-1994.102) (-1993.049) * [-1995.263] (-1992.724) (-1991.880) (-1995.750) -- 0:01:35
379000 -- (-1999.561) (-1998.663) [-1990.496] (-1996.195) * (-1993.647) (-2006.074) (-1993.375) [-1991.414] -- 0:01:35
379500 -- (-1997.796) [-1992.475] (-1989.908) (-1993.402) * (-1998.207) [-1998.146] (-1993.129) (-1995.004) -- 0:01:34
380000 -- (-1997.379) (-1997.218) (-1992.357) [-1990.947] * (-1995.961) [-1993.529] (-1991.733) (-1990.952) -- 0:01:34
Average standard deviation of split frequencies: 0.000000
380500 -- (-1994.811) (-1990.738) [-1998.186] (-1989.136) * (-2002.598) [-1990.904] (-2002.464) (-1995.582) -- 0:01:34
381000 -- (-2000.555) (-1991.054) (-1996.254) [-1992.401] * (-1992.200) [-1997.044] (-1996.716) (-1993.723) -- 0:01:34
381500 -- (-1996.448) (-1995.640) [-2001.151] (-1992.666) * [-1990.498] (-1995.024) (-1996.703) (-1995.521) -- 0:01:34
382000 -- (-1993.005) [-2001.103] (-1999.632) (-1993.555) * (-1997.160) [-1992.094] (-1995.416) (-2000.202) -- 0:01:33
382500 -- (-1991.700) (-1996.582) (-1993.725) [-1993.491] * (-2000.021) (-1998.880) (-1994.718) [-1995.994] -- 0:01:33
383000 -- (-1994.525) (-2002.446) [-1994.226] (-1989.924) * [-1992.494] (-1996.132) (-1993.595) (-1998.426) -- 0:01:33
383500 -- (-1996.872) [-1995.849] (-1998.823) (-1996.894) * (-1993.784) (-2000.649) [-1994.940] (-1989.733) -- 0:01:33
384000 -- [-1994.316] (-1995.320) (-1996.383) (-1995.905) * (-1992.785) (-1999.988) (-1994.100) [-1996.702] -- 0:01:34
384500 -- (-1997.011) [-1992.988] (-1994.104) (-1998.471) * [-1995.100] (-2001.370) (-2002.380) (-1993.522) -- 0:01:34
385000 -- [-1993.577] (-1996.197) (-1992.556) (-2003.197) * [-1994.262] (-1995.877) (-1998.231) (-1997.604) -- 0:01:34
Average standard deviation of split frequencies: 0.000000
385500 -- (-1992.779) [-1997.027] (-1996.682) (-1998.756) * (-1998.200) [-1997.531] (-1997.516) (-1991.593) -- 0:01:34
386000 -- (-1993.388) [-1991.977] (-1997.583) (-1997.874) * (-1995.804) (-1994.601) [-1994.863] (-1995.038) -- 0:01:33
386500 -- (-1998.412) [-1992.558] (-1996.129) (-1995.321) * (-2001.259) (-1998.120) (-1997.475) [-1993.013] -- 0:01:33
387000 -- (-1992.119) (-1995.604) (-1998.802) [-1991.906] * (-2001.677) (-1994.783) [-1993.890] (-1997.673) -- 0:01:33
387500 -- (-1992.480) [-1993.362] (-1989.956) (-1998.798) * [-1996.278] (-1994.087) (-1993.807) (-1994.075) -- 0:01:33
388000 -- (-1997.306) (-2001.274) (-1990.197) [-1991.886] * (-1999.033) (-1997.998) (-1993.987) [-2001.543] -- 0:01:33
388500 -- (-1999.523) (-1992.582) [-1999.142] (-1997.045) * (-1997.969) (-1997.441) [-1999.233] (-1994.495) -- 0:01:32
389000 -- (-1993.303) (-1995.625) (-1996.502) [-1993.099] * (-1995.968) [-1990.545] (-1995.512) (-2016.613) -- 0:01:32
389500 -- (-1993.039) (-1990.873) [-1991.495] (-2003.447) * (-1991.567) (-2001.338) [-1992.059] (-1992.475) -- 0:01:32
390000 -- (-1995.684) [-2000.243] (-1999.842) (-1991.126) * (-1995.989) [-1994.101] (-2001.671) (-1992.669) -- 0:01:32
Average standard deviation of split frequencies: 0.000000
390500 -- (-1996.599) [-1996.582] (-1998.532) (-1995.696) * [-1992.905] (-2002.044) (-1992.600) (-2002.284) -- 0:01:33
391000 -- (-1993.872) (-1998.005) [-1999.781] (-1990.944) * (-1997.478) [-1989.430] (-1995.066) (-1993.091) -- 0:01:33
391500 -- (-2001.837) [-1995.468] (-1993.697) (-1995.453) * [-1994.993] (-1997.976) (-1990.568) (-1996.118) -- 0:01:33
392000 -- (-1996.975) (-1995.419) [-1995.855] (-1997.490) * (-2004.848) [-1991.330] (-1994.306) (-1993.939) -- 0:01:33
392500 -- (-2002.917) [-1993.501] (-2004.389) (-1998.975) * (-1993.199) [-1997.922] (-1994.703) (-1994.714) -- 0:01:32
393000 -- (-1999.678) (-1994.004) (-1997.473) [-1990.441] * (-1997.767) [-1994.282] (-1996.410) (-2000.549) -- 0:01:32
393500 -- [-1990.724] (-1997.958) (-1993.390) (-1990.324) * (-1995.863) [-1994.368] (-1995.309) (-1998.764) -- 0:01:32
394000 -- (-1994.630) (-1994.291) (-1996.044) [-1992.520] * [-1990.684] (-1998.266) (-1993.129) (-1998.880) -- 0:01:32
394500 -- (-1992.319) (-2002.187) [-1997.236] (-1992.161) * [-1992.057] (-1992.961) (-1994.848) (-1997.567) -- 0:01:32
395000 -- [-1990.397] (-1996.323) (-1996.657) (-1993.076) * (-1991.897) (-1996.228) [-1995.617] (-1998.630) -- 0:01:31
Average standard deviation of split frequencies: 0.000000
395500 -- (-1988.079) (-2000.103) (-1993.141) [-2000.230] * (-1994.555) (-1999.375) [-1994.810] (-1995.427) -- 0:01:31
396000 -- (-1999.757) (-2012.043) (-1994.770) [-1992.361] * (-1996.332) (-2000.323) (-1994.222) [-1997.271] -- 0:01:31
396500 -- [-1992.136] (-2016.051) (-2004.011) (-2001.090) * (-2005.148) (-1994.848) [-1993.252] (-2001.888) -- 0:01:31
397000 -- (-1994.211) (-2006.865) (-1993.839) [-1993.578] * (-1998.439) (-2004.618) (-1992.835) [-1993.454] -- 0:01:32
397500 -- (-2001.731) [-2000.398] (-1993.399) (-2000.816) * (-1996.649) (-1998.585) [-1994.774] (-1995.709) -- 0:01:32
398000 -- (-1993.990) (-1995.303) [-1991.118] (-1998.073) * (-2001.497) [-1993.973] (-1994.772) (-1994.694) -- 0:01:32
398500 -- (-1992.297) (-1993.347) [-1991.607] (-1990.478) * (-1992.824) [-1992.088] (-2007.307) (-1997.448) -- 0:01:32
399000 -- [-1993.866] (-1997.658) (-1999.673) (-1992.515) * [-1995.208] (-1997.953) (-1996.512) (-1997.155) -- 0:01:31
399500 -- (-1999.151) [-1994.626] (-1992.879) (-1994.806) * (-2001.639) (-2000.188) (-1995.330) [-1993.588] -- 0:01:31
400000 -- (-1998.484) (-1998.848) (-1992.088) [-1996.082] * (-1997.944) [-1999.316] (-1998.413) (-2003.213) -- 0:01:31
Average standard deviation of split frequencies: 0.000000
400500 -- (-1998.532) (-1994.226) (-1990.883) [-2003.657] * (-2000.341) (-2000.187) [-1990.030] (-2002.317) -- 0:01:31
401000 -- (-1998.992) (-2001.726) (-1993.054) [-1990.711] * (-1996.904) [-1994.589] (-1995.901) (-2007.196) -- 0:01:31
401500 -- (-2001.559) (-1995.093) (-1995.318) [-1995.064] * (-2006.266) [-1994.706] (-2000.139) (-1994.467) -- 0:01:30
402000 -- (-2005.251) [-1990.914] (-1993.229) (-1998.188) * (-1991.780) [-1994.814] (-1994.623) (-1992.704) -- 0:01:30
402500 -- (-2001.019) (-1993.546) (-1996.605) [-1993.398] * (-1994.565) (-1998.564) [-1994.684] (-1997.002) -- 0:01:30
403000 -- (-1995.498) (-1995.315) (-1998.420) [-1996.366] * (-2000.179) (-1990.915) [-1996.982] (-1994.022) -- 0:01:30
403500 -- (-1999.378) [-1992.491] (-2002.981) (-1991.487) * (-1998.717) [-1994.729] (-1991.157) (-1995.007) -- 0:01:31
404000 -- (-2000.532) (-1991.244) [-1994.196] (-1998.385) * (-1998.429) (-1998.318) [-1999.431] (-1998.213) -- 0:01:31
404500 -- (-1999.881) (-1996.284) (-1994.746) [-1988.965] * [-2000.555] (-1993.665) (-2003.765) (-1992.075) -- 0:01:31
405000 -- [-1997.474] (-1991.724) (-1993.947) (-1992.619) * (-2009.643) (-1993.270) (-2000.460) [-1995.575] -- 0:01:31
Average standard deviation of split frequencies: 0.000000
405500 -- [-1995.121] (-1997.171) (-1990.763) (-1995.407) * (-1992.369) (-2000.491) [-1996.896] (-1995.635) -- 0:01:30
406000 -- (-2004.543) (-1993.658) (-1995.626) [-1992.376] * (-1997.880) (-1997.290) (-1996.474) [-1990.647] -- 0:01:30
406500 -- (-1991.875) (-1995.089) (-1995.837) [-1994.914] * (-1995.410) [-1997.793] (-1992.512) (-1998.280) -- 0:01:30
407000 -- (-1996.877) (-2001.559) [-1994.904] (-2000.145) * (-1994.720) [-1999.853] (-1993.519) (-1994.949) -- 0:01:30
407500 -- (-1997.921) (-1993.645) (-1989.746) [-1993.052] * [-1992.891] (-1997.060) (-1993.649) (-1995.708) -- 0:01:30
408000 -- (-1993.487) [-1994.134] (-1993.567) (-1992.397) * [-1992.736] (-2005.675) (-2000.388) (-1997.041) -- 0:01:29
408500 -- [-1988.573] (-1998.469) (-1995.708) (-1994.183) * (-1996.615) [-1998.490] (-2000.700) (-1994.164) -- 0:01:29
409000 -- (-1999.745) [-1994.586] (-1993.430) (-1992.363) * (-2003.324) (-2004.487) (-1993.857) [-1994.141] -- 0:01:29
409500 -- (-1996.203) [-1990.359] (-1990.514) (-1998.418) * (-2000.614) [-1991.264] (-1993.738) (-1994.687) -- 0:01:29
410000 -- (-1995.915) (-1991.827) [-1997.732] (-1995.943) * (-2002.933) [-1993.360] (-1994.461) (-1997.633) -- 0:01:30
Average standard deviation of split frequencies: 0.000000
410500 -- [-1996.949] (-1992.559) (-1991.374) (-1993.900) * (-2001.514) [-1994.951] (-1992.208) (-1993.347) -- 0:01:30
411000 -- [-1996.288] (-1994.455) (-1995.062) (-1993.019) * [-1997.151] (-1994.370) (-2005.517) (-2000.068) -- 0:01:30
411500 -- (-1998.986) (-1996.741) (-1994.313) [-1989.823] * (-2000.606) [-1995.333] (-2009.934) (-1992.202) -- 0:01:30
412000 -- (-1994.404) (-1999.261) (-1995.670) [-1992.183] * [-1991.451] (-2001.161) (-1992.891) (-1998.308) -- 0:01:29
412500 -- [-1996.533] (-2004.504) (-2004.663) (-1994.244) * [-1999.603] (-1996.206) (-2000.304) (-1994.204) -- 0:01:29
413000 -- (-2000.768) (-1998.886) (-2000.304) [-1989.046] * [-1995.641] (-1998.210) (-1992.281) (-1989.757) -- 0:01:29
413500 -- (-1995.769) (-1997.706) [-1995.472] (-1999.390) * (-1998.081) (-1994.039) [-1994.620] (-1994.972) -- 0:01:29
414000 -- (-2011.092) [-1991.636] (-1997.376) (-2005.353) * [-1994.639] (-1993.115) (-1997.627) (-1994.040) -- 0:01:29
414500 -- (-1995.725) [-1994.771] (-1998.302) (-1990.920) * (-1994.200) (-1992.104) (-1999.786) [-1994.659] -- 0:01:28
415000 -- (-1992.419) (-2010.231) (-1996.002) [-1994.412] * (-1996.708) [-1991.257] (-1994.530) (-1996.869) -- 0:01:28
Average standard deviation of split frequencies: 0.000000
415500 -- (-1991.699) (-2001.576) [-1996.029] (-1994.646) * (-1990.945) [-1998.640] (-1996.415) (-1995.998) -- 0:01:28
416000 -- [-1993.631] (-1996.037) (-1990.250) (-1991.690) * (-1999.270) (-2001.925) [-1994.296] (-1990.208) -- 0:01:28
416500 -- (-1997.189) [-1993.493] (-1994.301) (-1991.523) * [-1992.595] (-1996.578) (-1993.563) (-1996.677) -- 0:01:29
417000 -- (-2008.933) (-1999.246) [-1993.803] (-1997.433) * [-1994.485] (-1995.462) (-1995.982) (-1999.190) -- 0:01:29
417500 -- (-1999.610) (-1998.085) [-1996.395] (-1998.955) * (-1990.573) [-1990.492] (-1994.019) (-1994.997) -- 0:01:29
418000 -- (-1994.758) (-1994.273) [-1996.033] (-1995.017) * (-1993.439) (-1995.275) [-1992.608] (-1990.326) -- 0:01:29
418500 -- (-1999.212) [-1994.874] (-1993.947) (-1997.786) * (-1993.914) (-2003.714) (-1999.615) [-1994.490] -- 0:01:28
419000 -- (-1995.505) (-1999.351) [-1993.649] (-1992.486) * (-2002.519) (-1993.286) (-2004.598) [-1991.853] -- 0:01:28
419500 -- (-1994.518) [-1991.344] (-1993.174) (-1995.028) * (-2000.176) [-1997.298] (-1998.179) (-1991.261) -- 0:01:28
420000 -- (-1998.363) (-1995.846) [-1999.443] (-1993.139) * (-2002.834) (-1996.015) [-1993.673] (-1994.581) -- 0:01:28
Average standard deviation of split frequencies: 0.000000
420500 -- [-1993.400] (-1996.147) (-1993.470) (-1992.079) * (-1996.547) (-2000.927) [-1996.228] (-1997.816) -- 0:01:28
421000 -- (-1996.043) [-1992.021] (-1998.001) (-1999.224) * (-1991.475) [-1997.812] (-1997.676) (-1991.974) -- 0:01:28
421500 -- (-1993.638) (-1999.634) (-1996.549) [-1992.602] * [-1998.035] (-1992.844) (-1996.942) (-2003.827) -- 0:01:27
422000 -- [-2001.675] (-1994.993) (-1997.831) (-1996.743) * [-1998.030] (-2003.707) (-1996.877) (-1995.673) -- 0:01:27
422500 -- (-1991.142) (-1994.619) [-1995.289] (-1997.694) * [-1994.248] (-1995.020) (-1990.225) (-1996.618) -- 0:01:27
423000 -- [-1995.162] (-1999.881) (-1992.051) (-1998.614) * (-1994.778) [-1993.779] (-1997.647) (-1993.963) -- 0:01:28
423500 -- [-1993.025] (-2000.838) (-1990.652) (-2000.940) * (-1993.319) (-1996.952) [-1995.452] (-1994.471) -- 0:01:28
424000 -- (-2000.655) (-1995.244) (-1997.610) [-1995.541] * [-1992.097] (-2002.159) (-1995.939) (-1994.773) -- 0:01:28
424500 -- (-1995.449) (-1993.969) [-2001.187] (-2000.580) * (-1999.066) (-1991.147) [-1996.574] (-1993.837) -- 0:01:28
425000 -- [-1994.315] (-2001.401) (-1993.310) (-2001.846) * (-2001.762) (-1992.404) [-1992.112] (-1991.984) -- 0:01:27
Average standard deviation of split frequencies: 0.000000
425500 -- (-1994.803) (-1998.302) (-1989.132) [-1995.023] * (-1992.678) (-2002.424) [-1995.736] (-1993.478) -- 0:01:27
426000 -- (-1990.393) (-1994.677) (-1992.602) [-1997.792] * (-1995.215) [-1995.205] (-1994.353) (-1994.829) -- 0:01:27
426500 -- (-1996.757) [-1994.881] (-1994.943) (-1995.987) * (-1996.899) (-1989.884) (-1997.129) [-1998.902] -- 0:01:27
427000 -- [-1992.163] (-1994.224) (-1994.560) (-1996.364) * (-2002.123) (-1998.621) (-1992.901) [-1992.701] -- 0:01:27
427500 -- (-1994.673) (-1998.273) [-1997.647] (-1997.953) * (-1998.095) (-1994.402) [-1996.918] (-1990.659) -- 0:01:27
428000 -- (-1990.753) [-2000.600] (-2005.430) (-2000.887) * (-1994.588) (-2006.765) [-1996.691] (-1996.458) -- 0:01:26
428500 -- [-1993.647] (-2006.535) (-1996.015) (-2002.709) * (-1999.039) (-2000.295) [-1992.048] (-1997.183) -- 0:01:26
429000 -- (-1993.053) (-1995.972) [-1994.880] (-1990.665) * (-1997.892) (-1998.048) [-1995.690] (-1993.289) -- 0:01:26
429500 -- (-1991.407) (-1995.062) [-1994.127] (-2000.188) * [-1991.564] (-1994.763) (-1998.960) (-1994.092) -- 0:01:27
430000 -- (-1988.572) (-1993.841) (-1993.390) [-1997.698] * [-1991.026] (-2005.449) (-2002.903) (-1993.367) -- 0:01:27
Average standard deviation of split frequencies: 0.000000
430500 -- (-1992.320) [-1992.896] (-1992.718) (-1993.345) * (-1996.190) (-2001.975) (-1998.668) [-1992.635] -- 0:01:27
431000 -- (-1995.094) (-1999.610) [-1991.514] (-1993.802) * (-1999.573) (-1995.327) [-1993.697] (-1996.294) -- 0:01:27
431500 -- (-1993.233) (-1993.505) [-1993.173] (-2002.044) * (-2001.187) [-1995.851] (-1995.140) (-1994.894) -- 0:01:26
432000 -- [-1996.373] (-2003.363) (-1996.341) (-2001.615) * (-1994.167) (-1993.602) (-2005.056) [-1994.085] -- 0:01:26
432500 -- (-1997.757) [-1996.686] (-1996.348) (-1996.292) * [-1993.761] (-1995.404) (-1997.723) (-2001.242) -- 0:01:26
433000 -- [-1998.160] (-1993.791) (-1994.033) (-1995.016) * (-1995.134) (-1995.975) [-2001.291] (-2004.048) -- 0:01:26
433500 -- (-1994.413) [-1993.170] (-1993.227) (-1991.253) * [-2000.867] (-1997.260) (-1996.847) (-1997.491) -- 0:01:26
434000 -- (-1992.054) (-1998.144) [-1997.310] (-1993.720) * (-1995.169) (-1992.482) (-1997.746) [-1994.291] -- 0:01:26
434500 -- [-1995.794] (-1993.218) (-1996.958) (-1992.624) * (-2001.385) (-2006.505) (-1998.464) [-1997.614] -- 0:01:25
435000 -- [-1992.868] (-1998.592) (-1994.950) (-1993.136) * (-1994.885) (-2003.432) (-2000.467) [-1994.596] -- 0:01:25
Average standard deviation of split frequencies: 0.000000
435500 -- (-2005.608) (-1996.880) (-1993.695) [-1994.703] * (-1989.651) [-1996.353] (-1992.609) (-2003.207) -- 0:01:25
436000 -- [-1996.285] (-1997.255) (-1994.955) (-2002.065) * (-1996.415) (-1993.378) [-1994.185] (-2002.271) -- 0:01:26
436500 -- (-1992.021) (-1995.687) [-1989.382] (-2004.167) * (-1994.717) [-1994.833] (-1994.290) (-1994.321) -- 0:01:26
437000 -- (-1998.230) (-1999.369) [-1993.515] (-2004.502) * (-1993.105) [-1995.675] (-1991.626) (-2003.018) -- 0:01:26
437500 -- (-1994.792) [-1999.348] (-2001.837) (-2009.483) * (-1999.748) (-1993.825) [-2001.673] (-1995.862) -- 0:01:26
438000 -- (-1995.528) [-1994.090] (-1999.595) (-1994.892) * (-1994.098) (-2002.099) [-1991.278] (-1993.533) -- 0:01:25
438500 -- [-1995.039] (-1999.140) (-2000.261) (-1997.284) * [-1995.639] (-1996.782) (-1996.228) (-1996.850) -- 0:01:25
439000 -- [-1994.810] (-1994.474) (-1998.720) (-1997.344) * (-1997.040) (-1997.043) [-1997.412] (-1996.013) -- 0:01:25
439500 -- (-1997.331) (-1995.774) [-1996.571] (-1991.402) * (-2001.322) (-2002.879) (-1998.713) [-1992.499] -- 0:01:25
440000 -- (-1996.702) (-1993.263) (-1993.191) [-1991.694] * (-1991.166) (-1999.489) (-1997.087) [-1993.539] -- 0:01:25
Average standard deviation of split frequencies: 0.000000
440500 -- [-1997.750] (-1996.442) (-1997.867) (-1989.306) * (-1992.185) (-2002.643) (-2001.744) [-1992.168] -- 0:01:25
441000 -- [-1996.666] (-2001.314) (-1993.575) (-1993.083) * (-1998.011) (-2008.847) [-1994.620] (-1994.508) -- 0:01:24
441500 -- (-1993.101) [-2009.505] (-1996.457) (-1997.892) * [-1994.539] (-2004.878) (-1989.423) (-1993.155) -- 0:01:24
442000 -- [-1999.185] (-1991.877) (-1991.354) (-1995.409) * (-2005.447) (-2000.020) [-1993.492] (-1995.454) -- 0:01:24
442500 -- (-1994.571) (-1992.086) [-1996.891] (-1994.293) * [-2001.852] (-1996.022) (-1994.196) (-1997.799) -- 0:01:25
443000 -- (-1990.388) (-1992.870) [-1994.076] (-1993.982) * (-1998.677) (-1996.334) (-1994.849) [-1994.280] -- 0:01:25
443500 -- (-1992.735) (-1995.350) (-1992.733) [-1993.941] * (-2000.238) (-1993.227) [-1993.478] (-2002.622) -- 0:01:25
444000 -- [-1989.336] (-1998.382) (-1997.121) (-1993.912) * (-1997.666) (-1994.493) [-1997.954] (-1990.696) -- 0:01:25
444500 -- [-1995.703] (-1995.507) (-2000.343) (-1996.406) * [-1995.993] (-1994.402) (-2001.155) (-1995.052) -- 0:01:24
445000 -- (-1990.065) [-2001.300] (-1992.614) (-1992.628) * [-1997.440] (-1994.884) (-2002.213) (-1999.282) -- 0:01:24
Average standard deviation of split frequencies: 0.000000
445500 -- (-1995.183) (-2001.235) [-1995.811] (-2001.953) * (-1994.565) [-1992.339] (-1994.874) (-2000.941) -- 0:01:24
446000 -- (-1999.935) (-1996.012) [-1993.906] (-1994.501) * (-1991.240) [-1995.204] (-1997.928) (-1992.760) -- 0:01:24
446500 -- (-1996.169) (-1996.048) (-1992.728) [-2000.195] * (-1995.185) (-1991.106) (-1997.595) [-1998.274] -- 0:01:24
447000 -- (-1998.682) (-1993.796) (-1989.997) [-1997.885] * (-1993.822) (-1992.877) [-1993.136] (-1997.179) -- 0:01:24
447500 -- (-1989.998) (-1997.318) [-1992.883] (-1995.418) * (-1995.708) (-1995.549) [-1995.801] (-1991.200) -- 0:01:23
448000 -- [-1997.098] (-1998.315) (-1994.514) (-1995.482) * [-1992.438] (-1994.569) (-1996.434) (-1991.867) -- 0:01:23
448500 -- (-1993.862) (-1993.524) (-1988.676) [-1998.728] * [-2001.553] (-1996.814) (-1996.405) (-1994.999) -- 0:01:23
449000 -- [-1992.992] (-1992.808) (-1994.426) (-1994.410) * [-1992.267] (-2000.630) (-2006.968) (-1994.505) -- 0:01:24
449500 -- (-1997.618) (-1990.907) (-1991.868) [-1998.949] * (-1999.925) (-1994.823) [-1995.758] (-2000.679) -- 0:01:24
450000 -- (-2006.337) (-1996.511) [-1989.867] (-1996.848) * (-1996.460) (-1999.171) (-1998.068) [-1995.804] -- 0:01:24
Average standard deviation of split frequencies: 0.000000
450500 -- [-1996.554] (-1992.779) (-1996.850) (-1999.532) * (-1998.490) (-1992.616) (-2007.273) [-1994.330] -- 0:01:24
451000 -- (-1999.186) [-1996.229] (-2004.143) (-1997.592) * [-1996.626] (-1998.681) (-2002.035) (-1999.958) -- 0:01:23
451500 -- (-1993.482) (-1993.805) [-1996.295] (-1995.211) * (-1998.667) [-1998.542] (-1991.934) (-1999.718) -- 0:01:23
452000 -- (-1992.565) (-1994.657) (-1994.116) [-1995.545] * [-1993.668] (-1994.083) (-1997.558) (-1995.133) -- 0:01:23
452500 -- (-1994.629) (-1997.893) [-1993.988] (-1995.659) * (-1989.994) (-1994.338) (-1996.091) [-2001.314] -- 0:01:23
453000 -- (-1998.887) [-1992.804] (-1993.956) (-1991.682) * (-1999.686) (-1993.405) (-1994.097) [-1992.717] -- 0:01:23
453500 -- (-1993.253) [-1992.208] (-1997.898) (-1999.705) * (-1994.020) (-1996.045) (-1997.982) [-1998.907] -- 0:01:23
454000 -- [-1998.418] (-1991.679) (-1992.647) (-1994.494) * [-1993.214] (-1999.389) (-1990.634) (-1997.778) -- 0:01:22
454500 -- (-1997.004) (-1994.714) [-1990.777] (-1999.748) * [-1999.569] (-1992.074) (-1997.646) (-1997.644) -- 0:01:22
455000 -- (-1996.489) [-1992.363] (-1997.130) (-1997.906) * (-1997.574) [-1994.517] (-1995.880) (-1990.612) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
455500 -- (-1994.755) [-1994.550] (-1990.226) (-1994.229) * [-1998.076] (-1992.989) (-1996.755) (-1997.756) -- 0:01:23
456000 -- [-1995.496] (-1994.568) (-1996.720) (-1998.440) * (-1993.182) (-1993.103) (-1996.843) [-1996.916] -- 0:01:23
456500 -- (-1995.723) (-1996.705) (-1992.433) [-1991.384] * [-1992.927] (-1998.201) (-1997.025) (-1996.142) -- 0:01:23
457000 -- (-1995.055) (-1999.589) [-1993.984] (-1993.448) * (-1988.964) (-2000.207) [-1999.503] (-1997.283) -- 0:01:23
457500 -- (-1995.717) (-1996.396) [-1990.221] (-1996.648) * (-1998.143) (-1998.586) (-1994.663) [-1993.869] -- 0:01:23
458000 -- (-1998.654) (-1998.382) [-1995.370] (-2001.469) * (-1993.680) (-1994.565) (-1994.721) [-1998.230] -- 0:01:22
458500 -- (-1994.045) [-1994.565] (-2001.476) (-1994.340) * [-1998.207] (-2009.137) (-1993.601) (-2000.178) -- 0:01:22
459000 -- (-1990.897) [-1992.593] (-2001.022) (-1996.315) * (-1997.017) (-2000.505) (-1994.682) [-1995.830] -- 0:01:22
459500 -- (-1992.911) (-1993.342) (-2002.226) [-1997.756] * (-1993.153) (-1994.989) (-1992.364) [-1992.140] -- 0:01:22
460000 -- [-1994.130] (-1995.005) (-1993.062) (-1992.625) * (-1991.693) [-1997.817] (-1991.310) (-1997.485) -- 0:01:22
Average standard deviation of split frequencies: 0.000000
460500 -- (-1990.488) (-1989.704) (-1996.796) [-1991.337] * (-1991.822) [-1991.797] (-1997.821) (-1996.195) -- 0:01:22
461000 -- (-1990.132) [-1992.960] (-1991.171) (-1998.061) * (-1991.984) [-1993.557] (-2001.146) (-1993.079) -- 0:01:21
461500 -- (-1990.109) [-1990.283] (-1992.270) (-2004.270) * (-1996.398) [-1991.482] (-1994.195) (-1992.817) -- 0:01:21
462000 -- [-1989.923] (-1997.713) (-1993.462) (-2000.674) * (-1989.806) [-1995.488] (-2000.046) (-1992.828) -- 0:01:22
462500 -- (-1990.035) [-1997.338] (-2007.865) (-2000.589) * [-1994.684] (-1991.316) (-1992.899) (-1993.605) -- 0:01:22
463000 -- (-1995.512) [-1995.953] (-2003.705) (-1991.088) * (-1995.302) [-1995.035] (-2001.279) (-1996.737) -- 0:01:22
463500 -- (-1994.938) [-1991.285] (-1995.408) (-1999.268) * (-1992.789) (-1993.902) (-1996.867) [-2001.283] -- 0:01:22
464000 -- (-1991.965) (-1994.546) [-1992.304] (-1995.176) * (-1997.418) (-2001.249) (-1997.204) [-1997.016] -- 0:01:22
464500 -- (-2000.512) [-1994.319] (-1997.941) (-1990.267) * (-2008.501) (-2008.973) [-1991.889] (-1992.121) -- 0:01:21
465000 -- (-1997.750) (-1991.630) (-1996.843) [-1989.903] * (-1994.241) (-1993.675) [-1993.264] (-1994.898) -- 0:01:21
Average standard deviation of split frequencies: 0.000000
465500 -- (-1991.344) (-1998.329) [-1991.491] (-1991.348) * (-2002.439) (-1994.822) (-1992.115) [-1996.289] -- 0:01:21
466000 -- (-1995.902) (-1995.984) [-1993.013] (-1993.322) * [-1993.215] (-1996.492) (-1998.792) (-1996.681) -- 0:01:21
466500 -- (-2000.500) (-1998.086) (-1991.825) [-1996.075] * [-1995.705] (-2002.797) (-1991.538) (-1994.674) -- 0:01:21
467000 -- (-1997.200) (-1999.879) (-1995.896) [-1994.871] * [-1996.835] (-1998.840) (-1995.874) (-1995.960) -- 0:01:21
467500 -- (-2001.621) [-1999.015] (-1995.439) (-1988.828) * (-2004.122) (-1995.272) [-1994.641] (-1996.097) -- 0:01:20
468000 -- (-1997.856) [-1993.007] (-1998.017) (-1988.747) * (-1997.229) [-2000.875] (-1997.566) (-1999.128) -- 0:01:20
468500 -- (-1996.771) (-2004.360) [-1998.037] (-1996.996) * [-1993.788] (-1996.211) (-1993.896) (-2000.505) -- 0:01:21
469000 -- (-1996.960) (-2002.351) [-1989.273] (-1992.578) * (-1992.424) [-1995.162] (-1999.062) (-1992.664) -- 0:01:21
469500 -- (-1997.564) (-1991.216) (-1995.618) [-1991.923] * (-1991.843) (-1994.094) [-1996.441] (-1995.124) -- 0:01:21
470000 -- (-1995.986) (-1991.913) [-1989.927] (-2005.520) * [-1997.101] (-2000.007) (-1994.676) (-2000.032) -- 0:01:21
Average standard deviation of split frequencies: 0.000000
470500 -- [-1992.390] (-1994.550) (-1993.458) (-1997.201) * (-1993.107) (-1996.948) [-2001.686] (-1998.655) -- 0:01:21
471000 -- (-1998.257) [-1993.391] (-1996.511) (-1994.897) * [-1994.212] (-1996.199) (-1993.179) (-1996.492) -- 0:01:20
471500 -- (-1995.786) [-1993.742] (-1992.259) (-1992.108) * (-2003.307) [-1995.007] (-1996.466) (-1997.005) -- 0:01:20
472000 -- (-2002.262) (-1988.721) (-1994.972) [-1992.379] * [-1991.804] (-1996.208) (-1992.910) (-1994.713) -- 0:01:20
472500 -- (-2001.658) (-1993.094) [-1997.109] (-1998.601) * (-1996.831) (-1993.813) (-1999.399) [-1995.381] -- 0:01:20
473000 -- (-1995.367) (-1998.737) (-1991.434) [-1996.906] * (-1995.509) (-1992.979) [-1998.559] (-1991.167) -- 0:01:20
473500 -- (-1996.985) (-1998.843) [-1991.858] (-2003.215) * (-1996.444) (-1999.826) [-2000.545] (-1998.748) -- 0:01:20
474000 -- (-1999.066) [-1997.321] (-1998.595) (-1999.035) * (-1992.732) (-1993.110) (-1997.769) [-1995.868] -- 0:01:19
474500 -- [-1996.333] (-1995.230) (-1996.891) (-1997.895) * (-1994.217) (-2000.493) (-1996.539) [-1993.332] -- 0:01:19
475000 -- (-1990.931) [-1994.241] (-1996.872) (-1994.307) * (-1992.889) (-2000.907) [-1994.167] (-1998.744) -- 0:01:20
Average standard deviation of split frequencies: 0.000000
475500 -- (-1997.112) (-1997.777) [-1999.104] (-2000.627) * (-1991.087) (-2002.420) [-1994.345] (-1993.364) -- 0:01:20
476000 -- (-2000.774) (-1997.941) [-1996.535] (-1995.985) * (-1996.816) [-2001.176] (-1989.928) (-1995.758) -- 0:01:20
476500 -- (-2000.800) (-1996.311) [-1999.492] (-2002.816) * (-1994.461) (-2001.681) [-1992.247] (-1999.656) -- 0:01:20
477000 -- (-1999.729) (-1998.155) [-1992.886] (-1996.257) * [-2001.981] (-1993.551) (-1993.059) (-2001.053) -- 0:01:20
477500 -- (-2000.451) (-1996.904) (-1997.699) [-1997.581] * (-1991.271) (-1998.851) [-1998.501] (-2001.734) -- 0:01:19
478000 -- (-1994.435) (-1999.456) (-1994.724) [-1997.864] * [-1993.996] (-1993.846) (-1997.070) (-1994.254) -- 0:01:19
478500 -- (-1993.298) [-1989.502] (-2003.427) (-1996.579) * (-1998.371) (-1995.323) [-1996.153] (-1996.069) -- 0:01:19
479000 -- (-1993.628) [-1995.116] (-1993.766) (-1994.291) * (-1997.764) [-1997.894] (-1994.405) (-2003.523) -- 0:01:19
479500 -- (-1996.175) (-1996.753) [-1999.112] (-1993.919) * (-1998.146) [-1994.258] (-1995.238) (-1998.453) -- 0:01:19
480000 -- (-2004.700) [-1993.435] (-1992.594) (-1994.872) * [-1995.634] (-1997.189) (-1997.861) (-1997.771) -- 0:01:19
Average standard deviation of split frequencies: 0.000000
480500 -- (-1995.887) (-1997.932) (-1996.961) [-1999.097] * [-1994.270] (-1992.842) (-1992.476) (-1997.347) -- 0:01:18
481000 -- [-1997.433] (-1992.427) (-1995.934) (-1996.719) * (-1990.922) (-1993.870) [-1992.049] (-1994.731) -- 0:01:18
481500 -- (-1994.342) (-1994.310) [-1993.045] (-1997.250) * (-1994.109) (-1994.684) [-1993.361] (-2000.737) -- 0:01:19
482000 -- (-1993.388) [-1992.460] (-1995.737) (-1995.144) * (-1994.604) (-1995.300) (-1998.197) [-1998.844] -- 0:01:19
482500 -- (-1994.982) (-1995.474) (-1995.487) [-1993.803] * (-1994.652) (-1992.709) (-1990.831) [-2000.008] -- 0:01:19
483000 -- (-1996.430) (-1993.292) (-1993.780) [-1997.026] * (-1995.066) (-1999.676) [-1994.630] (-1994.861) -- 0:01:19
483500 -- (-1995.049) [-1997.484] (-1995.705) (-1995.258) * [-1994.824] (-1993.444) (-2001.751) (-1995.024) -- 0:01:19
484000 -- (-1995.842) [-2003.622] (-1994.991) (-1995.109) * (-1995.946) (-1989.087) (-1993.741) [-1994.143] -- 0:01:18
484500 -- [-1995.829] (-1994.900) (-2000.256) (-1998.252) * (-1994.449) [-1992.295] (-1994.379) (-1994.287) -- 0:01:18
485000 -- (-1997.465) [-1995.696] (-1998.114) (-1997.927) * [-1997.699] (-1992.107) (-1993.727) (-1994.614) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
485500 -- (-1999.151) (-2002.010) (-2000.332) [-1994.484] * [-1996.926] (-1995.298) (-1995.691) (-1993.501) -- 0:01:18
486000 -- (-1993.082) [-1997.195] (-1995.599) (-1998.448) * (-1993.854) (-1999.612) [-1996.580] (-1998.869) -- 0:01:18
486500 -- (-1997.078) (-1993.049) [-1995.073] (-1996.225) * [-1993.500] (-1994.777) (-1995.784) (-1998.580) -- 0:01:18
487000 -- (-1998.288) (-1989.283) [-1994.470] (-1995.109) * [-1997.745] (-1994.502) (-1998.378) (-1997.917) -- 0:01:17
487500 -- (-2000.757) (-1998.072) (-1991.171) [-1995.718] * (-1995.068) [-1992.748] (-1993.790) (-1992.542) -- 0:01:17
488000 -- (-1998.871) (-1992.089) (-1998.819) [-1991.665] * (-2003.875) (-1996.248) [-1992.740] (-1996.368) -- 0:01:18
488500 -- (-1999.995) (-1995.701) (-1994.264) [-1997.643] * (-2006.729) (-1994.396) [-1995.283] (-1995.591) -- 0:01:18
489000 -- [-1994.472] (-1994.659) (-1991.401) (-1992.393) * (-1994.901) (-1996.712) [-1992.070] (-1995.039) -- 0:01:18
489500 -- (-1991.841) (-1993.606) [-1992.773] (-1994.846) * (-2003.020) (-1994.489) [-1992.179] (-1991.076) -- 0:01:18
490000 -- (-1995.464) (-1990.978) [-1993.432] (-1993.029) * (-2005.233) (-1996.685) [-1997.425] (-2000.273) -- 0:01:18
Average standard deviation of split frequencies: 0.000000
490500 -- (-1990.989) [-1995.244] (-1993.405) (-2001.030) * (-1995.582) (-1994.940) [-2000.048] (-2005.904) -- 0:01:17
491000 -- (-1995.560) [-1996.868] (-1992.631) (-1991.936) * (-1996.076) [-1994.124] (-1994.058) (-1998.896) -- 0:01:17
491500 -- (-1996.439) (-1995.460) (-1997.289) [-1992.257] * [-1995.036] (-1993.663) (-1989.630) (-1997.751) -- 0:01:17
492000 -- (-1997.024) (-1995.371) [-1996.997] (-1998.048) * (-1997.274) [-1994.667] (-1992.296) (-1991.201) -- 0:01:17
492500 -- (-1994.488) (-1989.113) (-1992.746) [-1993.084] * (-1993.105) (-1995.086) [-1990.293] (-1995.917) -- 0:01:17
493000 -- (-1997.001) (-1993.942) [-1991.860] (-1991.274) * (-1999.483) (-1995.234) [-1992.611] (-1995.529) -- 0:01:17
493500 -- [-1994.042] (-2003.413) (-2001.310) (-1994.977) * (-1995.485) [-1994.453] (-1993.587) (-2002.658) -- 0:01:16
494000 -- (-1999.031) (-1992.574) [-1991.960] (-1994.478) * (-1995.901) (-1995.459) (-1994.834) [-1998.668] -- 0:01:17
494500 -- (-1994.512) (-1995.061) (-2001.477) [-1992.468] * (-1995.143) (-2000.586) (-1993.050) [-1994.386] -- 0:01:17
495000 -- (-1995.198) (-2006.287) (-1989.844) [-1997.654] * [-1990.601] (-1989.081) (-1995.089) (-1993.276) -- 0:01:17
Average standard deviation of split frequencies: 0.000000
495500 -- (-1996.455) (-2002.337) [-1995.248] (-1995.375) * (-1993.117) (-1996.236) [-1997.858] (-1992.168) -- 0:01:17
496000 -- (-1997.186) (-2007.018) [-1992.892] (-1992.367) * (-1998.641) (-1998.107) [-1998.052] (-2004.633) -- 0:01:17
496500 -- (-1995.002) (-1994.983) (-1992.871) [-1996.420] * (-1994.052) (-1996.537) [-2004.168] (-2010.374) -- 0:01:17
497000 -- (-1991.869) [-1992.226] (-1999.799) (-1994.846) * (-1998.626) [-1996.524] (-1999.144) (-1996.379) -- 0:01:16
497500 -- (-1995.924) (-1989.675) (-1996.501) [-1993.273] * (-1993.342) (-2000.874) (-2002.346) [-1997.967] -- 0:01:16
498000 -- (-1994.693) (-2000.192) (-1994.125) [-1992.663] * (-1996.445) (-1995.958) (-1998.372) [-1994.162] -- 0:01:16
498500 -- (-1992.307) (-1995.964) [-1993.464] (-1994.020) * (-1994.111) [-1991.418] (-1999.092) (-1993.860) -- 0:01:16
499000 -- (-1996.116) (-2002.374) (-1992.569) [-1993.479] * (-1996.510) (-1993.376) (-1997.830) [-1995.488] -- 0:01:16
499500 -- (-1998.069) (-2000.372) [-1992.841] (-2004.577) * (-1999.233) (-1996.719) (-1993.462) [-1991.024] -- 0:01:16
500000 -- (-1993.934) (-1995.152) [-2000.424] (-1998.189) * [-1997.249] (-2000.734) (-1992.738) (-1998.552) -- 0:01:16
Average standard deviation of split frequencies: 0.000000
500500 -- [-1997.093] (-1995.347) (-2003.339) (-1995.915) * [-1995.667] (-1994.865) (-1992.480) (-1991.172) -- 0:01:16
501000 -- (-1992.648) (-2000.340) (-1996.437) [-1992.472] * (-1997.872) [-1988.942] (-1996.306) (-2007.297) -- 0:01:16
501500 -- (-1994.046) [-1995.778] (-2001.430) (-1992.985) * (-1992.132) [-1995.031] (-1993.794) (-1997.092) -- 0:01:16
502000 -- (-1997.091) [-1992.224] (-1995.372) (-1993.582) * [-1994.696] (-1995.122) (-1993.585) (-1998.732) -- 0:01:16
502500 -- (-1995.221) (-1990.987) (-1993.829) [-1998.741] * (-1994.646) (-1996.527) [-2000.857] (-1995.003) -- 0:01:16
503000 -- (-1998.151) [-1996.232] (-1997.548) (-1992.594) * (-1997.735) (-1995.331) [-1992.914] (-1994.114) -- 0:01:16
503500 -- (-1994.683) (-1995.580) [-1996.368] (-1994.400) * (-2003.656) [-1990.421] (-1999.355) (-1992.918) -- 0:01:15
504000 -- (-1995.373) (-1997.915) (-1993.152) [-1998.697] * (-1995.917) [-1996.414] (-1990.101) (-1998.045) -- 0:01:15
504500 -- (-1999.209) (-1995.631) [-1996.688] (-1992.239) * (-2003.362) (-1998.842) [-1996.554] (-1995.414) -- 0:01:15
505000 -- (-1994.264) (-1994.394) [-1994.519] (-1996.511) * (-1995.413) [-1998.829] (-1992.717) (-1994.192) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
505500 -- (-2003.866) (-1994.918) (-1997.714) [-1992.813] * (-1996.938) (-1995.755) (-2004.228) [-1996.441] -- 0:01:15
506000 -- (-1998.354) [-2000.523] (-2000.835) (-1992.912) * [-1991.855] (-1994.554) (-1994.845) (-1993.504) -- 0:01:15
506500 -- (-1994.885) (-2003.960) (-1999.364) [-1993.178] * (-2000.400) [-1994.749] (-1994.737) (-1990.186) -- 0:01:15
507000 -- (-1995.820) (-1996.860) (-1994.137) [-1994.023] * [-1992.194] (-2000.323) (-1996.348) (-1998.125) -- 0:01:15
507500 -- [-1994.911] (-1993.580) (-1994.680) (-1997.386) * (-1992.303) (-2002.962) (-1993.951) [-1997.304] -- 0:01:15
508000 -- (-1994.239) (-1992.741) (-2004.308) [-1994.108] * (-1994.346) (-1994.507) [-1995.364] (-1993.676) -- 0:01:15
508500 -- [-1995.442] (-1996.604) (-1995.051) (-1999.818) * (-1993.629) (-1997.242) (-2002.138) [-1995.201] -- 0:01:15
509000 -- [-1997.206] (-1995.111) (-1996.293) (-1999.625) * (-1991.043) (-1997.592) [-2001.189] (-1995.093) -- 0:01:15
509500 -- [-1993.752] (-1996.902) (-1996.576) (-1995.088) * [-1993.437] (-2000.023) (-2000.984) (-2001.879) -- 0:01:15
510000 -- (-2003.711) [-1991.706] (-1993.575) (-1990.690) * (-1990.204) (-2010.099) [-1993.051] (-2000.997) -- 0:01:14
Average standard deviation of split frequencies: 0.000000
510500 -- (-2000.144) (-1998.899) [-1995.253] (-1993.924) * (-1998.487) (-1996.150) (-2000.244) [-1995.409] -- 0:01:14
511000 -- (-1993.534) [-1994.048] (-1990.803) (-1997.482) * (-1999.839) (-1995.723) [-1993.898] (-1995.010) -- 0:01:14
511500 -- (-1994.047) [-1994.379] (-1993.056) (-1991.005) * (-1998.727) (-2004.548) (-1993.806) [-2000.808] -- 0:01:14
512000 -- (-2000.472) (-1990.785) (-1990.825) [-1996.122] * (-1995.530) [-2006.341] (-1997.503) (-1994.164) -- 0:01:14
512500 -- (-2001.079) (-1994.101) [-1989.470] (-1997.560) * (-1993.800) (-2008.288) [-1995.280] (-1996.613) -- 0:01:14
513000 -- (-2005.703) (-1994.910) [-1992.981] (-1995.272) * (-1997.110) (-1996.335) (-1991.503) [-1992.934] -- 0:01:14
513500 -- (-1991.015) (-1997.474) (-1996.435) [-1999.873] * (-1995.344) [-2002.112] (-1999.193) (-1998.448) -- 0:01:14
514000 -- (-2002.402) (-1995.438) (-1992.540) [-1996.377] * [-1996.306] (-2005.185) (-1994.491) (-2001.546) -- 0:01:14
514500 -- (-1997.390) (-1993.580) (-1989.362) [-1996.801] * (-1996.024) (-2001.679) [-1994.210] (-2001.883) -- 0:01:14
515000 -- [-1994.581] (-1992.542) (-1999.055) (-1992.307) * [-1990.121] (-1993.858) (-1999.105) (-2002.024) -- 0:01:14
Average standard deviation of split frequencies: 0.000000
515500 -- [-1999.782] (-1998.955) (-1997.098) (-1994.031) * (-1993.614) (-1999.568) [-1991.534] (-1994.388) -- 0:01:14
516000 -- [-1997.458] (-1995.409) (-1993.787) (-1995.203) * (-1997.667) (-1996.999) (-1994.890) [-1999.507] -- 0:01:14
516500 -- (-2000.312) (-1992.408) [-1995.175] (-1996.787) * (-1992.158) (-1992.630) [-1990.944] (-1994.759) -- 0:01:13
517000 -- (-1996.858) (-1996.095) [-1998.495] (-1998.570) * (-1992.864) [-1994.759] (-1991.115) (-1991.467) -- 0:01:13
517500 -- [-1995.050] (-1995.759) (-1995.853) (-1997.910) * (-1996.366) [-1999.901] (-1995.388) (-1991.221) -- 0:01:13
518000 -- (-1997.423) [-1992.179] (-1993.822) (-1993.874) * (-1993.287) (-1995.789) (-1991.799) [-1992.403] -- 0:01:13
518500 -- [-1999.030] (-1989.979) (-1992.501) (-1995.910) * (-1991.121) (-1993.561) [-1993.033] (-1996.629) -- 0:01:13
519000 -- (-2000.220) (-1993.444) [-1999.295] (-1997.098) * (-1995.056) (-1991.290) (-2004.386) [-1993.211] -- 0:01:13
519500 -- [-1995.816] (-1995.821) (-2008.801) (-1997.450) * (-1995.564) [-1997.403] (-1996.617) (-1992.929) -- 0:01:13
520000 -- (-1997.945) [-1992.950] (-1993.865) (-1990.232) * (-1993.484) [-1992.619] (-1996.711) (-1996.945) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
520500 -- [-1995.729] (-1996.731) (-1997.858) (-1999.987) * (-1995.859) (-1998.775) [-1992.963] (-2000.630) -- 0:01:13
521000 -- (-2000.711) [-1999.032] (-1995.809) (-1998.976) * (-2002.437) [-1996.958] (-1999.187) (-1997.286) -- 0:01:13
521500 -- [-1998.172] (-1991.818) (-1994.343) (-1994.962) * (-1994.593) (-1994.310) [-1999.143] (-2001.956) -- 0:01:13
522000 -- (-1995.154) (-1993.332) (-1995.351) [-1995.403] * (-2003.545) [-1999.403] (-2003.332) (-1997.317) -- 0:01:13
522500 -- (-1994.987) (-1989.958) (-2000.047) [-1994.374] * (-1995.452) (-1994.597) (-1994.805) [-1993.899] -- 0:01:13
523000 -- (-1994.000) (-2000.117) [-1999.686] (-1999.382) * (-1998.851) (-1989.105) (-1992.878) [-1991.033] -- 0:01:12
523500 -- (-1991.434) (-1993.772) (-1999.910) [-1990.206] * (-1992.785) (-1995.432) (-1994.830) [-1993.147] -- 0:01:12
524000 -- (-1996.761) (-1995.933) (-1995.579) [-1992.998] * (-1997.362) (-1997.899) (-1997.417) [-1998.154] -- 0:01:12
524500 -- (-1995.071) (-1989.198) [-1993.600] (-1994.304) * [-1995.795] (-1993.555) (-2006.534) (-1994.492) -- 0:01:12
525000 -- (-2000.058) [-1995.463] (-1997.841) (-1998.353) * (-1998.836) (-1994.334) (-1994.806) [-1994.812] -- 0:01:12
Average standard deviation of split frequencies: 0.000000
525500 -- (-1998.137) (-1998.382) [-1998.722] (-1999.772) * (-2001.035) (-1996.935) [-1993.937] (-2001.711) -- 0:01:13
526000 -- (-1997.297) (-1992.059) (-1996.796) [-1993.590] * (-1992.658) (-2002.745) [-1998.763] (-1999.762) -- 0:01:12
526500 -- (-1993.341) (-1995.246) [-1997.090] (-1992.860) * (-1990.981) (-1997.395) (-1993.263) [-1993.949] -- 0:01:12
527000 -- [-2001.576] (-1989.211) (-1991.182) (-1994.185) * (-1990.111) (-1993.341) (-2003.594) [-1992.504] -- 0:01:12
527500 -- (-1998.111) (-1996.167) [-1996.236] (-1992.679) * (-2000.109) (-1991.664) [-1997.068] (-1992.943) -- 0:01:12
528000 -- (-1994.452) (-1996.290) (-1994.436) [-1992.037] * (-1994.111) (-1995.757) (-2003.342) [-1992.635] -- 0:01:12
528500 -- (-1992.242) (-1997.138) [-1994.249] (-1994.470) * (-1995.802) (-1990.105) [-1994.433] (-1994.931) -- 0:01:12
529000 -- (-2000.057) [-1993.215] (-2001.335) (-1998.459) * (-1992.655) [-2000.752] (-1998.251) (-1990.999) -- 0:01:12
529500 -- (-1997.162) (-1995.015) [-1994.873] (-2000.252) * (-1999.451) (-2000.758) [-1998.415] (-1999.796) -- 0:01:11
530000 -- (-1996.221) [-1994.986] (-1992.853) (-1996.876) * (-2000.935) (-2001.399) [-1995.956] (-1993.545) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
530500 -- [-1990.290] (-1990.408) (-2000.016) (-1992.072) * (-1996.048) (-1995.686) [-1996.531] (-2001.681) -- 0:01:11
531000 -- (-1998.813) (-1992.374) (-1995.387) [-1994.232] * (-1994.018) [-1990.084] (-1997.087) (-1998.208) -- 0:01:11
531500 -- (-1993.543) [-1994.977] (-1998.495) (-1995.588) * (-1997.435) (-1990.099) (-1993.450) [-1994.285] -- 0:01:11
532000 -- [-1997.647] (-1990.325) (-2005.034) (-1990.345) * (-1996.757) (-1998.614) [-1996.287] (-1994.797) -- 0:01:12
532500 -- (-1993.411) (-1994.226) (-2000.566) [-1993.070] * [-2001.992] (-1999.538) (-1993.310) (-1995.428) -- 0:01:11
533000 -- [-1994.955] (-1995.206) (-1992.503) (-1995.768) * (-1989.771) (-1993.801) [-1996.174] (-1996.306) -- 0:01:11
533500 -- (-1996.354) (-1998.263) [-1993.066] (-1999.651) * (-1995.631) [-2003.636] (-1995.158) (-1995.506) -- 0:01:11
534000 -- (-1996.207) (-1995.310) [-1995.755] (-1998.903) * (-2000.371) (-1993.326) (-2000.805) [-1996.061] -- 0:01:11
534500 -- (-1992.923) (-1992.700) (-2001.225) [-2002.272] * (-1996.163) (-1998.380) (-2000.896) [-1995.127] -- 0:01:11
535000 -- (-1993.084) [-1991.273] (-1995.911) (-1997.149) * (-1993.796) (-1995.472) (-1995.798) [-1996.576] -- 0:01:11
Average standard deviation of split frequencies: 0.000000
535500 -- (-2000.727) [-1994.030] (-1993.558) (-1990.912) * (-1990.975) (-1998.193) (-2000.284) [-1993.570] -- 0:01:11
536000 -- (-1992.226) (-1998.558) [-1996.438] (-1991.857) * [-1999.256] (-1997.429) (-1994.494) (-1994.454) -- 0:01:10
536500 -- (-1994.763) (-1999.690) (-2001.404) [-1992.960] * (-2000.498) (-1995.520) [-2002.574] (-1998.879) -- 0:01:10
537000 -- (-1990.767) (-2001.781) (-1997.782) [-1990.426] * (-1994.977) (-1999.979) [-1993.941] (-2003.990) -- 0:01:10
537500 -- (-1995.152) (-1996.764) [-1996.017] (-2004.719) * (-1997.745) (-2000.877) [-1993.993] (-1999.360) -- 0:01:10
538000 -- [-1997.374] (-1989.865) (-1994.564) (-2000.623) * [-1994.403] (-1995.096) (-1992.787) (-1997.468) -- 0:01:10
538500 -- [-1997.336] (-1993.420) (-1997.892) (-2002.016) * (-1999.280) (-1991.763) (-1996.211) [-1993.731] -- 0:01:11
539000 -- [-1993.464] (-1993.853) (-1993.751) (-1994.572) * (-1991.774) (-1996.003) [-1991.645] (-1993.306) -- 0:01:10
539500 -- [-1988.985] (-1996.763) (-1994.692) (-1997.589) * (-1993.855) [-2001.278] (-1994.176) (-2006.528) -- 0:01:10
540000 -- [-1995.471] (-1993.799) (-2003.316) (-1999.349) * [-1995.477] (-1997.752) (-1997.736) (-1991.450) -- 0:01:10
Average standard deviation of split frequencies: 0.000000
540500 -- (-1992.631) (-1993.423) [-1999.067] (-2001.400) * (-1995.314) [-1995.596] (-1995.095) (-1994.078) -- 0:01:10
541000 -- [-1996.053] (-1991.621) (-1995.081) (-1997.147) * (-1994.247) (-1999.924) [-1994.087] (-1994.533) -- 0:01:10
541500 -- (-2003.021) [-1996.667] (-1993.027) (-1994.639) * (-1994.563) (-1994.043) (-1999.377) [-1992.857] -- 0:01:10
542000 -- (-1990.672) [-1989.675] (-1995.792) (-1992.950) * (-2002.429) (-1997.089) [-1996.912] (-1993.260) -- 0:01:10
542500 -- (-1992.796) [-1998.884] (-1987.846) (-2000.876) * (-1997.075) (-1996.114) [-1998.140] (-1997.298) -- 0:01:09
543000 -- (-1994.017) (-1994.927) (-1995.805) [-1998.320] * (-1992.114) (-1997.497) [-1991.889] (-1990.966) -- 0:01:09
543500 -- (-1999.023) [-1998.163] (-1992.427) (-1997.134) * (-1998.182) [-1995.044] (-1994.161) (-1997.985) -- 0:01:09
544000 -- (-1997.469) [-1998.367] (-1992.751) (-1993.011) * (-1991.273) (-1995.398) (-1994.044) [-1994.709] -- 0:01:09
544500 -- (-1995.937) (-1991.416) (-2002.571) [-2002.631] * [-1995.053] (-2000.247) (-1995.855) (-1992.614) -- 0:01:09
545000 -- [-1992.308] (-1995.150) (-2000.420) (-1994.959) * (-1990.407) [-2001.425] (-2001.364) (-1996.895) -- 0:01:10
Average standard deviation of split frequencies: 0.000000
545500 -- [-1991.298] (-2003.486) (-1994.620) (-1994.441) * [-1995.614] (-1989.234) (-1996.591) (-2000.249) -- 0:01:09
546000 -- (-2006.357) (-2001.907) (-1997.879) [-1992.161] * (-1993.708) (-1993.978) (-1995.852) [-1995.378] -- 0:01:09
546500 -- (-1993.192) (-1999.668) (-1993.379) [-1994.305] * (-1993.600) [-1993.347] (-1994.887) (-1992.497) -- 0:01:09
547000 -- (-1997.951) [-1996.405] (-1991.622) (-1991.211) * [-1993.763] (-2004.251) (-1991.969) (-1996.561) -- 0:01:09
547500 -- (-2005.236) (-1999.028) [-1997.506] (-1989.854) * (-2000.043) (-1991.524) [-1996.277] (-1994.677) -- 0:01:09
548000 -- [-2003.838] (-2001.136) (-2001.184) (-1990.830) * (-1995.561) (-1991.487) [-1996.028] (-1995.316) -- 0:01:09
548500 -- (-2001.267) (-1998.735) [-1987.731] (-1992.868) * (-1995.953) (-1990.132) (-1991.736) [-1992.630] -- 0:01:09
549000 -- (-1997.925) (-1997.629) [-1990.161] (-1993.552) * [-1997.170] (-1995.033) (-1994.367) (-1993.196) -- 0:01:09
549500 -- (-1989.405) (-1998.359) [-1995.566] (-1993.966) * [-1995.659] (-1995.590) (-1996.189) (-1996.703) -- 0:01:08
550000 -- [-1991.722] (-1997.484) (-1995.530) (-1999.466) * (-1996.108) (-2000.995) (-1998.497) [-1989.317] -- 0:01:08
Average standard deviation of split frequencies: 0.000000
550500 -- (-1994.375) (-1997.275) [-1995.845] (-1996.413) * [-1990.247] (-1995.124) (-1998.179) (-1991.728) -- 0:01:08
551000 -- [-1995.419] (-1994.415) (-1997.007) (-1995.446) * [-2000.250] (-1995.889) (-2003.970) (-1996.047) -- 0:01:08
551500 -- [-1988.908] (-1993.424) (-1994.467) (-1993.709) * (-1995.156) (-1993.267) [-1994.810] (-1991.938) -- 0:01:09
552000 -- (-1998.828) (-1997.090) (-1997.692) [-1993.666] * (-1997.170) (-1995.202) (-1999.315) [-1995.328] -- 0:01:08
552500 -- (-1994.216) [-1997.008] (-1998.655) (-1995.093) * (-1996.122) (-1991.145) [-1993.410] (-1998.305) -- 0:01:08
553000 -- [-1992.540] (-1994.166) (-1992.930) (-2004.161) * (-1990.205) (-1995.537) (-1992.513) [-2001.908] -- 0:01:08
553500 -- (-1994.897) [-1995.899] (-1995.796) (-1990.424) * (-1991.460) (-1999.534) [-1996.123] (-1995.539) -- 0:01:08
554000 -- [-1995.524] (-2000.114) (-2000.538) (-2004.748) * (-2001.090) [-2001.943] (-1994.888) (-1993.568) -- 0:01:08
554500 -- [-2001.201] (-1989.483) (-1994.594) (-1998.089) * [-1995.823] (-2002.306) (-1992.926) (-1996.123) -- 0:01:08
555000 -- [-1993.630] (-1997.315) (-2005.470) (-1994.422) * (-1992.297) (-1999.454) (-1996.712) [-1992.718] -- 0:01:08
Average standard deviation of split frequencies: 0.000000
555500 -- (-1992.874) (-1996.462) [-1998.731] (-1994.991) * (-1994.512) (-1998.680) (-1993.860) [-1995.886] -- 0:01:08
556000 -- (-1996.695) (-1993.958) (-2001.887) [-1994.254] * [-1997.666] (-1995.616) (-2002.703) (-1993.582) -- 0:01:07
556500 -- [-1992.679] (-2001.435) (-1995.971) (-1992.478) * (-1993.104) (-1990.762) (-2000.542) [-1995.956] -- 0:01:07
557000 -- [-1992.841] (-1993.376) (-1998.532) (-1995.765) * (-1997.418) (-2000.384) [-1993.166] (-1995.598) -- 0:01:07
557500 -- (-1997.265) (-1995.467) (-1994.766) [-1996.754] * (-2001.878) [-1994.468] (-1992.599) (-1997.155) -- 0:01:07
558000 -- (-2002.009) [-1990.529] (-1993.030) (-1992.276) * (-2001.248) [-2001.302] (-1993.946) (-1990.989) -- 0:01:08
558500 -- (-2003.702) (-1999.868) [-1994.624] (-1996.889) * (-2004.430) [-1996.897] (-1995.068) (-2002.265) -- 0:01:07
559000 -- (-1992.311) (-1994.464) (-1997.318) [-1995.967] * (-1999.183) (-2000.566) [-1997.071] (-1999.587) -- 0:01:07
559500 -- (-1995.506) (-1995.513) (-1998.062) [-1994.222] * (-1998.344) (-1995.091) (-1992.243) [-1995.638] -- 0:01:07
560000 -- (-1995.168) (-1996.225) [-1992.674] (-1995.056) * (-1992.444) (-1992.459) [-1993.152] (-1991.415) -- 0:01:07
Average standard deviation of split frequencies: 0.000000
560500 -- (-1996.716) (-1999.460) (-1996.137) [-1994.408] * (-1995.936) (-2004.198) [-1995.611] (-1994.071) -- 0:01:07
561000 -- [-1990.227] (-1994.616) (-1994.186) (-1995.131) * (-1995.758) (-2000.794) [-1991.332] (-1996.449) -- 0:01:07
561500 -- (-1998.724) [-1995.809] (-2000.971) (-1995.595) * (-1999.897) (-1993.342) (-1994.818) [-1996.151] -- 0:01:07
562000 -- (-1990.103) [-1996.388] (-2001.920) (-1996.370) * (-1999.374) (-1999.665) (-1995.814) [-1992.178] -- 0:01:07
562500 -- [-1992.686] (-1997.271) (-1999.359) (-1993.383) * (-2002.275) (-1997.362) (-1996.735) [-1995.940] -- 0:01:06
563000 -- (-1991.461) (-1991.823) (-2005.911) [-1992.856] * (-1995.204) [-1992.277] (-1995.382) (-1992.674) -- 0:01:06
563500 -- (-1992.215) (-1992.236) (-1999.830) [-1991.670] * [-1995.767] (-1996.811) (-1994.961) (-1994.619) -- 0:01:06
564000 -- [-1994.149] (-1998.744) (-1991.553) (-1996.912) * (-1995.992) (-1993.008) [-1992.722] (-2004.277) -- 0:01:06
564500 -- (-1995.756) (-2000.991) [-1992.506] (-1998.538) * (-1994.454) (-1996.378) [-1988.068] (-1991.263) -- 0:01:07
565000 -- (-1995.503) (-2006.857) (-1996.337) [-2002.351] * (-1997.465) [-1992.465] (-1991.955) (-1993.781) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
565500 -- (-1997.941) [-1996.335] (-1991.083) (-2000.917) * (-2001.203) (-1993.144) [-1992.770] (-1998.347) -- 0:01:06
566000 -- (-1997.927) (-1997.068) [-1996.535] (-1997.975) * (-1995.777) (-1998.596) [-1993.391] (-1994.935) -- 0:01:06
566500 -- (-2000.379) [-1994.138] (-1995.035) (-1993.794) * (-1995.713) (-1996.749) [-1992.382] (-2002.539) -- 0:01:06
567000 -- (-1998.419) [-1990.771] (-1993.359) (-1989.087) * (-2001.243) (-1995.190) (-1992.356) [-2000.467] -- 0:01:06
567500 -- [-1992.463] (-1991.355) (-1994.473) (-1992.331) * (-1997.444) (-2002.833) [-1992.324] (-2007.260) -- 0:01:06
568000 -- [-1992.797] (-1996.966) (-1992.563) (-1995.236) * (-1995.538) (-1999.731) [-1991.558] (-1994.931) -- 0:01:06
568500 -- [-1992.969] (-1993.864) (-1991.723) (-1998.857) * (-1993.418) (-2001.903) [-1996.819] (-1992.033) -- 0:01:06
569000 -- (-1995.911) (-1999.785) [-1994.783] (-1991.758) * (-1993.163) (-2001.108) [-1991.962] (-1998.450) -- 0:01:05
569500 -- [-2000.732] (-1997.794) (-1997.865) (-1997.213) * (-1989.858) (-1996.203) [-1991.684] (-1998.076) -- 0:01:05
570000 -- (-1998.879) (-1996.688) (-1999.966) [-1994.178] * [-1993.438] (-1993.880) (-1998.713) (-2001.484) -- 0:01:05
Average standard deviation of split frequencies: 0.000000
570500 -- (-1995.827) (-1998.640) [-1995.143] (-1998.886) * (-2002.334) (-1996.681) [-1997.346] (-1994.857) -- 0:01:05
571000 -- [-1995.868] (-1997.752) (-2000.586) (-1992.409) * [-1999.654] (-1991.605) (-1993.860) (-1994.320) -- 0:01:06
571500 -- [-1994.798] (-1991.877) (-1998.677) (-1996.040) * (-1995.403) (-1991.600) [-1993.691] (-1997.887) -- 0:01:05
572000 -- (-1995.733) (-1994.123) (-2000.269) [-1997.062] * (-1996.749) (-1994.095) (-1994.187) [-1999.945] -- 0:01:05
572500 -- (-1994.757) [-1994.649] (-1999.167) (-1994.556) * (-1995.433) (-1994.398) (-1999.349) [-1993.664] -- 0:01:05
573000 -- [-1995.651] (-1998.196) (-1993.753) (-2004.185) * (-1997.120) (-1999.313) [-1996.675] (-1997.258) -- 0:01:05
573500 -- [-1995.342] (-1997.629) (-1996.362) (-1993.759) * (-1998.981) [-1991.816] (-1998.053) (-2004.501) -- 0:01:05
574000 -- [-1998.641] (-1995.469) (-1995.260) (-1998.924) * (-1991.845) [-1994.507] (-1989.494) (-1994.553) -- 0:01:05
574500 -- (-2000.461) (-1995.664) [-1999.241] (-2004.263) * (-1992.845) [-1997.126] (-1996.411) (-1998.460) -- 0:01:05
575000 -- (-1992.889) (-1994.182) (-1991.286) [-1991.314] * (-2000.040) [-1989.859] (-1996.355) (-2003.438) -- 0:01:05
Average standard deviation of split frequencies: 0.000000
575500 -- (-1997.903) (-1992.224) (-1997.357) [-1997.612] * (-1993.343) [-1988.133] (-1993.685) (-1996.839) -- 0:01:04
576000 -- [-1994.875] (-1999.013) (-1994.630) (-1996.734) * (-1997.921) [-1990.768] (-2007.604) (-1990.855) -- 0:01:04
576500 -- (-2000.928) (-1996.639) [-1993.927] (-1995.040) * (-1995.803) (-1992.950) [-1993.244] (-1994.151) -- 0:01:04
577000 -- (-2003.280) (-1995.046) (-1994.234) [-1997.405] * (-1999.264) [-1990.487] (-1999.310) (-1999.042) -- 0:01:04
577500 -- (-2000.364) (-1998.099) [-1992.844] (-1999.408) * [-1993.338] (-1991.504) (-1995.102) (-1992.553) -- 0:01:05
578000 -- (-1995.044) [-1995.964] (-1994.444) (-1993.620) * [-1993.988] (-1999.718) (-2001.523) (-1992.709) -- 0:01:04
578500 -- (-1995.457) (-2000.562) (-1991.708) [-1997.540] * (-2001.727) [-2005.005] (-1992.744) (-1997.815) -- 0:01:04
579000 -- (-1992.219) (-1997.472) (-1997.251) [-1987.767] * (-1996.937) [-1994.141] (-1999.555) (-1994.981) -- 0:01:04
579500 -- (-1993.844) (-1991.528) [-1993.038] (-1996.665) * [-1995.777] (-1992.355) (-1993.837) (-1990.315) -- 0:01:04
580000 -- (-1998.190) (-1996.168) (-1993.425) [-1993.129] * [-1994.355] (-1993.800) (-1991.623) (-1997.815) -- 0:01:04
Average standard deviation of split frequencies: 0.000000
580500 -- (-1992.155) (-1993.998) [-1996.816] (-1993.446) * (-1996.226) (-1996.374) (-1988.126) [-1992.268] -- 0:01:04
581000 -- [-2000.093] (-1991.839) (-1998.116) (-1998.508) * (-1997.208) (-1999.612) [-1993.563] (-2002.878) -- 0:01:04
581500 -- (-1992.862) (-1991.914) (-2000.163) [-1996.165] * (-1998.417) (-1994.659) [-1992.281] (-1993.712) -- 0:01:04
582000 -- [-1994.811] (-1996.297) (-1994.428) (-1994.899) * [-1992.316] (-1992.585) (-1998.338) (-1999.124) -- 0:01:03
582500 -- [-1996.850] (-1993.530) (-1991.238) (-1996.957) * [-1997.381] (-1997.311) (-1995.573) (-1998.303) -- 0:01:03
583000 -- (-2001.159) (-1997.532) [-1994.686] (-1992.199) * [-1991.423] (-1996.610) (-1995.680) (-1999.744) -- 0:01:03
583500 -- (-2002.955) [-1997.569] (-1995.399) (-1993.096) * (-1993.017) (-2002.245) [-1993.334] (-1992.618) -- 0:01:03
584000 -- (-1995.369) (-1996.066) [-1993.248] (-1998.121) * (-1999.035) (-1997.489) (-2002.712) [-1999.422] -- 0:01:04
584500 -- [-1995.462] (-1997.818) (-2006.746) (-1999.813) * (-1994.499) [-1991.691] (-2002.499) (-2003.110) -- 0:01:03
585000 -- (-1994.059) (-1996.321) [-1995.596] (-1995.474) * (-1993.479) (-1992.282) (-2001.695) [-1995.575] -- 0:01:03
Average standard deviation of split frequencies: 0.000000
585500 -- (-1994.384) (-2011.113) [-1994.510] (-2001.266) * (-1994.738) (-1995.480) [-1997.225] (-2000.073) -- 0:01:03
586000 -- (-1993.356) [-1994.759] (-1993.949) (-1998.223) * (-1994.858) (-1990.052) (-1994.642) [-1993.152] -- 0:01:03
586500 -- (-1995.914) [-1992.542] (-1997.711) (-1996.185) * [-1991.736] (-1992.547) (-2000.085) (-1994.980) -- 0:01:03
587000 -- [-1993.922] (-1998.341) (-2003.774) (-1993.310) * (-1992.863) (-1995.524) [-1995.989] (-1993.973) -- 0:01:03
587500 -- [-1999.280] (-1996.160) (-1997.844) (-1996.894) * (-1999.566) [-1993.782] (-1992.581) (-1997.069) -- 0:01:03
588000 -- (-1995.656) (-2003.655) (-1995.537) [-1997.930] * (-1996.096) (-1995.364) [-1994.785] (-1997.849) -- 0:01:03
588500 -- (-1993.764) (-1998.664) [-1994.455] (-1994.303) * (-1998.089) (-1998.245) (-1993.818) [-1997.442] -- 0:01:02
589000 -- (-1996.531) (-2004.001) (-2000.524) [-1991.461] * (-2003.769) (-1991.404) (-1994.721) [-1992.784] -- 0:01:02
589500 -- (-1993.714) (-1998.981) [-1991.051] (-2001.192) * (-2001.685) (-1990.692) (-1994.495) [-1996.640] -- 0:01:02
590000 -- (-1992.019) [-1993.397] (-1992.814) (-1996.587) * (-2000.534) [-1993.534] (-1995.625) (-2002.912) -- 0:01:02
Average standard deviation of split frequencies: 0.000000
590500 -- (-1995.212) (-2000.318) [-1994.003] (-1995.423) * (-1992.985) (-1999.597) (-1994.619) [-1993.605] -- 0:01:03
591000 -- [-1996.564] (-2002.204) (-1996.215) (-1995.340) * (-2002.966) [-1994.376] (-1995.944) (-2003.355) -- 0:01:02
591500 -- (-1996.086) (-1990.490) [-1990.629] (-1992.749) * (-1997.999) (-2000.294) (-1992.237) [-1997.441] -- 0:01:02
592000 -- (-1996.268) [-1997.573] (-1998.786) (-1999.143) * (-1996.169) (-2000.862) (-1988.904) [-1998.680] -- 0:01:02
592500 -- (-1994.921) (-1997.228) [-1998.420] (-1993.696) * (-1997.719) (-1996.518) (-2000.795) [-1993.047] -- 0:01:02
593000 -- (-1994.847) (-2001.491) [-1996.380] (-1993.787) * (-2003.138) (-2000.248) (-1991.761) [-1989.608] -- 0:01:02
593500 -- (-1991.596) [-1995.916] (-1993.605) (-1999.528) * (-1992.309) (-1997.575) (-1997.683) [-1997.128] -- 0:01:02
594000 -- (-1994.779) (-1995.388) [-1995.669] (-2002.348) * [-1990.316] (-2003.582) (-1992.956) (-1991.571) -- 0:01:02
594500 -- (-2003.484) [-1999.970] (-1992.688) (-1998.051) * (-1996.020) (-1993.552) (-2003.678) [-1997.852] -- 0:01:02
595000 -- (-1998.677) (-1999.559) (-1995.096) [-1995.916] * (-1997.585) [-1992.058] (-1993.614) (-1994.645) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
595500 -- (-1994.239) [-1995.015] (-1996.024) (-1999.270) * (-1997.115) (-1997.790) (-1996.390) [-1997.252] -- 0:01:01
596000 -- (-1993.695) [-1995.147] (-1999.746) (-1992.557) * (-2001.688) [-1997.997] (-1992.124) (-1995.934) -- 0:01:01
596500 -- (-1997.816) (-1994.137) (-1994.300) [-1991.801] * (-1997.579) (-1994.682) [-1995.245] (-1997.739) -- 0:01:01
597000 -- [-1993.429] (-1993.630) (-2000.821) (-1988.792) * (-1993.943) (-1990.429) [-1996.320] (-2000.065) -- 0:01:01
597500 -- (-1997.232) [-1994.299] (-1992.891) (-1995.984) * (-1991.812) (-1992.800) (-1990.444) [-1993.439] -- 0:01:01
598000 -- (-1993.397) [-1993.908] (-1993.434) (-1992.806) * [-1989.194] (-1992.266) (-1996.011) (-1997.008) -- 0:01:01
598500 -- (-1999.764) (-1994.345) [-1994.534] (-1993.802) * (-1999.479) [-1994.893] (-1994.249) (-1998.600) -- 0:01:01
599000 -- (-1995.680) (-1999.360) (-1993.377) [-1993.281] * (-1998.303) (-1995.901) (-1996.013) [-1995.632] -- 0:01:01
599500 -- (-1996.346) (-1990.197) (-1997.231) [-1992.145] * (-1996.474) [-1994.877] (-1994.228) (-2002.566) -- 0:01:01
600000 -- [-1991.817] (-1994.264) (-1994.109) (-1993.061) * (-1995.931) [-1997.999] (-1992.831) (-1998.151) -- 0:01:01
Average standard deviation of split frequencies: 0.000000
600500 -- (-2002.879) [-1991.682] (-1992.933) (-1990.703) * (-1992.309) (-1994.036) (-1990.368) [-1993.825] -- 0:01:01
601000 -- [-1996.679] (-1996.960) (-1996.532) (-1990.080) * [-1992.159] (-1998.165) (-1992.870) (-1989.880) -- 0:01:01
601500 -- (-1998.748) (-2002.581) [-1997.471] (-1997.819) * (-2003.930) (-1995.435) (-1993.835) [-2003.476] -- 0:01:00
602000 -- (-1998.162) (-2000.928) (-1997.003) [-1995.882] * (-1993.414) [-1995.238] (-1997.124) (-2006.137) -- 0:01:00
602500 -- (-1999.198) (-1994.990) (-1994.262) [-2000.171] * (-1997.058) (-1998.574) [-1991.218] (-1994.498) -- 0:01:00
603000 -- [-1992.054] (-1998.233) (-1991.563) (-1995.029) * (-1999.424) (-1996.205) (-2000.468) [-1992.388] -- 0:01:00
603500 -- (-1991.883) (-1990.129) [-1998.926] (-1996.777) * (-2000.319) [-1989.193] (-1997.187) (-1995.921) -- 0:01:00
604000 -- (-1996.965) (-1992.905) [-1994.636] (-1997.563) * (-2007.986) (-1993.216) (-1994.672) [-1994.575] -- 0:01:00
604500 -- (-1992.393) (-1993.773) [-1997.575] (-2000.277) * (-1999.260) (-1993.334) (-1997.411) [-1994.554] -- 0:01:00
605000 -- (-1992.176) (-1993.291) [-2002.889] (-1997.117) * [-1995.699] (-1993.294) (-1996.897) (-1998.081) -- 0:01:00
Average standard deviation of split frequencies: 0.000000
605500 -- (-1999.646) [-1995.431] (-1992.592) (-1997.671) * [-1998.318] (-1992.277) (-1996.829) (-2000.076) -- 0:01:00
606000 -- [-1993.634] (-1998.449) (-1995.404) (-1991.574) * (-1992.619) [-1991.346] (-2005.460) (-2000.720) -- 0:01:00
606500 -- (-1996.898) [-1996.125] (-1999.742) (-1993.525) * (-1996.114) [-1999.834] (-1996.261) (-1996.914) -- 0:01:00
607000 -- (-1997.372) (-2000.620) [-1994.218] (-1990.236) * [-1989.602] (-1997.145) (-1990.630) (-1997.739) -- 0:01:00
607500 -- (-1995.582) (-2000.259) (-1998.438) [-1995.679] * (-2002.692) [-1993.910] (-2000.666) (-2004.051) -- 0:01:00
608000 -- (-1998.151) (-1994.966) (-2001.372) [-1995.760] * (-1993.881) (-1992.823) (-1998.943) [-1993.873] -- 0:00:59
608500 -- (-1995.417) [-1999.042] (-1994.927) (-1989.401) * (-1992.942) [-1988.971] (-1991.364) (-1998.730) -- 0:00:59
609000 -- [-1994.022] (-1994.783) (-1998.801) (-1990.692) * (-1996.393) (-1993.952) [-1990.119] (-1992.933) -- 0:00:59
609500 -- [-1991.364] (-2003.320) (-1999.544) (-1995.554) * [-1991.811] (-2001.818) (-1994.792) (-2000.406) -- 0:00:59
610000 -- (-1993.085) (-1990.730) [-1998.926] (-1997.126) * (-2000.072) [-1990.080] (-1994.842) (-1992.296) -- 0:00:59
Average standard deviation of split frequencies: 0.000000
610500 -- (-2002.149) (-1998.196) [-1995.236] (-2001.688) * (-1994.220) [-1996.601] (-1997.771) (-1992.961) -- 0:00:59
611000 -- (-1991.529) (-1996.943) [-1992.777] (-1996.799) * (-1998.218) (-1989.246) [-1996.827] (-1998.932) -- 0:00:59
611500 -- (-1998.762) [-1993.559] (-1996.414) (-1998.374) * (-1993.799) (-1998.593) (-1997.692) [-2001.402] -- 0:00:59
612000 -- (-1993.542) (-1993.758) (-1995.404) [-1996.692] * (-1993.169) (-1993.288) [-1995.347] (-2000.039) -- 0:00:59
612500 -- (-1991.415) (-1993.005) (-2005.245) [-1995.802] * (-1994.035) (-1995.719) (-1993.859) [-1996.284] -- 0:00:59
613000 -- (-1994.239) [-1996.009] (-1998.369) (-1996.303) * [-1994.723] (-2002.208) (-1996.272) (-1993.371) -- 0:00:59
613500 -- [-1993.335] (-1999.481) (-1993.086) (-1996.170) * (-1994.898) (-1994.426) [-1998.434] (-1991.386) -- 0:00:59
614000 -- (-1995.983) (-1995.665) (-1989.756) [-2002.653] * (-1997.956) (-2001.528) [-1999.762] (-1994.627) -- 0:00:59
614500 -- [-1996.741] (-1997.749) (-1989.829) (-1999.137) * [-2001.711] (-1995.094) (-1995.324) (-2003.430) -- 0:00:58
615000 -- (-1999.285) [-1993.362] (-1993.193) (-1993.071) * (-1990.258) (-2003.157) [-1991.230] (-1998.086) -- 0:00:58
Average standard deviation of split frequencies: 0.000000
615500 -- (-2001.406) (-1994.873) [-1992.145] (-1993.878) * (-1995.216) [-1995.520] (-1998.009) (-1992.842) -- 0:00:58
616000 -- (-1998.681) (-1995.081) (-1998.709) [-1990.705] * (-1999.286) [-1994.131] (-1998.502) (-1995.133) -- 0:00:58
616500 -- (-2001.462) (-1995.478) (-1992.775) [-1994.894] * (-1997.318) (-1992.497) [-1995.630] (-1991.037) -- 0:00:58
617000 -- (-2007.051) (-1993.112) [-1995.192] (-1993.667) * (-1997.050) [-1994.736] (-1998.367) (-1991.593) -- 0:00:58
617500 -- [-1996.642] (-1993.654) (-1993.686) (-1989.892) * (-1996.952) [-2000.087] (-1993.360) (-1997.402) -- 0:00:58
618000 -- [-1992.119] (-1994.974) (-1994.528) (-1995.581) * (-1992.862) (-1995.928) [-1990.479] (-1989.268) -- 0:00:58
618500 -- [-1994.529] (-1991.244) (-1994.098) (-1995.767) * (-1994.413) [-1995.442] (-2002.243) (-1992.346) -- 0:00:58
619000 -- (-1997.773) (-2001.790) (-1997.485) [-1991.193] * [-1996.675] (-1994.118) (-1995.078) (-1998.606) -- 0:00:58
619500 -- (-1989.631) (-2002.945) (-1999.041) [-1993.093] * (-1990.594) (-1996.670) [-1995.105] (-1995.116) -- 0:00:58
620000 -- (-1992.862) (-1999.383) [-1991.905] (-1993.975) * (-1993.353) (-2002.219) (-1998.167) [-1994.469] -- 0:00:58
Average standard deviation of split frequencies: 0.000000
620500 -- (-2001.636) (-2009.106) (-1993.133) [-1991.818] * [-1992.801] (-1999.893) (-1998.614) (-1993.966) -- 0:00:58
621000 -- [-1997.405] (-2001.624) (-1996.550) (-1993.611) * (-1989.249) (-2001.977) [-1996.351] (-1998.560) -- 0:00:57
621500 -- [-1996.035] (-1997.855) (-2004.116) (-1996.166) * (-1998.484) (-2001.900) [-1993.006] (-1999.186) -- 0:00:57
622000 -- (-2001.550) (-1992.622) [-1992.927] (-1991.128) * (-1992.257) (-1997.571) [-1992.799] (-2000.281) -- 0:00:57
622500 -- (-1997.147) (-1995.999) (-1994.981) [-1995.628] * (-1990.990) (-1999.862) [-1999.496] (-1995.723) -- 0:00:57
623000 -- (-1995.186) (-1998.343) [-1993.531] (-1995.210) * (-1996.029) [-1994.175] (-1999.397) (-2000.094) -- 0:00:57
623500 -- (-2006.547) [-1995.928] (-1993.230) (-1998.654) * (-1992.363) (-1995.245) (-1997.848) [-1993.982] -- 0:00:57
624000 -- (-1999.357) (-1994.981) (-1994.290) [-1994.035] * [-1993.573] (-1999.004) (-1993.689) (-1990.490) -- 0:00:57
624500 -- (-1991.081) (-1991.551) (-1997.971) [-1996.490] * (-1995.289) (-1991.157) [-1994.557] (-1996.198) -- 0:00:57
625000 -- (-1994.650) (-1996.351) [-1995.146] (-1993.490) * (-1990.646) (-1999.644) (-1992.724) [-1996.591] -- 0:00:57
Average standard deviation of split frequencies: 0.000000
625500 -- (-2000.623) [-1996.706] (-2000.666) (-1990.854) * (-1995.994) (-1993.779) (-1997.732) [-2005.734] -- 0:00:57
626000 -- (-1995.253) (-2010.389) (-1998.039) [-1997.429] * (-1997.852) (-1991.156) (-1995.850) [-1992.619] -- 0:00:57
626500 -- (-1997.969) (-2006.531) (-1994.326) [-1990.369] * (-1999.461) (-1993.164) (-1997.594) [-1992.968] -- 0:00:57
627000 -- [-1999.407] (-1991.978) (-1994.337) (-2005.138) * (-1998.079) [-1990.502] (-1998.597) (-1993.868) -- 0:00:57
627500 -- (-1999.971) (-1999.568) [-1992.267] (-1991.823) * (-2000.245) [-1994.667] (-1996.130) (-1994.548) -- 0:00:56
628000 -- (-1997.036) [-2000.176] (-1993.614) (-1994.236) * (-1997.822) (-1995.753) (-1992.942) [-1991.268] -- 0:00:56
628500 -- (-1994.886) (-1991.332) [-1995.025] (-2000.203) * (-1993.694) [-2005.323] (-1994.124) (-1997.022) -- 0:00:56
629000 -- (-1991.759) [-1991.652] (-1995.776) (-1992.566) * [-1994.860] (-1994.242) (-1995.696) (-1991.541) -- 0:00:56
629500 -- (-1998.565) [-2000.597] (-1995.672) (-1998.245) * (-1998.551) (-1993.397) (-1996.927) [-1996.342] -- 0:00:56
630000 -- (-1993.936) (-1996.879) [-1991.169] (-1993.525) * (-1995.851) [-1991.509] (-1995.734) (-1996.045) -- 0:00:56
Average standard deviation of split frequencies: 0.000000
630500 -- (-1999.731) [-1992.940] (-1996.915) (-2003.474) * [-1988.330] (-1995.386) (-2006.907) (-1996.491) -- 0:00:56
631000 -- [-1994.991] (-1992.711) (-1992.524) (-1996.769) * (-1989.504) [-2002.251] (-1994.685) (-1998.906) -- 0:00:56
631500 -- (-1996.093) (-1997.837) (-1989.980) [-1990.824] * (-1992.204) [-1999.655] (-1993.343) (-1999.793) -- 0:00:56
632000 -- (-1996.492) (-1992.912) [-1992.243] (-1993.643) * (-1992.807) (-1991.232) [-1995.172] (-1995.157) -- 0:00:56
632500 -- [-1992.178] (-2001.862) (-1994.148) (-1999.715) * [-1990.056] (-1992.910) (-1996.498) (-1997.109) -- 0:00:56
633000 -- (-2001.047) (-1995.977) [-1993.141] (-1990.213) * (-1996.813) [-1997.752] (-1994.159) (-1991.786) -- 0:00:56
633500 -- (-1991.566) (-2000.643) (-1996.603) [-1995.534] * (-2002.121) (-1997.051) (-1991.376) [-1997.257] -- 0:00:56
634000 -- (-1994.547) (-2003.881) (-1994.490) [-2001.157] * (-1993.657) [-1989.918] (-2000.308) (-1994.536) -- 0:00:55
634500 -- (-1990.687) (-1998.414) [-1998.726] (-1991.286) * (-1997.954) (-1999.532) (-2001.068) [-1990.670] -- 0:00:55
635000 -- [-1997.685] (-1998.038) (-1994.650) (-1994.271) * (-1999.709) [-1997.332] (-1997.016) (-1993.436) -- 0:00:55
Average standard deviation of split frequencies: 0.000000
635500 -- (-2003.086) (-2006.771) (-1998.387) [-1997.914] * (-1998.113) (-1996.131) [-1995.566] (-1996.535) -- 0:00:55
636000 -- (-1994.180) (-1996.221) (-1997.518) [-1995.054] * (-1998.897) (-1993.511) (-1992.261) [-1997.713] -- 0:00:55
636500 -- (-1997.436) [-2000.658] (-1999.233) (-1994.808) * [-2002.422] (-1995.352) (-2000.812) (-1996.157) -- 0:00:55
637000 -- (-1993.757) (-1995.816) [-1992.615] (-2004.249) * (-1990.837) (-1995.533) (-2002.847) [-1994.080] -- 0:00:55
637500 -- (-2000.248) (-1997.009) [-1998.358] (-1993.863) * (-1992.360) [-1995.461] (-1998.526) (-1995.369) -- 0:00:55
638000 -- [-1997.568] (-1994.945) (-1998.534) (-1997.826) * (-1995.153) (-1998.250) (-1993.939) [-1995.071] -- 0:00:55
638500 -- (-1997.747) (-2002.247) (-2000.583) [-1992.610] * (-1993.857) (-1998.767) (-1995.460) [-1993.023] -- 0:00:55
639000 -- (-1992.967) (-1994.182) [-1996.175] (-1998.322) * (-1995.287) [-1989.961] (-1995.680) (-2002.969) -- 0:00:55
639500 -- (-1997.184) (-1990.018) [-1989.287] (-1996.463) * [-1992.120] (-1998.808) (-1994.018) (-1997.818) -- 0:00:55
640000 -- (-1997.186) (-1990.177) [-1994.869] (-1993.626) * (-2000.599) (-1992.918) (-1999.301) [-1998.012] -- 0:00:55
Average standard deviation of split frequencies: 0.000000
640500 -- (-1995.667) (-1993.119) [-1992.394] (-2000.842) * (-1992.644) [-1990.534] (-1994.194) (-1994.310) -- 0:00:55
641000 -- (-1996.721) (-1997.663) (-1990.801) [-1994.108] * (-1994.726) (-1994.043) (-1999.187) [-1995.748] -- 0:00:54
641500 -- [-1998.093] (-1995.772) (-1998.457) (-1998.427) * (-1995.943) (-1997.243) (-1998.506) [-1995.796] -- 0:00:54
642000 -- (-2002.342) (-2000.968) (-1998.740) [-1994.701] * (-2002.458) (-1991.063) [-1992.624] (-1998.233) -- 0:00:54
642500 -- (-2005.793) (-1994.984) (-1994.361) [-1995.596] * (-2005.065) (-1996.137) [-1990.672] (-1992.335) -- 0:00:54
643000 -- (-2001.853) (-1996.224) (-1993.045) [-1991.695] * (-1997.203) (-2001.043) [-1995.104] (-1998.968) -- 0:00:54
643500 -- [-1996.879] (-2002.479) (-1993.929) (-2001.215) * [-1994.700] (-2001.156) (-1995.996) (-1995.897) -- 0:00:54
644000 -- (-1998.342) (-1987.657) (-1993.162) [-1994.271] * (-1995.897) (-1997.106) [-1992.380] (-1993.420) -- 0:00:54
644500 -- (-1996.377) (-1993.023) [-1992.924] (-1998.558) * (-1997.941) (-1993.367) (-1996.100) [-1989.805] -- 0:00:54
645000 -- (-1997.892) (-1992.374) [-1993.516] (-1995.518) * (-1993.673) [-1993.783] (-1997.288) (-1991.477) -- 0:00:54
Average standard deviation of split frequencies: 0.000000
645500 -- (-1991.455) [-1994.304] (-1991.918) (-1995.044) * (-1993.523) (-2000.830) (-1997.326) [-1996.069] -- 0:00:54
646000 -- (-1997.554) (-1992.300) [-1997.744] (-1994.528) * (-2001.834) [-1991.716] (-1996.766) (-1993.621) -- 0:00:54
646500 -- (-1993.924) (-1997.895) (-1997.000) [-1994.216] * [-2001.597] (-1994.909) (-1999.345) (-1996.464) -- 0:00:54
647000 -- [-1994.627] (-1997.842) (-1998.239) (-1992.894) * (-1996.220) (-1992.265) [-1995.261] (-2002.100) -- 0:00:54
647500 -- [-1996.353] (-2000.452) (-1997.030) (-1993.863) * (-1996.605) (-1990.354) [-1993.248] (-1995.489) -- 0:00:53
648000 -- (-1998.347) (-1997.046) [-1997.151] (-1995.788) * (-1990.334) (-1990.897) (-1993.129) [-1989.265] -- 0:00:53
648500 -- [-1997.617] (-1996.306) (-1996.738) (-1992.218) * (-1997.855) [-1998.540] (-1999.475) (-1999.483) -- 0:00:53
649000 -- (-2002.540) (-2002.870) [-1993.208] (-1992.290) * (-1992.597) (-1994.261) (-1997.308) [-1993.295] -- 0:00:53
649500 -- (-1991.865) (-1993.816) [-1993.153] (-1991.947) * (-1994.808) (-1996.361) (-1999.712) [-1995.265] -- 0:00:53
650000 -- (-1997.618) (-1993.960) [-2002.587] (-1998.985) * (-1995.297) (-1998.221) (-1992.986) [-1996.870] -- 0:00:53
Average standard deviation of split frequencies: 0.000000
650500 -- (-2003.746) [-1994.870] (-2003.847) (-1993.325) * (-1992.717) (-2000.204) (-2003.675) [-1995.580] -- 0:00:53
651000 -- (-2004.150) (-1995.706) [-1991.729] (-1992.297) * (-1994.932) [-1993.251] (-2005.976) (-1996.672) -- 0:00:53
651500 -- [-1993.209] (-1990.214) (-1997.700) (-1998.033) * (-1992.715) (-1993.717) (-1995.417) [-1993.667] -- 0:00:53
652000 -- (-1993.596) [-1994.896] (-1994.505) (-1996.643) * (-1996.521) [-1996.785] (-1990.344) (-1996.993) -- 0:00:53
652500 -- (-1998.351) (-1992.955) [-1992.212] (-1996.591) * [-1994.402] (-1992.638) (-1992.118) (-1996.767) -- 0:00:53
653000 -- (-1995.660) (-1993.720) (-1999.220) [-1996.376] * (-1995.830) (-1998.281) [-1999.942] (-1993.291) -- 0:00:53
653500 -- (-1992.810) [-1991.581] (-1995.099) (-1991.765) * [-1994.365] (-1996.076) (-1997.146) (-1994.013) -- 0:00:53
654000 -- (-2000.755) [-2003.185] (-1992.180) (-1999.255) * (-1993.364) (-1996.435) [-1997.045] (-1993.938) -- 0:00:52
654500 -- (-1998.888) (-1991.122) [-1995.994] (-1997.969) * (-1996.776) [-1992.049] (-2002.274) (-1991.863) -- 0:00:52
655000 -- [-2004.440] (-1996.009) (-1997.306) (-1997.305) * (-1997.377) (-1994.241) (-1994.381) [-1998.573] -- 0:00:52
Average standard deviation of split frequencies: 0.000000
655500 -- (-1997.164) (-1989.822) (-1994.107) [-1990.707] * (-1996.000) [-1991.560] (-1997.062) (-2005.549) -- 0:00:52
656000 -- (-1996.131) (-1989.771) (-1999.575) [-1997.843] * (-1995.256) (-1990.931) [-1988.273] (-1997.142) -- 0:00:52
656500 -- (-1994.903) (-2001.955) (-1998.205) [-1994.313] * (-1989.673) (-1996.014) [-1993.414] (-1988.469) -- 0:00:52
657000 -- (-1994.178) (-1992.757) (-1997.398) [-1990.710] * (-1991.988) (-1996.600) [-1995.690] (-1990.532) -- 0:00:52
657500 -- (-1996.179) [-1992.027] (-1998.273) (-1995.837) * (-1997.767) (-1996.523) [-1993.431] (-1992.028) -- 0:00:52
658000 -- [-1999.221] (-1996.891) (-1997.640) (-2003.447) * (-1999.734) (-1994.853) [-2000.547] (-2001.857) -- 0:00:52
658500 -- (-1998.651) [-1997.146] (-1995.462) (-1999.083) * (-1996.080) (-1996.856) [-1993.399] (-1993.610) -- 0:00:52
659000 -- (-1990.681) (-1991.422) [-1994.660] (-1996.826) * [-1992.715] (-1994.328) (-1996.273) (-1990.337) -- 0:00:52
659500 -- (-1997.334) (-1991.646) [-1991.229] (-1995.856) * (-1992.813) (-1994.291) (-1999.972) [-1997.792] -- 0:00:52
660000 -- (-1999.801) (-1993.275) [-1993.826] (-1997.193) * (-1998.639) (-1993.919) (-2002.640) [-1993.787] -- 0:00:52
Average standard deviation of split frequencies: 0.000000
660500 -- (-2000.115) (-1997.740) (-1996.186) [-1990.936] * (-1996.729) [-1997.453] (-1996.676) (-1994.101) -- 0:00:51
661000 -- (-1995.809) (-1996.675) (-1996.735) [-1999.740] * (-1999.305) (-1997.936) (-1995.309) [-1993.574] -- 0:00:51
661500 -- [-1995.838] (-1994.903) (-1996.324) (-2002.296) * (-1995.667) (-1997.445) [-1994.339] (-1995.533) -- 0:00:51
662000 -- (-1995.700) [-1999.825] (-1995.275) (-1994.900) * (-1994.173) (-1999.064) [-1995.100] (-1991.207) -- 0:00:51
662500 -- (-1999.656) (-2002.553) [-1996.498] (-1991.591) * (-1998.217) (-1996.086) (-1995.761) [-1994.106] -- 0:00:51
663000 -- (-1995.995) (-2005.308) [-1995.846] (-1997.451) * (-1997.971) (-1994.733) (-1999.251) [-1995.037] -- 0:00:51
663500 -- (-1997.895) (-2001.585) [-1992.077] (-1992.493) * [-2000.126] (-1995.785) (-1998.328) (-1995.662) -- 0:00:51
664000 -- (-2006.696) (-1997.120) [-1996.931] (-1998.668) * (-1995.321) (-2002.370) (-1990.628) [-1990.668] -- 0:00:51
664500 -- [-1997.557] (-1995.978) (-1991.160) (-2004.953) * [-1995.750] (-1992.264) (-1994.200) (-1989.351) -- 0:00:51
665000 -- [-1999.776] (-1993.311) (-1995.964) (-1992.827) * (-1996.360) [-1996.734] (-2006.951) (-1992.727) -- 0:00:51
Average standard deviation of split frequencies: 0.000000
665500 -- [-1990.735] (-1994.946) (-1999.808) (-1997.014) * (-1999.627) (-1996.703) (-1994.356) [-1993.509] -- 0:00:51
666000 -- [-1998.512] (-1999.553) (-1995.413) (-1989.335) * (-1998.147) (-1996.925) [-1995.619] (-2003.667) -- 0:00:51
666500 -- (-1995.340) (-1999.160) [-1991.021] (-1995.996) * [-1995.251] (-1997.126) (-1994.507) (-1995.685) -- 0:00:51
667000 -- (-2002.848) (-2001.909) (-1998.340) [-1996.934] * (-2000.911) (-1992.490) (-2010.805) [-1992.477] -- 0:00:50
667500 -- (-1995.631) [-1997.024] (-1997.250) (-1991.448) * (-2005.037) (-1994.842) [-1995.047] (-1994.858) -- 0:00:50
668000 -- (-1999.876) (-1998.684) (-1994.724) [-1993.604] * [-1992.027] (-2000.978) (-1996.405) (-1996.939) -- 0:00:50
668500 -- [-1992.552] (-1998.022) (-1992.167) (-1992.792) * [-1992.643] (-1997.050) (-1993.337) (-1994.982) -- 0:00:50
669000 -- (-1997.090) [-1991.144] (-1992.890) (-2001.067) * (-2000.365) [-1995.834] (-1993.597) (-1997.229) -- 0:00:50
669500 -- (-1994.063) (-2000.345) [-1994.903] (-1994.327) * (-1993.698) (-1999.148) (-1996.177) [-1992.176] -- 0:00:50
670000 -- (-1998.290) [-1996.766] (-1993.548) (-1995.805) * (-2002.133) (-1994.093) (-1993.050) [-1992.520] -- 0:00:50
Average standard deviation of split frequencies: 0.000000
670500 -- (-1994.543) [-1993.623] (-1991.269) (-1993.392) * (-1999.301) (-2002.940) [-1989.506] (-1999.361) -- 0:00:50
671000 -- (-1997.086) (-1996.506) (-1996.383) [-1994.290] * (-2001.133) [-1995.352] (-1993.840) (-1995.035) -- 0:00:50
671500 -- (-1995.604) (-1994.378) (-2005.836) [-1994.635] * (-2002.859) (-1997.033) (-1995.817) [-1993.441] -- 0:00:50
672000 -- (-1994.981) (-2003.211) [-1994.422] (-2007.162) * (-1998.723) (-1991.352) (-1994.241) [-1996.467] -- 0:00:50
672500 -- (-1996.832) (-1995.466) (-1997.773) [-1992.451] * (-1998.100) (-1996.237) [-1995.084] (-2001.733) -- 0:00:50
673000 -- (-1999.711) [-1996.696] (-1995.201) (-1997.515) * (-2001.677) (-1993.743) [-1994.835] (-2003.507) -- 0:00:50
673500 -- [-1991.776] (-2002.835) (-2000.035) (-1998.072) * (-1993.169) (-1991.553) [-1992.017] (-2000.940) -- 0:00:49
674000 -- (-1996.371) [-2004.414] (-2001.184) (-1993.128) * (-1995.821) (-1995.509) [-1999.485] (-1990.756) -- 0:00:49
674500 -- (-2000.380) [-1998.492] (-2004.642) (-1996.761) * (-1995.289) (-1999.068) (-1999.704) [-1992.892] -- 0:00:49
675000 -- [-1992.129] (-1998.351) (-1994.741) (-1995.327) * (-1996.099) (-1996.769) [-1994.251] (-2000.678) -- 0:00:49
Average standard deviation of split frequencies: 0.000000
675500 -- [-1992.312] (-1993.771) (-2002.195) (-1994.145) * (-2003.359) (-1995.783) [-1991.839] (-1991.635) -- 0:00:49
676000 -- (-1996.313) (-2006.104) [-1994.952] (-1996.454) * (-1997.693) [-1995.734] (-1995.957) (-1993.203) -- 0:00:49
676500 -- [-1995.217] (-2000.151) (-1993.453) (-2000.057) * (-1998.542) (-1991.963) (-1999.344) [-1993.870] -- 0:00:49
677000 -- (-1992.839) (-1998.535) (-1999.528) [-1995.856] * (-2003.301) [-1994.523] (-1996.627) (-1995.291) -- 0:00:49
677500 -- (-1993.996) (-2002.023) [-1994.333] (-1994.802) * [-1993.696] (-1993.341) (-1993.010) (-1992.493) -- 0:00:49
678000 -- (-1996.298) (-1997.009) [-1995.238] (-1992.725) * (-1999.288) (-1995.966) (-1995.013) [-1997.135] -- 0:00:49
678500 -- (-2000.985) [-1992.488] (-1999.451) (-1993.089) * (-2003.333) (-1995.467) (-1998.355) [-1991.557] -- 0:00:49
679000 -- (-1993.973) [-1992.477] (-1991.269) (-1997.543) * [-1995.971] (-2006.475) (-1993.662) (-1994.276) -- 0:00:49
679500 -- (-1998.986) [-1992.606] (-1991.682) (-1995.217) * (-1998.208) (-1997.663) (-1995.053) [-1994.675] -- 0:00:49
680000 -- (-1991.195) [-1996.001] (-2000.634) (-1998.458) * (-2000.426) [-1999.466] (-1996.690) (-1998.714) -- 0:00:48
Average standard deviation of split frequencies: 0.000000
680500 -- (-1989.266) (-1994.206) (-1995.631) [-2000.946] * (-1996.606) (-1995.007) (-1993.358) [-1995.372] -- 0:00:48
681000 -- [-1995.900] (-1993.499) (-2004.851) (-1995.598) * (-1992.713) (-1992.347) (-1992.847) [-2000.293] -- 0:00:48
681500 -- (-1996.754) (-1991.809) (-1999.736) [-1996.620] * (-1996.860) [-1996.511] (-1994.923) (-1994.430) -- 0:00:48
682000 -- (-1999.969) [-1990.899] (-2001.635) (-1996.340) * (-1999.973) [-1991.399] (-1991.302) (-1993.680) -- 0:00:48
682500 -- (-1993.379) [-1994.622] (-1998.474) (-1997.020) * (-2000.216) [-1994.383] (-1991.663) (-1993.827) -- 0:00:48
683000 -- (-1997.754) [-1995.646] (-1999.262) (-1993.908) * [-1996.109] (-1994.499) (-1990.431) (-1997.083) -- 0:00:48
683500 -- (-1995.079) (-1995.777) [-1998.688] (-1994.122) * (-1993.919) [-1992.420] (-1996.194) (-1993.588) -- 0:00:48
684000 -- (-1996.352) (-1995.344) [-1992.024] (-1995.498) * (-1997.587) [-1990.468] (-1999.309) (-1993.586) -- 0:00:48
684500 -- [-1994.889] (-1996.231) (-1989.700) (-1996.047) * (-1992.812) [-1995.009] (-1992.668) (-1997.821) -- 0:00:48
685000 -- (-1994.173) (-1994.143) (-1997.039) [-1997.268] * (-1989.625) (-1995.739) [-1993.801] (-1998.487) -- 0:00:48
Average standard deviation of split frequencies: 0.000000
685500 -- (-1994.638) (-1993.858) [-1998.736] (-2002.459) * (-1997.697) [-1995.416] (-1997.668) (-1995.178) -- 0:00:48
686000 -- [-1992.107] (-1997.498) (-1994.278) (-2000.683) * (-1992.783) [-1999.614] (-1997.051) (-1990.301) -- 0:00:48
686500 -- [-2000.253] (-1996.591) (-1997.480) (-1994.358) * (-1999.430) [-1994.684] (-1996.070) (-1996.806) -- 0:00:47
687000 -- [-1998.063] (-1995.417) (-1989.780) (-1996.531) * (-1992.115) [-1999.266] (-1997.628) (-1994.360) -- 0:00:47
687500 -- [-1997.549] (-1994.457) (-1993.883) (-2000.460) * (-1998.029) (-2000.709) [-1995.649] (-1995.499) -- 0:00:47
688000 -- (-1995.152) [-1991.373] (-1995.868) (-1994.245) * (-1999.134) (-1994.576) (-1993.804) [-1992.991] -- 0:00:47
688500 -- (-2000.901) (-1990.545) (-1995.226) [-1998.524] * (-1994.976) [-2000.803] (-1995.067) (-1991.675) -- 0:00:47
689000 -- (-1994.629) [-1993.351] (-1998.676) (-1994.347) * (-2002.178) (-1992.714) [-1991.308] (-1992.265) -- 0:00:47
689500 -- (-1991.983) [-1994.616] (-2000.364) (-1994.528) * (-1993.589) (-2001.887) (-1996.642) [-1993.142] -- 0:00:47
690000 -- (-1997.397) (-1995.973) (-1998.906) [-2001.207] * [-1988.547] (-1999.667) (-1994.315) (-1993.627) -- 0:00:47
Average standard deviation of split frequencies: 0.000000
690500 -- (-2000.769) (-2001.301) [-1992.973] (-1997.408) * (-1997.128) (-2004.377) (-1996.497) [-1998.115] -- 0:00:47
691000 -- (-1999.873) (-2003.287) [-1991.045] (-1996.783) * [-1996.657] (-1996.269) (-1998.116) (-1994.383) -- 0:00:47
691500 -- (-1993.699) (-1996.325) [-1993.149] (-1996.309) * [-1993.980] (-2002.967) (-1990.830) (-1996.757) -- 0:00:47
692000 -- (-1996.960) (-1996.007) (-1998.162) [-1998.483] * (-1996.230) (-2000.828) [-1993.976] (-1992.886) -- 0:00:47
692500 -- (-1993.990) (-1991.315) (-1993.189) [-1999.056] * (-2000.119) (-1996.906) (-1994.501) [-1995.647] -- 0:00:47
693000 -- [-1994.603] (-2004.974) (-1994.770) (-1995.863) * [-1996.050] (-1994.767) (-1997.358) (-1997.030) -- 0:00:46
693500 -- (-1998.373) (-1994.941) [-1995.251] (-1994.307) * (-1993.311) (-1999.335) [-1995.202] (-1991.719) -- 0:00:46
694000 -- (-1992.469) (-1997.436) [-1996.441] (-1995.491) * (-1993.751) (-1991.815) [-1995.176] (-1995.617) -- 0:00:46
694500 -- [-1998.594] (-1994.371) (-1999.513) (-1991.834) * [-1992.390] (-2002.149) (-1993.873) (-1991.034) -- 0:00:46
695000 -- (-1993.233) (-1994.005) [-1997.703] (-1996.395) * [-1993.366] (-1992.924) (-2003.048) (-1995.468) -- 0:00:46
Average standard deviation of split frequencies: 0.000000
695500 -- [-1992.727] (-1994.932) (-1996.518) (-1995.225) * [-1995.768] (-1998.314) (-1999.188) (-1993.272) -- 0:00:46
696000 -- (-1996.676) (-1995.225) [-1996.979] (-1999.712) * (-1996.107) (-2003.463) [-1993.653] (-1992.191) -- 0:00:46
696500 -- (-1996.943) (-1992.915) (-1991.889) [-2003.394] * (-1994.254) [-1988.900] (-1998.470) (-1999.096) -- 0:00:46
697000 -- (-1990.715) (-1999.223) (-1994.470) [-1991.338] * [-1997.335] (-1993.230) (-1993.191) (-1997.159) -- 0:00:46
697500 -- (-2005.085) [-2003.694] (-1994.470) (-1995.566) * (-1992.423) (-1993.968) [-1995.746] (-1996.161) -- 0:00:46
698000 -- [-1994.664] (-1996.605) (-1997.502) (-1994.183) * (-1994.027) (-1993.826) [-1994.256] (-1998.286) -- 0:00:46
698500 -- (-2004.177) (-1996.113) (-1996.812) [-1991.041] * (-1999.249) (-1997.450) (-1994.544) [-1997.525] -- 0:00:46
699000 -- (-1992.341) (-1994.336) [-1997.202] (-1995.798) * [-1996.437] (-1992.806) (-1992.832) (-1997.236) -- 0:00:46
699500 -- (-1993.364) (-1997.777) (-1996.505) [-1998.065] * (-2003.564) (-1996.603) [-1997.750] (-1997.176) -- 0:00:45
700000 -- (-1995.396) [-1988.912] (-2003.577) (-2000.489) * [-2001.101] (-1993.697) (-1993.715) (-1997.628) -- 0:00:45
Average standard deviation of split frequencies: 0.000000
700500 -- [-2002.046] (-2000.969) (-1989.517) (-1999.013) * (-1995.389) (-1994.080) [-1996.697] (-2005.158) -- 0:00:45
701000 -- (-1992.816) [-1995.984] (-1996.282) (-1991.598) * (-2003.913) [-1994.209] (-2000.263) (-1992.009) -- 0:00:45
701500 -- (-1993.052) (-1997.585) (-1990.255) [-1997.988] * (-2000.831) [-1993.510] (-1995.881) (-2000.206) -- 0:00:45
702000 -- (-2004.746) [-1999.265] (-2000.778) (-1994.196) * [-1998.394] (-1994.517) (-2001.519) (-1997.632) -- 0:00:45
702500 -- (-1992.230) (-1994.433) [-1996.944] (-2001.548) * [-1995.313] (-2001.835) (-1996.540) (-1994.739) -- 0:00:45
703000 -- (-1991.973) [-1994.559] (-2003.077) (-1996.851) * (-1999.934) (-1995.269) (-1994.595) [-1988.542] -- 0:00:45
703500 -- (-1991.649) [-1993.880] (-1995.207) (-2001.678) * (-2004.353) [-1992.006] (-1999.556) (-1992.407) -- 0:00:45
704000 -- [-1996.908] (-1991.617) (-1994.488) (-1998.154) * (-1993.358) (-1992.173) (-1990.288) [-1992.893] -- 0:00:45
704500 -- (-1995.599) (-1993.838) [-1991.503] (-1994.243) * (-2001.784) (-1997.476) (-2000.055) [-1992.452] -- 0:00:45
705000 -- [-1995.563] (-1995.720) (-1994.619) (-1994.314) * (-2000.930) (-1999.801) (-1989.179) [-1995.056] -- 0:00:45
Average standard deviation of split frequencies: 0.000000
705500 -- (-1995.229) (-1996.375) [-1994.369] (-1992.883) * (-1993.974) [-1994.711] (-1999.247) (-1996.933) -- 0:00:45
706000 -- (-1994.215) (-2002.459) (-1993.258) [-1995.804] * (-2006.254) (-1991.439) (-1997.906) [-1999.341] -- 0:00:44
706500 -- (-1996.393) (-1994.275) [-1990.458] (-1995.470) * [-1992.886] (-2000.049) (-2000.087) (-1993.691) -- 0:00:44
707000 -- (-1995.111) (-1996.193) [-1996.138] (-1994.283) * (-1996.891) [-1994.112] (-1994.456) (-2003.961) -- 0:00:44
707500 -- (-1997.814) (-1997.589) (-1992.983) [-1994.652] * [-1994.580] (-2002.578) (-1992.248) (-1995.570) -- 0:00:44
708000 -- [-1993.435] (-2001.711) (-2004.451) (-2001.134) * (-1999.055) [-1992.104] (-1998.194) (-1991.866) -- 0:00:44
708500 -- (-1996.739) [-1995.452] (-1991.822) (-1993.540) * (-2004.993) [-1994.810] (-1993.191) (-1990.666) -- 0:00:44
709000 -- [-1993.485] (-1991.880) (-1993.557) (-1993.094) * (-1995.216) [-1994.288] (-1993.937) (-1993.200) -- 0:00:44
709500 -- (-1995.568) [-1995.668] (-1991.999) (-1994.752) * (-1993.070) (-2000.772) [-1998.123] (-2001.160) -- 0:00:44
710000 -- (-1997.524) (-2006.378) [-1991.421] (-1999.388) * (-1993.466) (-1992.208) (-1995.154) [-1992.846] -- 0:00:44
Average standard deviation of split frequencies: 0.000000
710500 -- (-1994.798) (-2001.171) (-1996.051) [-1994.745] * (-1993.497) (-1992.452) (-1992.737) [-1993.417] -- 0:00:44
711000 -- (-1995.697) (-1998.209) (-1995.641) [-1990.086] * (-1990.254) (-1998.190) (-1991.118) [-1996.047] -- 0:00:44
711500 -- (-1999.391) (-1998.987) [-1995.605] (-1991.638) * (-1995.207) [-1992.044] (-1998.458) (-2000.541) -- 0:00:44
712000 -- (-1995.502) (-1994.600) (-1994.105) [-1997.462] * (-1994.947) [-1995.348] (-1990.431) (-1994.935) -- 0:00:44
712500 -- (-2006.660) [-1997.193] (-2001.096) (-1996.821) * (-1995.925) (-1992.984) (-1994.193) [-1998.779] -- 0:00:43
713000 -- (-1994.137) [-1992.300] (-1990.579) (-1994.093) * (-1993.086) [-1992.655] (-1995.290) (-1992.357) -- 0:00:43
713500 -- (-1992.827) (-1998.200) (-1993.021) [-1994.378] * (-1994.685) [-1998.164] (-1995.784) (-1994.198) -- 0:00:43
714000 -- (-1997.866) (-2005.214) [-1991.885] (-1997.202) * (-1990.017) (-2000.587) [-1995.874] (-1994.484) -- 0:00:43
714500 -- (-1999.706) (-2001.227) (-1995.960) [-1996.585] * [-1993.437] (-1998.506) (-2000.705) (-1996.854) -- 0:00:43
715000 -- (-2006.386) (-2007.637) (-1992.041) [-1998.224] * (-1999.287) (-1993.939) (-1998.352) [-1991.619] -- 0:00:43
Average standard deviation of split frequencies: 0.000000
715500 -- (-1999.083) (-1990.221) [-1988.188] (-1999.486) * [-1993.121] (-1994.406) (-2004.792) (-1990.754) -- 0:00:43
716000 -- (-1997.374) (-1996.828) (-2001.712) [-1994.796] * (-2008.171) [-1993.286] (-1996.186) (-1992.690) -- 0:00:43
716500 -- [-1993.490] (-1995.238) (-1994.922) (-2002.326) * (-1993.821) (-2000.152) (-1994.653) [-1994.714] -- 0:00:43
717000 -- [-1991.066] (-1994.922) (-1996.040) (-1990.632) * (-1996.024) [-1997.688] (-1999.299) (-1992.219) -- 0:00:43
717500 -- [-1992.338] (-2000.770) (-1992.670) (-1997.404) * (-1995.434) (-1997.142) (-2002.328) [-1995.500] -- 0:00:43
718000 -- (-1992.552) (-1995.997) (-1988.822) [-1993.797] * [-2000.107] (-1991.955) (-1996.367) (-1996.664) -- 0:00:43
718500 -- (-1992.986) [-1996.356] (-1993.390) (-1996.788) * [-1998.423] (-1995.510) (-1996.548) (-1995.210) -- 0:00:43
719000 -- [-1990.860] (-1997.226) (-2003.665) (-1998.939) * (-1989.819) (-1997.408) [-1996.289] (-1992.009) -- 0:00:42
719500 -- [-1995.240] (-1990.093) (-1992.706) (-1995.205) * (-1997.077) (-1995.096) (-1989.678) [-1993.884] -- 0:00:42
720000 -- (-1992.025) (-1990.286) (-1994.216) [-1995.044] * (-1997.232) (-1997.828) (-1988.738) [-1996.966] -- 0:00:42
Average standard deviation of split frequencies: 0.000000
720500 -- (-1995.922) [-1996.707] (-1995.529) (-1997.170) * [-1994.926] (-1989.973) (-1992.041) (-1992.483) -- 0:00:42
721000 -- (-1993.942) [-1998.373] (-1991.641) (-1996.456) * (-1993.429) [-1991.142] (-1994.382) (-1993.332) -- 0:00:42
721500 -- [-1992.747] (-2003.634) (-1994.212) (-1996.603) * (-1994.706) [-1992.120] (-2001.588) (-1992.149) -- 0:00:42
722000 -- [-1993.844] (-2004.809) (-2000.531) (-1995.923) * (-1993.334) [-1988.954] (-1997.492) (-1998.809) -- 0:00:42
722500 -- [-1995.615] (-1995.130) (-2001.266) (-1994.683) * (-1992.909) (-1993.697) [-1991.956] (-1997.866) -- 0:00:42
723000 -- [-1995.593] (-2011.166) (-1995.778) (-1997.404) * (-1997.576) (-1991.439) (-1992.379) [-1998.551] -- 0:00:42
723500 -- [-1998.430] (-1997.673) (-1992.810) (-1995.891) * (-2005.464) (-1999.345) (-2003.160) [-2000.164] -- 0:00:42
724000 -- (-1998.796) (-1993.923) (-2000.382) [-1994.551] * (-1996.178) (-1994.286) (-1998.764) [-1994.615] -- 0:00:42
724500 -- (-1996.202) (-1991.861) [-1994.166] (-1993.276) * (-1997.789) (-1993.161) (-1997.225) [-2000.397] -- 0:00:42
725000 -- [-1991.827] (-1989.740) (-1995.385) (-2003.712) * (-1999.882) (-1993.306) [-1997.084] (-1996.396) -- 0:00:42
Average standard deviation of split frequencies: 0.000000
725500 -- (-1995.507) [-1996.572] (-1990.793) (-1998.358) * (-1995.749) (-1997.399) [-1998.179] (-1994.212) -- 0:00:41
726000 -- (-1993.007) (-1998.885) [-1996.900] (-1995.801) * [-1998.110] (-1996.960) (-1998.882) (-1994.171) -- 0:00:41
726500 -- (-1996.634) [-1993.209] (-1995.079) (-1992.079) * (-1992.849) (-1995.954) [-2002.184] (-1993.645) -- 0:00:41
727000 -- (-1997.304) [-1995.387] (-1998.890) (-1996.120) * [-1989.826] (-2008.303) (-2000.676) (-1995.604) -- 0:00:41
727500 -- (-1994.536) [-1994.315] (-1998.087) (-1999.600) * (-1992.690) (-1999.217) (-1994.638) [-1993.967] -- 0:00:41
728000 -- (-1999.762) [-1994.918] (-2002.981) (-1997.772) * (-1997.857) (-1994.678) [-1991.868] (-1993.548) -- 0:00:41
728500 -- (-1995.783) [-1993.023] (-1999.825) (-1995.512) * [-1990.433] (-1994.883) (-1992.742) (-1992.580) -- 0:00:41
729000 -- (-1993.336) (-1998.369) [-1988.292] (-1995.519) * (-1996.464) (-1995.929) (-1992.601) [-1990.718] -- 0:00:41
729500 -- (-1997.847) [-1991.256] (-1995.197) (-1995.449) * (-1995.212) (-1996.066) [-1992.163] (-1991.971) -- 0:00:41
730000 -- (-1997.461) [-1988.976] (-1995.101) (-1993.760) * (-1996.159) [-1997.056] (-1997.549) (-1997.374) -- 0:00:41
Average standard deviation of split frequencies: 0.000000
730500 -- (-1992.457) (-1995.119) [-1995.235] (-1999.369) * [-1993.517] (-1994.586) (-1995.258) (-1998.773) -- 0:00:41
731000 -- [-1991.208] (-1995.960) (-1999.959) (-1995.241) * (-1998.986) (-1995.489) [-1994.994] (-1993.258) -- 0:00:41
731500 -- [-1991.890] (-1992.539) (-1995.305) (-1991.927) * (-1993.499) [-1995.224] (-1992.865) (-1996.869) -- 0:00:41
732000 -- (-1992.108) (-1997.385) [-1993.989] (-2000.523) * (-1991.182) (-1998.506) [-1992.985] (-2002.813) -- 0:00:41
732500 -- [-1995.098] (-1991.989) (-1992.613) (-1994.664) * [-1997.022] (-2000.751) (-1994.226) (-1994.963) -- 0:00:40
733000 -- (-1998.802) (-1990.277) (-1995.019) [-1994.100] * (-2008.046) (-1996.020) (-1991.696) [-1988.863] -- 0:00:40
733500 -- (-1996.763) (-1995.300) (-1991.860) [-1998.911] * (-1996.106) (-2002.043) (-1996.972) [-1992.994] -- 0:00:40
734000 -- [-1995.477] (-1999.802) (-1994.606) (-1992.209) * (-1992.895) [-1992.255] (-1996.653) (-1996.038) -- 0:00:40
734500 -- (-1996.379) (-1995.471) [-1996.005] (-1994.558) * (-1990.646) [-1995.739] (-1995.027) (-1994.034) -- 0:00:40
735000 -- (-1997.764) [-1996.415] (-1997.554) (-1995.253) * (-1994.610) (-1994.561) (-1995.379) [-1994.899] -- 0:00:40
Average standard deviation of split frequencies: 0.000000
735500 -- (-1995.590) (-1993.287) [-1996.555] (-1993.104) * (-1997.175) [-1992.801] (-1994.088) (-1992.304) -- 0:00:40
736000 -- [-1994.927] (-1994.708) (-1997.784) (-1998.812) * (-1994.901) [-1999.035] (-1995.361) (-1992.030) -- 0:00:40
736500 -- (-1996.888) (-1996.197) (-1999.026) [-2001.987] * (-1995.091) (-1999.024) (-2000.528) [-1991.253] -- 0:00:40
737000 -- (-1993.533) (-1996.981) (-1991.537) [-1992.498] * (-1993.079) [-2007.191] (-1995.651) (-1999.145) -- 0:00:40
737500 -- (-1999.674) (-1996.783) (-1992.327) [-1993.921] * (-2003.977) (-1995.386) [-1993.251] (-1993.391) -- 0:00:40
738000 -- [-2008.142] (-1997.810) (-1992.366) (-1996.891) * [-1996.302] (-1993.455) (-1994.648) (-1993.324) -- 0:00:40
738500 -- [-1992.691] (-1997.359) (-1996.943) (-1995.993) * (-1996.724) [-1992.845] (-2001.511) (-1994.031) -- 0:00:40
739000 -- (-1990.355) [-1994.220] (-1996.923) (-1996.838) * [-1995.216] (-1998.050) (-1990.403) (-1991.994) -- 0:00:39
739500 -- (-1999.507) (-1997.641) (-2001.852) [-1992.870] * (-1993.554) (-1992.899) [-1994.225] (-1994.291) -- 0:00:39
740000 -- (-1993.762) [-1989.717] (-2002.707) (-1994.135) * (-1997.674) (-1997.882) (-2000.327) [-1999.447] -- 0:00:39
Average standard deviation of split frequencies: 0.000000
740500 -- (-1993.164) (-1994.420) (-1999.623) [-1994.282] * (-1995.126) (-2001.491) (-1997.548) [-1991.803] -- 0:00:39
741000 -- (-1991.622) [-1997.489] (-1994.387) (-2001.596) * (-2001.692) (-1993.811) (-1994.093) [-1997.441] -- 0:00:39
741500 -- (-1989.727) [-1996.237] (-2004.328) (-1992.952) * (-1993.229) [-1992.493] (-1995.399) (-1993.374) -- 0:00:39
742000 -- (-1995.816) [-1997.316] (-1996.030) (-1990.893) * (-1995.438) (-1996.481) [-1989.448] (-1999.751) -- 0:00:39
742500 -- (-1993.231) (-1999.433) (-1994.575) [-1992.956] * (-1993.422) (-1995.819) (-1997.609) [-1992.843] -- 0:00:39
743000 -- (-1999.787) (-1996.322) (-1995.714) [-1994.155] * (-1994.004) (-1993.584) (-2000.682) [-1994.069] -- 0:00:39
743500 -- (-1992.569) (-1997.060) (-2000.176) [-1991.763] * (-1993.822) (-1998.560) [-1991.651] (-1996.959) -- 0:00:39
744000 -- (-1990.382) (-2001.262) (-1995.259) [-1998.683] * (-1993.564) [-1996.621] (-1991.110) (-2002.586) -- 0:00:39
744500 -- (-1995.717) [-1992.195] (-1993.609) (-1994.056) * (-2002.923) (-1998.110) (-1994.473) [-1994.820] -- 0:00:39
745000 -- (-1995.771) (-1994.527) (-2003.796) [-1996.463] * (-1996.104) (-1999.669) (-1997.927) [-1994.937] -- 0:00:39
Average standard deviation of split frequencies: 0.000000
745500 -- (-1996.835) (-1995.760) (-1999.210) [-1995.458] * (-1997.983) [-1996.381] (-1999.229) (-1989.055) -- 0:00:38
746000 -- (-2006.137) (-1997.971) (-2003.875) [-1992.163] * (-2000.651) (-1999.215) (-1999.318) [-1993.229] -- 0:00:38
746500 -- (-1996.178) (-1994.697) [-1991.000] (-1998.928) * [-1992.330] (-1991.673) (-1997.062) (-1997.595) -- 0:00:38
747000 -- (-1996.105) (-1993.745) [-2001.121] (-1997.329) * (-1999.027) (-1991.365) [-1995.291] (-1993.744) -- 0:00:38
747500 -- [-1996.717] (-1993.337) (-1996.205) (-1997.142) * (-2005.499) (-1995.574) (-1992.309) [-1993.200] -- 0:00:38
748000 -- (-2011.004) (-1991.819) (-1994.609) [-1993.011] * [-1992.100] (-2005.828) (-1996.602) (-1994.319) -- 0:00:38
748500 -- (-1997.823) [-2000.211] (-1992.365) (-1995.650) * [-1993.655] (-1996.901) (-1996.139) (-1993.649) -- 0:00:38
749000 -- [-1990.735] (-1992.555) (-1991.464) (-2001.953) * (-2000.118) (-1995.542) [-1995.756] (-1999.033) -- 0:00:38
749500 -- (-1991.421) [-1992.204] (-1997.943) (-2000.777) * (-1996.334) [-1992.132] (-1992.603) (-1998.326) -- 0:00:38
750000 -- (-1992.687) [-1999.657] (-1998.374) (-2001.064) * [-1997.591] (-1997.806) (-1995.079) (-1999.019) -- 0:00:38
Average standard deviation of split frequencies: 0.000000
750500 -- [-2001.102] (-1992.415) (-1991.579) (-2004.141) * (-2000.144) [-1995.853] (-1994.481) (-1998.087) -- 0:00:38
751000 -- (-1993.935) (-1996.311) [-1994.306] (-1998.880) * (-1997.524) [-1988.104] (-2009.140) (-1994.062) -- 0:00:38
751500 -- [-1996.095] (-1990.902) (-1993.307) (-1997.073) * (-2007.549) (-1993.964) [-1995.855] (-1995.365) -- 0:00:38
752000 -- [-1992.324] (-1992.024) (-1994.609) (-1994.918) * [-1994.204] (-1996.040) (-2001.193) (-2001.449) -- 0:00:37
752500 -- (-1994.833) (-1993.199) (-1993.039) [-1997.857] * (-1993.989) (-1996.023) (-1998.608) [-1989.944] -- 0:00:37
753000 -- (-2001.536) [-1989.957] (-1992.217) (-2002.210) * (-1993.415) (-1999.128) [-1994.519] (-1997.156) -- 0:00:37
753500 -- (-1997.368) [-1996.746] (-1994.032) (-2001.792) * (-1993.142) (-1998.186) (-1994.527) [-1993.399] -- 0:00:37
754000 -- [-1993.492] (-1993.252) (-1996.716) (-1998.383) * (-2002.089) (-2004.175) [-1994.113] (-1995.985) -- 0:00:37
754500 -- (-1992.184) [-1994.083] (-1994.809) (-1994.169) * (-1997.056) (-1990.756) [-1991.140] (-1995.705) -- 0:00:37
755000 -- (-2003.531) [-1998.082] (-1997.885) (-1989.929) * (-1995.101) (-1993.897) (-1990.293) [-2000.526] -- 0:00:37
Average standard deviation of split frequencies: 0.000000
755500 -- [-1995.075] (-1993.930) (-1994.927) (-1995.227) * [-1997.614] (-1997.632) (-1994.714) (-1993.746) -- 0:00:37
756000 -- (-2003.299) (-2001.487) [-2005.487] (-1997.860) * (-1998.047) [-1995.771] (-2002.921) (-1994.205) -- 0:00:37
756500 -- (-1996.047) (-2011.607) (-1991.095) [-1991.828] * (-1997.803) (-1992.428) (-1996.483) [-1990.956] -- 0:00:37
757000 -- (-1999.690) [-1992.747] (-2001.672) (-1993.678) * (-1994.179) (-1995.154) [-1992.529] (-2001.180) -- 0:00:37
757500 -- (-1994.304) (-1997.568) (-1993.716) [-1992.338] * (-1991.246) (-2002.009) [-1994.702] (-1995.654) -- 0:00:37
758000 -- (-1995.262) (-1993.343) [-1993.909] (-1995.233) * [-1999.936] (-1996.446) (-1997.779) (-2004.736) -- 0:00:37
758500 -- (-1993.768) (-1995.842) [-1996.277] (-1999.683) * (-1990.721) (-2002.163) (-1996.821) [-1996.120] -- 0:00:36
759000 -- (-1995.195) [-1994.522] (-1996.450) (-1995.656) * [-1998.056] (-2001.351) (-1998.972) (-1995.883) -- 0:00:37
759500 -- (-1998.836) (-1992.642) (-1993.952) [-1999.421] * (-1995.756) (-1999.890) (-1994.831) [-1997.709] -- 0:00:37
760000 -- (-2004.915) (-2002.450) (-1995.171) [-2000.434] * [-1992.149] (-1995.027) (-1997.144) (-2001.541) -- 0:00:36
Average standard deviation of split frequencies: 0.000000
760500 -- [-1992.544] (-1999.300) (-1995.511) (-1996.870) * (-1999.040) (-1998.671) [-1992.891] (-1992.522) -- 0:00:36
761000 -- [-1998.719] (-2001.420) (-1991.734) (-1996.984) * (-1998.908) [-1991.784] (-1996.379) (-2001.204) -- 0:00:36
761500 -- (-1993.998) (-1997.615) (-2007.639) [-1993.421] * [-1997.519] (-1990.425) (-1995.718) (-1997.907) -- 0:00:36
762000 -- (-1993.537) (-1991.707) [-1991.540] (-2002.633) * [-1997.005] (-1997.262) (-1991.497) (-1999.082) -- 0:00:36
762500 -- (-1996.681) [-2001.140] (-2002.573) (-1996.128) * (-1995.259) (-1990.134) [-1996.827] (-1997.142) -- 0:00:36
763000 -- (-1998.748) (-1994.212) (-2001.247) [-1999.146] * (-1995.493) [-1993.623] (-1993.466) (-1997.082) -- 0:00:36
763500 -- [-1990.749] (-1996.983) (-1999.868) (-1995.924) * (-1995.410) [-1992.294] (-1992.358) (-1999.207) -- 0:00:36
764000 -- (-1994.171) (-1996.684) (-1995.537) [-2001.723] * (-1995.733) (-1994.009) [-1993.463] (-1994.697) -- 0:00:36
764500 -- [-1991.522] (-1992.591) (-1992.865) (-1999.267) * (-1997.895) [-1997.062] (-1996.842) (-1995.655) -- 0:00:36
765000 -- (-1996.691) [-2000.863] (-1994.758) (-1996.243) * (-1996.369) (-1993.639) [-1995.926] (-2002.690) -- 0:00:36
Average standard deviation of split frequencies: 0.000000
765500 -- [-1995.591] (-1996.957) (-1991.785) (-1994.568) * (-1993.265) (-1996.931) (-2002.841) [-2000.216] -- 0:00:36
766000 -- (-1991.938) [-1996.316] (-1997.442) (-1996.823) * (-1998.400) (-1993.223) (-1997.899) [-1997.000] -- 0:00:36
766500 -- (-1996.689) [-1993.237] (-1995.494) (-1998.290) * (-1997.137) [-1994.529] (-1990.188) (-1993.802) -- 0:00:35
767000 -- (-1993.951) (-1993.359) [-1994.509] (-1995.231) * (-1994.264) [-1994.917] (-1993.143) (-1995.229) -- 0:00:35
767500 -- [-1995.899] (-1992.467) (-1991.374) (-2003.788) * (-1994.174) [-1996.519] (-1990.607) (-1995.712) -- 0:00:35
768000 -- [-2001.196] (-1996.717) (-2004.871) (-1993.548) * (-1994.343) (-2000.122) (-1995.503) [-1998.188] -- 0:00:35
768500 -- (-1993.996) (-1996.878) [-1992.682] (-1993.323) * (-1993.927) [-1996.163] (-1995.773) (-1993.043) -- 0:00:35
769000 -- (-1993.763) [-2003.825] (-2004.359) (-1992.488) * (-1991.978) (-1994.693) (-1994.279) [-1996.393] -- 0:00:35
769500 -- (-1993.152) (-1995.561) (-1999.754) [-1992.908] * (-1998.098) (-1996.321) [-1992.311] (-2001.466) -- 0:00:35
770000 -- (-1990.751) [-1991.610] (-2001.679) (-1999.943) * (-1995.299) [-1997.631] (-1992.982) (-2000.001) -- 0:00:35
Average standard deviation of split frequencies: 0.000000
770500 -- (-2000.564) (-1995.962) (-1993.077) [-1994.022] * (-1992.932) (-1998.745) [-1995.022] (-1996.486) -- 0:00:35
771000 -- [-1996.744] (-1991.966) (-1993.304) (-1993.553) * (-2001.222) (-2003.999) [-1996.154] (-1994.075) -- 0:00:35
771500 -- (-1990.985) (-1992.898) (-1997.438) [-1990.469] * (-1992.334) (-1998.711) (-1996.212) [-1993.203] -- 0:00:35
772000 -- [-1992.664] (-1996.305) (-1992.997) (-1995.374) * (-1998.949) (-1996.162) [-1994.606] (-1996.470) -- 0:00:35
772500 -- [-1995.752] (-1995.612) (-1993.616) (-1997.413) * (-1992.870) [-1998.186] (-1995.189) (-1994.376) -- 0:00:35
773000 -- (-2002.470) [-1995.610] (-1990.138) (-1997.465) * [-1992.480] (-1994.981) (-1997.316) (-1999.426) -- 0:00:34
773500 -- [-1993.996] (-1991.227) (-1993.757) (-1995.263) * (-1997.036) (-1996.781) (-1991.602) [-1994.986] -- 0:00:34
774000 -- (-1991.680) [-1994.128] (-1994.455) (-2000.700) * (-1993.440) (-1996.200) [-1996.632] (-1995.744) -- 0:00:34
774500 -- (-2000.688) (-1993.219) (-1996.541) [-1993.208] * (-1993.407) (-1990.218) (-1996.222) [-1998.452] -- 0:00:34
775000 -- (-1998.176) (-1996.713) [-1991.738] (-1991.130) * [-1997.107] (-1993.971) (-1993.620) (-1994.817) -- 0:00:34
Average standard deviation of split frequencies: 0.000000
775500 -- (-1998.499) (-1993.114) [-1989.793] (-1997.605) * (-1995.052) [-2002.686] (-1995.574) (-2001.530) -- 0:00:34
776000 -- (-1996.212) (-1996.414) [-1995.267] (-1998.245) * (-1991.573) (-2001.442) [-1991.066] (-1997.596) -- 0:00:34
776500 -- (-1996.500) [-1993.899] (-1995.867) (-2000.178) * (-1992.131) (-2004.616) [-1996.063] (-1992.332) -- 0:00:34
777000 -- (-1996.379) (-1992.734) [-1995.337] (-1993.110) * (-1996.652) (-2000.504) (-1993.114) [-1997.832] -- 0:00:34
777500 -- [-1994.144] (-1994.505) (-2000.558) (-1993.716) * [-1992.057] (-1996.334) (-1994.101) (-1989.228) -- 0:00:34
778000 -- [-1993.495] (-1993.985) (-1998.151) (-1994.978) * (-1994.595) (-1995.046) [-1993.316] (-1997.288) -- 0:00:34
778500 -- (-2000.934) [-1999.172] (-1991.766) (-1999.071) * (-1993.746) [-1992.817] (-1991.293) (-1993.537) -- 0:00:34
779000 -- (-1996.773) (-1991.970) [-1994.258] (-2004.015) * (-1999.518) [-1990.199] (-2000.956) (-1996.435) -- 0:00:34
779500 -- (-1988.951) (-2001.075) (-1994.795) [-1998.844] * (-1988.529) [-1995.677] (-2007.053) (-1998.134) -- 0:00:33
780000 -- (-1996.652) (-1998.396) [-1993.901] (-1993.121) * [-1991.936] (-1995.746) (-1993.936) (-1996.220) -- 0:00:33
Average standard deviation of split frequencies: 0.000000
780500 -- [-1993.919] (-1994.795) (-1992.924) (-1995.332) * (-2000.160) (-1994.309) [-1992.646] (-1994.491) -- 0:00:33
781000 -- (-2002.548) [-1991.211] (-2002.580) (-1997.623) * (-1993.007) [-1996.388] (-1997.605) (-1997.037) -- 0:00:33
781500 -- (-1992.691) (-1993.011) [-1991.005] (-1995.934) * (-1996.860) (-1993.708) [-2002.626] (-1995.805) -- 0:00:33
782000 -- (-1991.070) (-1994.373) (-1996.396) [-1996.457] * (-1992.562) (-1994.015) [-1996.374] (-1993.764) -- 0:00:33
782500 -- (-2002.518) (-1996.611) [-1998.087] (-2000.080) * (-1995.000) [-1993.529] (-1995.425) (-1992.674) -- 0:00:33
783000 -- [-1999.322] (-1997.625) (-1999.034) (-2001.063) * [-2000.723] (-1991.696) (-1992.419) (-1997.526) -- 0:00:33
783500 -- [-1993.102] (-1995.730) (-2001.733) (-1997.457) * (-1993.380) [-1991.876] (-2002.673) (-1997.768) -- 0:00:33
784000 -- [-1996.945] (-1995.929) (-1997.914) (-1995.559) * [-1995.445] (-1992.910) (-1996.014) (-2003.498) -- 0:00:33
784500 -- (-1997.915) [-1996.267] (-1991.486) (-1997.260) * (-1991.267) (-2008.171) (-2001.919) [-2001.722] -- 0:00:33
785000 -- (-1993.214) (-1991.645) [-1992.626] (-1992.336) * [-1994.698] (-2002.269) (-1998.681) (-1999.845) -- 0:00:33
Average standard deviation of split frequencies: 0.000000
785500 -- (-1992.942) (-2002.180) (-2001.336) [-1995.395] * (-1990.260) [-1998.081] (-1995.947) (-2001.168) -- 0:00:33
786000 -- (-1995.536) (-1998.329) (-2003.891) [-1991.503] * (-1996.161) [-1994.120] (-2001.903) (-2005.014) -- 0:00:32
786500 -- (-1996.790) (-1993.379) (-2002.199) [-1994.414] * [-1995.460] (-1993.762) (-2001.652) (-1999.513) -- 0:00:32
787000 -- (-1996.024) [-1994.592] (-2002.515) (-1995.569) * (-1992.881) (-1997.675) [-1996.912] (-1993.274) -- 0:00:32
787500 -- (-2000.085) (-2001.916) [-1999.425] (-1992.647) * [-1995.720] (-1999.512) (-1993.692) (-2003.490) -- 0:00:32
788000 -- (-1991.535) (-1996.137) (-2002.399) [-1989.595] * (-1993.802) (-1996.257) [-1993.928] (-1999.149) -- 0:00:32
788500 -- [-1993.399] (-1992.819) (-1998.124) (-1996.970) * (-1992.198) (-1993.734) [-1994.496] (-1995.951) -- 0:00:32
789000 -- (-1989.832) (-1996.678) (-1996.493) [-1991.092] * [-1995.849] (-1996.649) (-1999.245) (-1999.019) -- 0:00:32
789500 -- (-1995.476) (-1994.275) (-2004.707) [-1992.133] * [-1991.217] (-1998.939) (-1998.370) (-1995.364) -- 0:00:32
790000 -- [-1996.098] (-1999.275) (-1998.336) (-1996.289) * [-1996.425] (-1993.499) (-1996.575) (-1996.499) -- 0:00:32
Average standard deviation of split frequencies: 0.000000
790500 -- (-1995.012) (-1993.934) (-1995.184) [-1993.442] * [-1992.552] (-2000.994) (-1993.879) (-1995.726) -- 0:00:32
791000 -- [-1996.096] (-2000.776) (-1997.899) (-1995.472) * (-1995.122) (-1997.728) (-2003.854) [-1997.285] -- 0:00:32
791500 -- [-1992.648] (-1994.498) (-2000.760) (-1996.316) * (-2004.666) (-1995.468) (-1996.247) [-2002.632] -- 0:00:32
792000 -- (-1997.730) (-1996.465) (-1996.301) [-1993.985] * (-1992.452) (-1992.856) (-1999.283) [-1996.341] -- 0:00:32
792500 -- (-2001.954) (-1994.628) (-1997.779) [-1995.381] * (-1996.619) [-1997.202] (-1992.860) (-1993.288) -- 0:00:31
793000 -- (-1998.002) [-1990.112] (-1994.115) (-1990.474) * (-1999.520) [-1991.601] (-1993.447) (-1992.168) -- 0:00:31
793500 -- (-1999.130) [-1993.458] (-2002.256) (-1993.310) * (-1997.906) (-1994.799) [-1998.004] (-1992.353) -- 0:00:31
794000 -- (-1994.449) (-2000.638) (-1996.129) [-1993.965] * (-1997.544) (-1997.462) [-1993.254] (-1996.807) -- 0:00:31
794500 -- (-1994.950) [-2005.143] (-1997.495) (-1995.424) * (-1999.796) [-1997.781] (-1999.268) (-1996.820) -- 0:00:31
795000 -- [-1997.839] (-2001.063) (-2002.684) (-1998.716) * (-1998.626) (-1991.793) (-1994.954) [-1996.486] -- 0:00:31
Average standard deviation of split frequencies: 0.000000
795500 -- (-1997.776) [-1997.858] (-1997.253) (-2001.979) * (-1989.824) (-1995.298) (-1996.151) [-1993.403] -- 0:00:31
796000 -- (-2001.286) (-1994.465) (-1990.847) [-1998.060] * (-1995.668) [-1995.572] (-2000.846) (-1995.876) -- 0:00:31
796500 -- (-1995.792) (-1992.784) (-1994.759) [-1994.169] * (-1994.490) (-2000.672) (-2000.045) [-1991.803] -- 0:00:31
797000 -- [-1994.947] (-1992.734) (-1990.492) (-1996.368) * (-1995.930) (-1990.658) (-1993.515) [-1997.565] -- 0:00:31
797500 -- [-1995.675] (-1994.544) (-1996.532) (-1997.565) * (-1991.330) (-1994.882) [-1997.405] (-1992.573) -- 0:00:31
798000 -- (-1995.297) (-1992.250) (-1994.184) [-1999.209] * [-1992.208] (-1994.173) (-1989.501) (-1990.429) -- 0:00:31
798500 -- [-1993.347] (-1990.012) (-1991.160) (-2005.687) * (-1995.659) (-1995.956) (-1992.534) [-1994.395] -- 0:00:31
799000 -- (-1990.339) [-1995.564] (-1997.600) (-1998.508) * (-1991.855) (-1999.414) (-1993.263) [-1996.428] -- 0:00:30
799500 -- [-1992.890] (-1995.276) (-1991.175) (-1994.783) * (-1991.368) (-1998.619) (-1991.705) [-1993.116] -- 0:00:30
800000 -- [-1998.772] (-1993.476) (-1991.132) (-2004.555) * (-1992.491) [-1991.209] (-2000.907) (-1996.389) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
800500 -- (-1995.231) (-1995.867) [-1994.165] (-1995.909) * (-1990.131) (-2001.805) (-1996.447) [-2000.968] -- 0:00:30
801000 -- (-2004.311) (-1991.719) (-1995.859) [-1990.218] * (-1998.491) (-1997.602) (-1995.785) [-1991.362] -- 0:00:30
801500 -- (-2002.609) [-1992.029] (-1994.675) (-1997.982) * (-1992.386) (-1995.590) [-1997.248] (-1998.176) -- 0:00:30
802000 -- (-1995.233) [-1997.724] (-1997.784) (-2003.076) * [-2001.089] (-1999.213) (-1997.019) (-1997.879) -- 0:00:30
802500 -- (-1990.184) [-1993.337] (-1999.206) (-2006.101) * [-1993.086] (-1992.566) (-2005.694) (-1996.388) -- 0:00:30
803000 -- (-1992.879) [-1993.130] (-2003.933) (-2001.683) * (-1993.876) (-1995.631) [-1998.070] (-1996.678) -- 0:00:30
803500 -- [-1991.488] (-1998.600) (-2004.111) (-1995.778) * [-1992.289] (-1998.269) (-2001.535) (-1991.676) -- 0:00:30
804000 -- [-2000.700] (-1994.587) (-1996.119) (-1994.239) * (-2006.073) (-1991.613) (-1995.196) [-1991.370] -- 0:00:30
804500 -- [-1991.534] (-1992.202) (-1999.124) (-1994.972) * (-2003.836) (-1995.057) (-1995.578) [-1996.587] -- 0:00:30
805000 -- (-1997.806) (-1992.365) (-1991.187) [-1996.464] * (-2001.961) [-1988.911] (-1995.421) (-1996.438) -- 0:00:30
Average standard deviation of split frequencies: 0.000000
805500 -- [-1992.960] (-1996.245) (-1992.294) (-1996.176) * (-1998.126) [-1995.003] (-1998.765) (-2004.756) -- 0:00:29
806000 -- (-1994.946) (-1994.129) (-1993.209) [-1992.672] * (-1999.004) [-1995.277] (-1989.367) (-1996.103) -- 0:00:29
806500 -- (-1990.423) [-1993.047] (-1999.954) (-1996.393) * (-1999.978) [-1991.755] (-1994.653) (-1993.400) -- 0:00:29
807000 -- [-1991.634] (-1992.582) (-2003.435) (-1996.165) * (-2004.490) (-1996.488) [-1994.705] (-1989.851) -- 0:00:29
807500 -- [-1992.265] (-1996.769) (-2000.070) (-1994.408) * (-1996.669) (-1997.276) (-1991.590) [-1991.037] -- 0:00:29
808000 -- (-1993.943) [-1994.453] (-2002.057) (-2002.676) * (-1993.826) [-1998.638] (-1991.881) (-1995.605) -- 0:00:29
808500 -- [-1996.114] (-1999.005) (-1995.104) (-2001.394) * (-1994.055) (-2001.297) [-1992.414] (-1992.759) -- 0:00:29
809000 -- (-1995.341) [-1993.761] (-2000.180) (-1994.341) * (-1992.477) (-1993.040) (-1990.370) [-1991.617] -- 0:00:29
809500 -- (-1995.214) (-1997.804) (-1996.927) [-1995.354] * (-1997.494) (-1996.240) (-1995.283) [-1996.370] -- 0:00:29
810000 -- (-1993.012) [-1993.132] (-1996.143) (-1998.485) * (-1991.315) [-1996.927] (-1998.678) (-1991.787) -- 0:00:29
Average standard deviation of split frequencies: 0.000000
810500 -- (-2004.616) [-1997.477] (-1994.738) (-1991.776) * [-1995.520] (-1994.932) (-1993.876) (-1998.238) -- 0:00:29
811000 -- [-1995.727] (-1992.836) (-1998.740) (-1995.758) * (-1995.615) (-1996.378) [-1994.415] (-1991.951) -- 0:00:29
811500 -- (-2003.305) (-1992.373) (-2000.751) [-1991.641] * (-1998.145) (-1995.442) [-1993.794] (-1990.699) -- 0:00:29
812000 -- (-1993.306) (-1997.194) (-1995.634) [-1994.717] * (-1995.745) [-1995.404] (-2002.030) (-1990.335) -- 0:00:28
812500 -- [-1990.223] (-1989.688) (-1997.069) (-2000.183) * (-1992.165) (-1995.395) (-1999.002) [-1992.779] -- 0:00:28
813000 -- [-1999.911] (-1994.682) (-1993.025) (-2000.447) * (-1993.497) (-1993.662) [-1996.760] (-1995.677) -- 0:00:28
813500 -- [-1994.666] (-1997.799) (-1995.441) (-1995.067) * (-1998.051) [-1993.652] (-1993.966) (-1997.480) -- 0:00:28
814000 -- (-1994.906) (-1994.449) (-1991.872) [-1996.983] * (-1993.289) (-2004.120) [-1993.266] (-1994.232) -- 0:00:28
814500 -- (-1992.892) (-2003.251) (-1999.230) [-1995.603] * (-2001.953) (-2001.589) (-1993.977) [-1996.261] -- 0:00:28
815000 -- (-1995.511) (-1998.842) (-1992.177) [-1994.506] * [-1992.741] (-2002.000) (-1990.176) (-1994.354) -- 0:00:28
Average standard deviation of split frequencies: 0.000000
815500 -- (-1994.712) (-1992.770) (-1999.773) [-1995.764] * (-1999.616) [-1994.096] (-1999.800) (-1995.188) -- 0:00:28
816000 -- (-1995.875) (-2001.684) [-1994.643] (-1995.683) * (-2004.173) (-1991.905) (-1995.582) [-1996.098] -- 0:00:28
816500 -- (-1998.820) (-1992.446) (-1996.058) [-1999.177] * (-1996.556) (-1992.358) [-1999.181] (-1999.453) -- 0:00:28
817000 -- (-2001.311) (-1992.920) (-1995.651) [-1997.775] * (-1997.996) (-1993.301) (-1995.094) [-1999.779] -- 0:00:28
817500 -- [-1993.097] (-2005.201) (-1991.911) (-1991.467) * [-1995.613] (-1997.017) (-1998.454) (-2009.007) -- 0:00:28
818000 -- (-1989.722) [-1991.812] (-1994.530) (-1995.547) * [-1991.838] (-1998.013) (-2001.825) (-1994.275) -- 0:00:28
818500 -- (-1995.873) (-1992.770) (-2003.838) [-1995.430] * (-1996.095) [-1995.328] (-1993.360) (-1998.228) -- 0:00:27
819000 -- (-2000.025) (-1993.723) (-1994.305) [-1992.625] * (-1999.783) (-1992.227) [-1994.789] (-1994.521) -- 0:00:27
819500 -- (-1991.948) (-1990.983) (-1990.739) [-1991.832] * (-1994.167) (-1999.559) [-1996.473] (-1994.399) -- 0:00:27
820000 -- [-1993.913] (-1995.502) (-1998.627) (-1998.848) * (-1993.970) [-1992.957] (-1995.006) (-1997.531) -- 0:00:27
Average standard deviation of split frequencies: 0.000000
820500 -- (-1998.799) (-1998.605) [-1999.405] (-1995.152) * (-1993.840) (-1998.732) [-1990.531] (-1993.038) -- 0:00:27
821000 -- (-1994.455) (-2003.067) [-1995.411] (-1993.238) * (-2001.891) [-1999.276] (-1994.032) (-2000.455) -- 0:00:27
821500 -- [-1999.143] (-1992.857) (-1994.122) (-1994.584) * (-1999.846) (-1994.810) (-1995.219) [-1991.766] -- 0:00:27
822000 -- (-1995.169) (-1991.298) (-1999.004) [-1994.636] * (-1995.261) (-1996.798) (-2004.031) [-1994.973] -- 0:00:27
822500 -- (-1998.002) (-1993.588) [-2000.187] (-1992.169) * (-1990.761) (-1991.130) [-2001.893] (-1999.850) -- 0:00:27
823000 -- (-1996.691) (-1992.075) (-1998.777) [-1994.106] * (-1993.995) [-2000.595] (-2006.011) (-1997.860) -- 0:00:27
823500 -- (-1997.331) (-1996.090) [-1991.318] (-1994.318) * [-1991.901] (-1998.801) (-1997.734) (-1994.543) -- 0:00:27
824000 -- [-1995.450] (-1989.647) (-1993.336) (-1998.705) * [-2002.126] (-1996.160) (-1999.123) (-2001.534) -- 0:00:27
824500 -- (-1996.346) (-1995.417) (-1993.220) [-1992.434] * [-2001.425] (-1999.181) (-2000.070) (-1997.828) -- 0:00:27
825000 -- [-1995.764] (-2001.089) (-1998.472) (-1998.495) * (-2001.690) (-1997.521) (-1997.483) [-1997.115] -- 0:00:26
Average standard deviation of split frequencies: 0.000000
825500 -- (-1993.038) (-2001.232) (-1993.752) [-1993.132] * (-2001.747) (-1997.550) (-1999.913) [-1991.414] -- 0:00:26
826000 -- (-1995.653) (-2001.521) (-2003.918) [-1993.605] * (-1994.019) [-1990.631] (-1991.905) (-1996.842) -- 0:00:26
826500 -- (-1999.478) (-2003.729) (-1996.999) [-1994.258] * (-1988.924) (-1992.507) [-1999.815] (-1994.635) -- 0:00:26
827000 -- [-1992.511] (-1994.949) (-1999.702) (-1996.000) * (-1996.567) (-1992.250) (-1993.192) [-1997.859] -- 0:00:26
827500 -- (-1994.025) (-1995.801) (-1997.634) [-1993.582] * (-1992.443) (-1994.917) (-2009.181) [-1989.283] -- 0:00:26
828000 -- (-1990.081) (-1998.921) [-1994.693] (-1994.603) * [-2000.288] (-1998.787) (-2006.086) (-1998.423) -- 0:00:26
828500 -- (-1994.804) (-2009.992) [-1995.856] (-1998.962) * (-1997.210) (-1993.440) [-1994.499] (-2000.831) -- 0:00:26
829000 -- [-1994.366] (-2002.025) (-1994.312) (-1993.227) * (-1995.570) [-1994.346] (-1992.992) (-2006.353) -- 0:00:26
829500 -- (-1996.605) [-1998.368] (-1994.738) (-1999.340) * (-1992.919) (-1995.559) (-1994.800) [-1998.190] -- 0:00:26
830000 -- (-1994.983) (-1994.469) (-1994.026) [-1995.597] * (-1991.569) [-1994.830] (-1996.732) (-1995.645) -- 0:00:26
Average standard deviation of split frequencies: 0.000000
830500 -- [-1993.759] (-1992.103) (-1994.179) (-1994.356) * (-1999.214) [-1992.118] (-1992.628) (-2005.596) -- 0:00:26
831000 -- [-1993.810] (-1995.780) (-1995.120) (-1994.752) * (-1993.124) (-1992.915) [-1998.419] (-2005.097) -- 0:00:26
831500 -- [-1992.025] (-2000.216) (-1996.296) (-1996.591) * [-1994.236] (-1990.739) (-1995.561) (-2000.507) -- 0:00:25
832000 -- (-1996.328) (-1992.220) [-1993.073] (-1994.161) * (-1998.052) (-1992.619) (-1998.579) [-1998.909] -- 0:00:25
832500 -- [-1995.840] (-1994.782) (-1995.084) (-1993.318) * (-1996.850) [-1997.787] (-2002.329) (-1995.746) -- 0:00:25
833000 -- [-1992.374] (-1995.687) (-2000.813) (-1993.445) * (-1998.380) (-2000.494) (-1993.075) [-1993.847] -- 0:00:25
833500 -- (-1995.285) (-1994.976) (-1999.751) [-1992.977] * (-1995.471) [-1990.805] (-1988.592) (-2002.370) -- 0:00:25
834000 -- (-2001.154) (-1997.904) (-1998.480) [-1992.176] * (-1989.229) [-1991.861] (-1994.631) (-1993.670) -- 0:00:25
834500 -- [-1995.237] (-1990.432) (-1994.567) (-1996.993) * (-1995.285) [-1994.344] (-1995.500) (-1998.277) -- 0:00:25
835000 -- (-1993.365) [-1994.621] (-1994.499) (-1995.124) * (-1994.037) (-1997.726) [-1993.731] (-1995.756) -- 0:00:25
Average standard deviation of split frequencies: 0.000000
835500 -- [-1996.425] (-1997.699) (-1995.742) (-1994.145) * (-1993.698) (-1999.807) (-1995.524) [-1992.016] -- 0:00:25
836000 -- (-1988.673) [-1992.520] (-1995.309) (-1988.394) * [-1993.582] (-1997.075) (-1994.304) (-1993.247) -- 0:00:25
836500 -- (-1993.279) (-1991.978) (-1996.248) [-1989.498] * (-1996.481) (-1994.373) [-1989.265] (-1993.615) -- 0:00:25
837000 -- (-2001.116) [-1994.994] (-2001.573) (-1989.327) * [-1991.467] (-1995.218) (-1995.202) (-1999.823) -- 0:00:25
837500 -- (-1993.075) (-1995.203) [-1997.658] (-1994.099) * (-1992.394) (-1997.664) (-1992.440) [-1992.939] -- 0:00:25
838000 -- (-1995.752) (-1995.094) [-1996.267] (-1995.816) * (-1992.626) (-1997.692) (-1990.751) [-1995.616] -- 0:00:24
838500 -- [-1997.615] (-1992.858) (-2002.907) (-1993.005) * (-1993.220) (-1997.661) [-1998.392] (-1996.102) -- 0:00:24
839000 -- [-1999.859] (-1992.700) (-2000.765) (-1995.398) * [-1997.835] (-1994.071) (-2001.662) (-1995.375) -- 0:00:24
839500 -- (-1994.345) [-1994.807] (-2001.733) (-1994.502) * [-1992.622] (-1993.504) (-1992.123) (-1993.471) -- 0:00:24
840000 -- (-1993.653) [-1995.787] (-1994.829) (-1990.345) * (-1999.470) (-1996.524) (-1994.704) [-1999.233] -- 0:00:24
Average standard deviation of split frequencies: 0.000000
840500 -- [-1997.664] (-1994.025) (-2000.652) (-1992.772) * (-1997.321) (-1995.675) [-1991.530] (-1994.217) -- 0:00:24
841000 -- [-1994.177] (-1995.798) (-1996.253) (-1991.987) * (-1994.119) (-2006.998) (-1994.261) [-1992.007] -- 0:00:24
841500 -- (-1995.233) (-2000.525) [-1997.088] (-2004.963) * [-1993.166] (-2005.864) (-1996.052) (-1994.657) -- 0:00:24
842000 -- (-2000.153) (-2004.857) [-1995.813] (-1994.393) * (-1997.337) (-1999.816) [-1999.338] (-1997.525) -- 0:00:24
842500 -- (-1995.560) (-1997.277) [-1995.298] (-1997.236) * (-1994.634) (-1998.474) [-1998.614] (-1994.323) -- 0:00:24
843000 -- (-1995.417) (-1993.655) [-1999.786] (-1993.946) * (-2000.024) [-1995.474] (-1996.125) (-1997.193) -- 0:00:24
843500 -- [-2003.174] (-1998.119) (-1993.731) (-1999.266) * (-1996.776) (-1998.308) [-1998.664] (-1994.163) -- 0:00:24
844000 -- (-2000.377) (-1993.802) [-1995.758] (-1996.177) * (-1996.124) [-1992.173] (-2000.282) (-1997.109) -- 0:00:24
844500 -- [-2000.310] (-1996.108) (-1995.111) (-1994.117) * (-1990.348) (-1997.299) [-1994.750] (-1994.935) -- 0:00:23
845000 -- (-1998.016) (-1994.539) (-1994.298) [-1991.651] * (-1999.264) (-1997.729) [-1999.600] (-1996.509) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
845500 -- (-1993.341) [-1995.316] (-1994.241) (-1995.304) * (-2005.238) [-1999.308] (-1998.892) (-1994.006) -- 0:00:23
846000 -- (-1999.311) (-1998.997) [-1998.845] (-1993.796) * [-1993.248] (-1999.218) (-1995.590) (-1996.264) -- 0:00:23
846500 -- (-1997.532) (-1995.296) (-1997.792) [-1989.551] * (-1995.343) (-1993.850) (-1994.798) [-1994.287] -- 0:00:23
847000 -- (-1992.594) (-1994.262) (-1995.877) [-1999.624] * (-1998.273) (-1995.324) [-2005.355] (-1997.070) -- 0:00:23
847500 -- (-1993.170) (-1995.189) [-2002.625] (-2002.768) * (-1993.922) (-1998.301) (-1996.160) [-1991.967] -- 0:00:23
848000 -- [-1997.362] (-1997.304) (-1996.940) (-1999.774) * (-2003.444) [-1992.540] (-1997.150) (-1993.621) -- 0:00:23
848500 -- (-1993.210) (-1999.058) (-1991.284) [-1995.094] * (-1992.601) (-2000.874) (-1992.563) [-1992.461] -- 0:00:23
849000 -- (-1994.918) (-1998.469) (-1994.308) [-1989.865] * (-2005.344) [-1993.165] (-1994.429) (-1995.250) -- 0:00:23
849500 -- [-1995.881] (-1996.513) (-1997.550) (-1990.902) * [-1994.291] (-2003.989) (-1999.468) (-2002.408) -- 0:00:23
850000 -- [-1999.229] (-1998.276) (-2001.840) (-1992.675) * (-1992.771) (-1996.649) [-1991.807] (-2000.399) -- 0:00:23
Average standard deviation of split frequencies: 0.000000
850500 -- (-1995.772) (-1997.605) (-1999.438) [-1997.694] * (-1993.614) (-1995.934) (-1992.610) [-1993.748] -- 0:00:23
851000 -- (-2003.054) (-1997.967) [-1996.295] (-1996.460) * (-1996.705) (-1993.427) (-1994.396) [-1996.537] -- 0:00:22
851500 -- (-1992.145) (-1997.624) (-2000.984) [-1999.667] * (-1991.475) (-1998.954) [-1988.775] (-1992.036) -- 0:00:22
852000 -- (-1992.099) (-1994.288) [-1992.079] (-1995.146) * [-1992.308] (-2000.392) (-1992.381) (-2000.991) -- 0:00:22
852500 -- (-1991.660) [-1992.742] (-1994.370) (-1995.587) * (-1993.539) (-1996.463) (-1996.278) [-1989.330] -- 0:00:22
853000 -- [-1997.693] (-1991.802) (-2001.092) (-1998.258) * (-1998.309) (-1993.825) [-1992.689] (-1990.605) -- 0:00:22
853500 -- (-1996.071) (-1997.287) (-1995.745) [-1996.874] * (-2005.726) [-1994.348] (-1997.030) (-1992.635) -- 0:00:22
854000 -- [-1998.929] (-1998.295) (-1991.075) (-1995.775) * (-2006.746) (-1998.768) (-1996.634) [-1998.045] -- 0:00:22
854500 -- (-1993.845) [-1994.207] (-1997.447) (-2009.624) * (-2006.415) (-1995.717) [-1997.642] (-1995.041) -- 0:00:22
855000 -- (-1996.581) (-1997.725) [-1994.915] (-1996.611) * (-1995.304) (-2002.704) (-1998.114) [-1992.748] -- 0:00:22
Average standard deviation of split frequencies: 0.000000
855500 -- (-1994.233) (-1994.045) [-1997.465] (-1993.003) * [-1998.643] (-1996.149) (-2001.326) (-2001.317) -- 0:00:22
856000 -- (-1997.089) (-2001.127) [-1993.765] (-1993.197) * (-1999.091) [-1995.177] (-1996.598) (-1997.707) -- 0:00:22
856500 -- (-1990.584) (-1993.143) (-1991.923) [-1992.778] * (-1995.481) (-1992.447) [-1992.907] (-1999.418) -- 0:00:22
857000 -- [-1993.325] (-1996.117) (-1996.668) (-1995.803) * (-1995.290) [-2002.529] (-1996.804) (-1998.718) -- 0:00:22
857500 -- (-1990.935) [-1992.424] (-1998.138) (-1989.810) * (-1994.604) (-1994.599) (-1995.672) [-1993.557] -- 0:00:21
858000 -- (-1998.666) (-1995.983) (-1993.241) [-1991.196] * [-1992.234] (-1997.669) (-2005.406) (-1998.268) -- 0:00:21
858500 -- [-1998.575] (-1998.139) (-1992.686) (-1996.251) * [-1997.564] (-1996.393) (-1993.564) (-2000.530) -- 0:00:21
859000 -- [-1998.383] (-1997.175) (-1992.342) (-1990.040) * (-1998.229) (-2001.424) (-1996.161) [-1998.868] -- 0:00:21
859500 -- (-1994.565) (-2005.558) [-2002.243] (-1999.908) * (-1995.235) (-1991.895) (-1995.219) [-1992.449] -- 0:00:21
860000 -- [-1995.087] (-1999.301) (-1992.484) (-2003.672) * (-1996.375) (-1997.966) (-1999.148) [-1989.931] -- 0:00:21
Average standard deviation of split frequencies: 0.000000
860500 -- (-1996.350) (-1995.710) [-1992.791] (-1994.280) * [-1995.753] (-1998.724) (-1995.696) (-1994.660) -- 0:00:21
861000 -- [-1998.826] (-2005.445) (-1996.667) (-1996.361) * (-1999.976) [-1992.601] (-1994.118) (-1993.982) -- 0:00:21
861500 -- [-1993.564] (-1996.405) (-1996.669) (-2005.192) * (-1996.174) (-1994.415) [-1988.573] (-1994.962) -- 0:00:21
862000 -- (-2003.665) [-1995.276] (-2005.061) (-2004.166) * (-1996.199) (-1991.587) [-1993.067] (-1996.693) -- 0:00:21
862500 -- (-2006.947) [-1997.998] (-1995.206) (-1995.390) * (-2007.005) (-1991.551) [-1992.591] (-2000.289) -- 0:00:21
863000 -- (-1997.864) [-1998.509] (-1993.135) (-2000.238) * (-1996.298) (-1999.510) [-1993.866] (-2011.519) -- 0:00:21
863500 -- (-1991.257) [-1991.718] (-1997.728) (-1997.825) * (-1995.197) (-1995.865) [-1991.670] (-1998.764) -- 0:00:21
864000 -- [-1994.988] (-1994.438) (-1994.365) (-1995.718) * (-1994.629) (-1994.292) [-1996.213] (-1999.209) -- 0:00:20
864500 -- (-2001.198) (-1998.234) (-1995.502) [-1993.118] * (-1993.409) (-1994.177) (-1998.102) [-1995.309] -- 0:00:20
865000 -- (-2001.564) (-1995.775) (-1994.413) [-1992.991] * (-2003.912) [-1994.822] (-1994.494) (-1991.787) -- 0:00:20
Average standard deviation of split frequencies: 0.000000
865500 -- (-1999.966) [-1991.184] (-1996.558) (-1993.314) * [-1993.833] (-1996.789) (-2000.010) (-1991.062) -- 0:00:20
866000 -- (-1994.305) [-1988.672] (-1993.680) (-1996.298) * [-1996.284] (-1998.096) (-2004.666) (-1994.582) -- 0:00:20
866500 -- [-1991.966] (-1994.027) (-2000.147) (-1994.516) * (-1990.704) (-2000.320) [-1999.605] (-1995.036) -- 0:00:20
867000 -- (-1993.048) (-1997.025) (-1997.905) [-1992.323] * (-1992.056) (-2000.418) [-2001.574] (-1994.596) -- 0:00:20
867500 -- [-1998.459] (-1995.632) (-1994.802) (-1989.017) * (-2000.225) [-1998.964] (-1996.918) (-1999.639) -- 0:00:20
868000 -- (-1993.730) (-1998.312) (-1993.456) [-2001.796] * [-1994.041] (-1996.657) (-1993.913) (-2001.497) -- 0:00:20
868500 -- (-1992.967) [-1998.372] (-2003.073) (-1995.628) * [-1990.909] (-2007.087) (-1996.649) (-1993.311) -- 0:00:20
869000 -- (-2006.320) [-1996.791] (-1995.798) (-2000.915) * (-1995.526) (-1999.958) [-1992.282] (-1993.715) -- 0:00:20
869500 -- (-1997.900) [-1988.918] (-1999.201) (-1993.283) * [-1992.235] (-1996.914) (-2004.263) (-1998.190) -- 0:00:20
870000 -- (-1995.275) [-1992.138] (-1997.615) (-1996.729) * (-2004.407) (-2004.834) (-1996.005) [-2001.060] -- 0:00:20
Average standard deviation of split frequencies: 0.000000
870500 -- [-1997.157] (-1999.825) (-1992.767) (-1995.200) * (-1993.730) [-1995.775] (-1997.415) (-1996.683) -- 0:00:19
871000 -- (-1994.555) (-1997.991) (-1998.865) [-1994.804] * [-1993.143] (-1997.414) (-2001.249) (-1998.730) -- 0:00:19
871500 -- [-1991.624] (-1996.410) (-1993.269) (-1995.689) * (-1997.056) [-1996.979] (-1989.939) (-1996.566) -- 0:00:19
872000 -- (-2000.268) (-1991.090) [-1993.999] (-1996.680) * (-2000.153) [-1999.772] (-1995.604) (-1997.026) -- 0:00:19
872500 -- (-1992.951) (-1997.411) [-1999.341] (-1993.164) * (-1996.054) (-1994.795) [-1996.653] (-1993.087) -- 0:00:19
873000 -- (-1995.375) [-1999.824] (-1992.899) (-1997.013) * (-1993.695) (-1993.669) (-2002.895) [-1996.153] -- 0:00:19
873500 -- (-1996.192) (-1991.918) (-1998.968) [-1991.989] * (-1992.577) (-1997.651) (-1997.446) [-1992.944] -- 0:00:19
874000 -- (-1992.505) (-1998.242) (-1993.444) [-1997.497] * (-1995.241) (-1996.819) (-1996.161) [-2000.801] -- 0:00:19
874500 -- (-1991.764) (-1997.236) [-1994.336] (-1997.090) * [-1998.020] (-1995.143) (-1993.702) (-2003.400) -- 0:00:19
875000 -- [-2001.235] (-1994.720) (-2001.308) (-1995.932) * (-1998.277) (-2004.341) (-1987.884) [-2001.931] -- 0:00:19
Average standard deviation of split frequencies: 0.000000
875500 -- (-1993.377) [-1992.181] (-1996.107) (-1999.024) * (-1991.232) (-1999.742) [-1997.385] (-1996.961) -- 0:00:19
876000 -- (-1994.612) (-1997.737) [-1994.083] (-1999.234) * (-2003.580) (-1995.857) [-1998.528] (-1996.798) -- 0:00:19
876500 -- (-1989.826) (-1994.089) (-1993.339) [-1992.125] * (-1999.215) (-1999.153) (-2005.060) [-2001.515] -- 0:00:19
877000 -- (-1992.086) (-1998.572) [-1995.069] (-1996.487) * (-1997.513) (-1994.942) [-1996.767] (-2000.202) -- 0:00:18
877500 -- [-1999.137] (-1997.342) (-1991.938) (-1997.294) * (-1994.904) (-1997.934) (-2003.671) [-1996.300] -- 0:00:18
878000 -- (-1992.799) (-2002.310) (-2001.404) [-1994.811] * (-1994.545) (-1995.795) (-1996.890) [-1994.572] -- 0:00:18
878500 -- (-1993.311) (-1992.576) (-2001.390) [-1997.598] * (-1997.428) [-1993.660] (-2002.440) (-1994.373) -- 0:00:18
879000 -- (-1995.832) (-1998.948) (-1999.451) [-1994.610] * [-1990.350] (-1995.003) (-2001.685) (-1995.240) -- 0:00:18
879500 -- (-1997.508) (-1995.823) (-1995.334) [-1990.996] * (-2000.028) (-1997.303) [-1996.550] (-1996.357) -- 0:00:18
880000 -- (-1992.830) (-2003.036) (-1999.132) [-1989.161] * [-1998.564] (-1993.093) (-2004.205) (-1994.750) -- 0:00:18
Average standard deviation of split frequencies: 0.000000
880500 -- (-1995.153) (-1997.546) (-1992.475) [-1997.378] * [-1990.454] (-2000.806) (-1996.065) (-2000.749) -- 0:00:18
881000 -- [-1994.481] (-1995.522) (-1998.015) (-1999.011) * (-1991.437) (-1994.793) [-1994.681] (-2000.765) -- 0:00:18
881500 -- (-1999.003) (-1991.149) [-1991.774] (-1992.084) * [-1995.646] (-1999.217) (-1996.836) (-1995.807) -- 0:00:18
882000 -- (-2002.342) [-1988.799] (-1996.474) (-2000.445) * (-2003.390) (-2001.031) [-1992.527] (-1995.178) -- 0:00:18
882500 -- (-1993.727) (-1998.882) [-1993.940] (-1993.097) * (-2003.144) (-1993.310) (-1991.483) [-2001.894] -- 0:00:18
883000 -- [-1994.318] (-1996.795) (-2002.287) (-1992.830) * (-1995.642) (-2006.926) [-1993.144] (-1995.623) -- 0:00:18
883500 -- (-1998.090) [-1990.780] (-1992.336) (-1997.514) * (-1991.457) (-2000.455) (-1991.895) [-1994.078] -- 0:00:17
884000 -- (-1990.964) [-1999.337] (-1993.062) (-1993.928) * (-1994.237) [-1996.379] (-1998.669) (-1995.655) -- 0:00:17
884500 -- (-1996.824) [-1993.173] (-1998.975) (-1996.711) * [-2000.777] (-1992.857) (-1995.094) (-1996.098) -- 0:00:17
885000 -- [-1992.214] (-1996.139) (-1999.335) (-1998.017) * (-1994.709) [-1992.396] (-1996.121) (-1997.533) -- 0:00:17
Average standard deviation of split frequencies: 0.000000
885500 -- [-1990.726] (-1997.632) (-2000.667) (-1996.956) * (-1997.230) (-1996.854) (-2006.837) [-1996.699] -- 0:00:17
886000 -- (-1995.675) (-1995.185) [-1994.881] (-1998.680) * [-1997.661] (-1993.116) (-1995.445) (-1997.055) -- 0:00:17
886500 -- (-1998.854) [-1992.488] (-1996.973) (-1996.230) * (-1994.012) (-1992.680) (-1993.807) [-2003.905] -- 0:00:17
887000 -- (-1994.295) (-1995.080) [-1993.129] (-2007.747) * (-1993.640) [-1992.128] (-1993.385) (-1997.480) -- 0:00:17
887500 -- (-2000.491) (-1992.101) (-1993.464) [-1995.036] * (-1995.732) (-1999.879) [-1997.650] (-1996.509) -- 0:00:17
888000 -- [-1996.905] (-1992.587) (-2005.552) (-1992.093) * (-1990.180) (-2001.166) [-1993.267] (-1990.870) -- 0:00:17
888500 -- (-1998.710) (-1996.440) [-1996.340] (-1998.314) * [-1998.960] (-1998.789) (-1995.702) (-1996.292) -- 0:00:17
889000 -- (-2001.770) (-1992.367) (-1999.163) [-1993.916] * (-2001.967) (-1996.043) [-1995.860] (-1999.521) -- 0:00:17
889500 -- (-1993.481) (-1992.030) (-1996.462) [-1998.504] * (-2012.308) [-1999.744] (-1999.062) (-1997.355) -- 0:00:17
890000 -- [-2002.822] (-2004.447) (-1996.947) (-2001.489) * (-2000.591) [-1997.387] (-1994.254) (-1995.834) -- 0:00:16
Average standard deviation of split frequencies: 0.000000
890500 -- [-1997.055] (-2001.748) (-1993.602) (-2006.754) * (-1992.951) (-1997.873) [-2000.557] (-1994.592) -- 0:00:16
891000 -- (-2001.144) (-1995.285) (-2000.739) [-1999.078] * (-1996.220) (-1995.954) (-1994.819) [-1993.300] -- 0:00:16
891500 -- [-1993.647] (-1996.935) (-1999.771) (-1992.665) * (-1993.279) [-1997.941] (-1994.438) (-1992.463) -- 0:00:16
892000 -- (-1994.328) (-1995.431) [-1995.351] (-1992.407) * [-1994.193] (-1998.423) (-1995.784) (-1993.585) -- 0:00:16
892500 -- [-1997.157] (-2001.652) (-1995.963) (-1989.743) * (-1992.219) (-1989.186) (-1991.923) [-1992.660] -- 0:00:16
893000 -- (-1998.920) (-1997.599) (-1997.885) [-1991.109] * (-1997.400) (-1991.978) [-1992.042] (-1995.020) -- 0:00:16
893500 -- (-2002.277) (-1993.296) (-1990.829) [-1993.694] * (-1994.882) (-1999.968) [-1999.064] (-1989.775) -- 0:00:16
894000 -- (-1996.817) (-1991.969) [-1992.721] (-2000.273) * [-1996.374] (-1993.185) (-1995.811) (-1997.918) -- 0:00:16
894500 -- [-2001.239] (-1994.033) (-1996.348) (-2001.540) * (-1996.121) (-1989.270) [-1996.654] (-1992.281) -- 0:00:16
895000 -- [-1993.126] (-1991.409) (-1993.699) (-1997.137) * (-1999.508) (-1995.974) [-1996.077] (-1992.265) -- 0:00:16
Average standard deviation of split frequencies: 0.000000
895500 -- [-1994.620] (-1994.074) (-1998.647) (-1999.329) * (-1994.263) (-1992.780) (-1996.164) [-1992.602] -- 0:00:16
896000 -- (-2006.100) [-1993.847] (-1997.921) (-1999.688) * (-1996.468) (-1992.614) [-1992.384] (-1993.619) -- 0:00:16
896500 -- (-1995.853) [-1999.172] (-1995.894) (-1998.902) * [-1995.546] (-1998.559) (-2003.212) (-2001.259) -- 0:00:15
897000 -- [-1996.628] (-1999.591) (-1995.359) (-1999.951) * (-1996.163) [-1997.836] (-1996.886) (-1998.920) -- 0:00:15
897500 -- (-1995.868) (-1995.048) (-1993.114) [-1997.269] * (-2003.003) (-1997.355) [-1993.294] (-1999.297) -- 0:00:15
898000 -- [-1993.995] (-2004.098) (-2003.249) (-1997.820) * (-1997.417) [-1995.279] (-1994.788) (-1994.558) -- 0:00:15
898500 -- [-1994.568] (-2003.426) (-1994.578) (-1991.771) * (-2001.624) (-1996.139) (-1990.593) [-1994.222] -- 0:00:15
899000 -- [-1995.571] (-1997.712) (-2004.447) (-1990.618) * (-1996.804) (-1993.146) [-1991.890] (-2001.483) -- 0:00:15
899500 -- (-1990.227) (-1996.100) (-2000.607) [-1991.500] * (-1995.105) (-2000.110) [-1996.530] (-1991.507) -- 0:00:15
900000 -- [-1992.104] (-1995.387) (-1995.909) (-1992.489) * (-1992.310) [-1997.213] (-1996.064) (-1996.402) -- 0:00:15
Average standard deviation of split frequencies: 0.000000
900500 -- (-1995.100) (-2002.433) (-1995.838) [-1992.111] * [-1996.989] (-1991.051) (-1994.448) (-1993.137) -- 0:00:15
901000 -- [-1991.829] (-1997.681) (-1996.363) (-2003.826) * (-2000.447) [-1994.599] (-1995.189) (-1990.438) -- 0:00:15
901500 -- (-1995.853) (-1993.929) [-1998.469] (-1993.366) * (-2002.854) (-1996.407) [-1993.354] (-1992.030) -- 0:00:15
902000 -- (-1996.853) (-2003.584) (-1997.576) [-1991.766] * (-1996.275) (-1992.272) [-1994.844] (-1993.673) -- 0:00:15
902500 -- (-1995.746) [-2002.593] (-1995.242) (-1997.681) * [-1996.344] (-1995.366) (-1996.116) (-1994.640) -- 0:00:15
903000 -- (-1994.590) (-2002.533) (-1994.822) [-1992.755] * [-1992.507] (-1999.047) (-1992.119) (-1995.547) -- 0:00:14
903500 -- (-1993.931) (-1992.757) (-1999.936) [-1995.274] * (-1998.467) (-2001.632) (-1994.423) [-1994.129] -- 0:00:14
904000 -- (-1997.339) (-1995.807) [-1992.335] (-1994.474) * (-2000.298) (-1994.751) [-1995.402] (-1999.707) -- 0:00:14
904500 -- (-1994.831) (-1993.164) [-1993.478] (-1992.448) * (-1996.669) (-1992.785) (-1995.615) [-2003.947] -- 0:00:14
905000 -- (-1993.679) [-1994.846] (-1994.920) (-1992.596) * (-1999.521) [-1999.165] (-1998.528) (-2002.461) -- 0:00:14
Average standard deviation of split frequencies: 0.000000
905500 -- [-1994.447] (-1992.488) (-1994.624) (-1994.074) * (-1998.634) (-1994.659) [-1994.964] (-1994.293) -- 0:00:14
906000 -- (-1998.583) (-1998.294) (-1989.968) [-1994.897] * [-1996.454] (-1993.234) (-1995.610) (-1991.329) -- 0:00:14
906500 -- (-1994.242) [-1998.813] (-1998.472) (-1995.863) * (-1997.975) (-1991.644) [-1994.986] (-1992.848) -- 0:00:14
907000 -- (-1996.137) (-1998.345) (-1994.611) [-1991.523] * [-1993.429] (-1993.451) (-1994.547) (-1994.401) -- 0:00:14
907500 -- (-1996.237) (-1996.264) (-1991.641) [-1991.695] * (-2000.040) (-1990.710) [-2004.311] (-1994.911) -- 0:00:14
908000 -- (-1996.076) (-1995.515) [-1991.260] (-1994.101) * (-1992.060) (-1993.537) (-1994.985) [-1991.443] -- 0:00:14
908500 -- (-1997.319) [-1993.205] (-1991.362) (-1992.485) * (-1996.306) [-1996.155] (-1993.919) (-1995.321) -- 0:00:14
909000 -- (-2002.462) (-1995.016) [-1993.908] (-2007.504) * [-1991.090] (-1992.184) (-2000.452) (-1993.822) -- 0:00:14
909500 -- (-1989.940) [-1994.995] (-1998.395) (-1994.652) * (-1990.741) (-2001.195) [-1992.785] (-1990.460) -- 0:00:13
910000 -- (-1993.008) (-1991.104) [-1997.405] (-2007.498) * (-1996.365) (-1997.157) [-1998.609] (-2001.224) -- 0:00:13
Average standard deviation of split frequencies: 0.000000
910500 -- [-1990.812] (-1993.863) (-1997.867) (-1995.155) * (-1994.684) (-2000.187) (-1997.258) [-1990.684] -- 0:00:13
911000 -- (-1994.232) (-1999.615) [-1992.027] (-1996.340) * (-1993.835) [-1996.648] (-1995.685) (-1991.498) -- 0:00:13
911500 -- (-1991.751) (-1994.151) [-1991.477] (-2000.511) * (-1994.754) (-2002.218) [-1994.275] (-1990.515) -- 0:00:13
912000 -- (-1995.478) (-1994.173) (-1989.736) [-1993.925] * (-1997.186) (-2001.658) [-1994.727] (-1997.093) -- 0:00:13
912500 -- [-1992.443] (-1998.103) (-1994.956) (-1993.158) * (-1999.880) (-2002.267) (-1996.987) [-1995.930] -- 0:00:13
913000 -- [-1993.712] (-1994.805) (-1993.355) (-1994.595) * (-2003.709) [-1992.707] (-1996.430) (-1993.047) -- 0:00:13
913500 -- (-1996.605) (-1996.006) [-1992.457] (-1998.571) * (-1992.786) [-1993.046] (-1996.589) (-2005.691) -- 0:00:13
914000 -- (-1999.346) [-1999.576] (-1997.291) (-1992.804) * [-1991.633] (-1995.371) (-1998.382) (-1998.476) -- 0:00:13
914500 -- (-1992.701) (-1991.613) [-1990.738] (-1995.149) * (-1995.484) (-1999.258) [-1995.931] (-1998.791) -- 0:00:13
915000 -- (-1994.744) (-2004.463) (-1993.256) [-1994.828] * [-1993.282] (-1991.568) (-1995.459) (-1994.906) -- 0:00:13
Average standard deviation of split frequencies: 0.000000
915500 -- (-1992.707) (-2004.112) (-1996.419) [-1996.158] * [-1998.247] (-1991.702) (-1991.369) (-2000.460) -- 0:00:13
916000 -- (-1993.263) (-2002.145) [-1996.048] (-2001.727) * (-2009.001) (-2001.493) [-1997.988] (-1991.521) -- 0:00:12
916500 -- (-1995.890) (-1997.548) (-1998.531) [-1995.860] * (-1995.326) (-1999.511) (-1996.794) [-1992.503] -- 0:00:12
917000 -- (-1998.490) [-1997.293] (-1995.330) (-2002.855) * (-2004.681) (-1996.130) [-1994.716] (-1993.463) -- 0:00:12
917500 -- (-1994.577) (-1992.403) (-1994.790) [-1995.740] * (-1999.154) (-1995.404) [-1995.401] (-1991.777) -- 0:00:12
918000 -- (-1997.577) (-1991.791) [-1991.377] (-1998.791) * (-2003.527) [-1994.624] (-1997.372) (-1992.800) -- 0:00:12
918500 -- (-1996.709) (-1999.796) (-1999.225) [-1994.661] * (-1996.311) [-1999.145] (-1993.729) (-1990.631) -- 0:00:12
919000 -- (-1999.712) (-1989.889) [-1994.659] (-1992.031) * (-1991.403) [-1994.599] (-1997.320) (-1996.172) -- 0:00:12
919500 -- (-1999.126) (-1992.095) [-1995.027] (-2001.296) * (-1999.138) (-1996.156) (-1998.811) [-1993.730] -- 0:00:12
920000 -- (-1998.765) (-1994.892) [-1997.329] (-1993.777) * (-1998.113) [-1998.020] (-1995.045) (-1995.042) -- 0:00:12
Average standard deviation of split frequencies: 0.000000
920500 -- (-1995.591) (-2001.330) (-1997.583) [-1990.688] * (-2000.698) (-1994.220) (-1993.161) [-1990.569] -- 0:00:12
921000 -- [-1993.188] (-1997.348) (-1998.226) (-1995.675) * (-2000.355) (-2002.044) (-1997.564) [-1994.157] -- 0:00:12
921500 -- (-1996.199) [-1996.059] (-2001.867) (-1995.401) * (-1994.338) [-1996.730] (-1992.960) (-1995.643) -- 0:00:12
922000 -- (-1994.203) [-1998.685] (-2000.198) (-1994.900) * (-1997.601) [-1998.216] (-1992.235) (-1997.057) -- 0:00:12
922500 -- [-1989.263] (-1994.324) (-1999.580) (-1992.370) * (-1998.917) (-1991.607) [-1994.399] (-1995.738) -- 0:00:11
923000 -- (-1990.596) [-1994.831] (-1995.759) (-1997.029) * (-1998.713) (-1995.742) [-2003.624] (-1994.163) -- 0:00:11
923500 -- (-1992.275) (-1994.155) [-1994.199] (-1997.562) * [-1996.497] (-1990.002) (-1995.770) (-1999.258) -- 0:00:11
924000 -- (-1996.778) [-1997.590] (-1992.390) (-1992.298) * (-1997.809) (-1993.881) (-1994.474) [-1995.060] -- 0:00:11
924500 -- (-1995.201) (-1993.584) (-2000.191) [-1995.881] * (-1995.127) (-2004.982) [-1997.573] (-1995.313) -- 0:00:11
925000 -- (-2001.208) [-1996.161] (-1993.066) (-1999.141) * (-1993.399) (-1995.571) [-1991.005] (-1992.845) -- 0:00:11
Average standard deviation of split frequencies: 0.000000
925500 -- (-1995.578) [-1991.097] (-1992.631) (-1995.157) * (-2005.634) (-1997.846) (-2000.252) [-1991.011] -- 0:00:11
926000 -- (-1991.111) (-1993.796) (-1998.235) [-1996.307] * (-1996.969) (-1996.052) [-1991.036] (-1996.924) -- 0:00:11
926500 -- (-1991.900) (-1996.941) (-1990.715) [-1994.379] * (-2003.565) (-2003.206) (-2000.286) [-2001.833] -- 0:00:11
927000 -- (-1991.913) (-2001.304) [-1994.217] (-2000.106) * (-1999.592) (-1996.383) [-1993.950] (-1993.017) -- 0:00:11
927500 -- (-1994.381) (-1998.921) [-1994.030] (-1993.640) * (-2011.589) (-1996.901) (-1992.375) [-1990.706] -- 0:00:11
928000 -- (-1996.285) (-1991.365) [-1993.424] (-1994.164) * (-1995.547) (-1994.879) (-1991.290) [-1994.820] -- 0:00:11
928500 -- (-1992.765) [-1992.309] (-1990.973) (-1996.608) * (-1995.066) [-1991.793] (-1999.526) (-1998.034) -- 0:00:11
929000 -- [-1989.275] (-1995.024) (-1998.200) (-1991.867) * (-2003.696) [-1991.021] (-1999.332) (-1993.751) -- 0:00:10
929500 -- (-1996.280) (-1996.147) [-1989.695] (-1997.709) * [-1990.715] (-1991.867) (-1993.147) (-1996.031) -- 0:00:10
930000 -- [-1994.120] (-1992.510) (-1990.518) (-1995.440) * (-1995.833) [-1995.865] (-1989.843) (-1991.580) -- 0:00:10
Average standard deviation of split frequencies: 0.000000
930500 -- (-1995.157) (-1998.305) (-1991.899) [-1996.390] * (-1993.208) (-1994.360) (-1995.147) [-1998.260] -- 0:00:10
931000 -- (-1998.908) (-1994.243) (-1995.434) [-1996.660] * (-1993.402) (-1994.549) (-1993.774) [-1991.795] -- 0:00:10
931500 -- (-1996.435) [-1992.927] (-1995.083) (-1999.708) * (-1994.314) (-1997.883) (-2001.418) [-1994.675] -- 0:00:10
932000 -- (-1995.607) (-1993.382) [-1991.108] (-1998.398) * (-1989.278) (-1998.997) [-1994.284] (-1997.045) -- 0:00:10
932500 -- [-1992.220] (-1996.312) (-2001.114) (-1994.049) * (-1994.350) (-1995.033) (-2000.236) [-1991.343] -- 0:00:10
933000 -- [-1993.425] (-1990.163) (-1998.121) (-2005.470) * [-1997.816] (-1998.792) (-1992.004) (-1991.618) -- 0:00:10
933500 -- (-1995.678) (-1990.925) (-2000.696) [-1998.467] * [-1993.037] (-2000.985) (-1997.452) (-1988.730) -- 0:00:10
934000 -- (-1998.942) (-1996.781) (-1995.253) [-1999.644] * (-1990.490) [-2001.560] (-1999.717) (-1992.320) -- 0:00:10
934500 -- [-1992.376] (-1993.628) (-1999.098) (-1990.445) * (-1993.736) (-1994.964) (-2004.631) [-1989.629] -- 0:00:10
935000 -- (-1994.426) [-1998.535] (-1997.065) (-2000.521) * (-1998.204) (-1996.582) (-1992.508) [-1991.678] -- 0:00:10
Average standard deviation of split frequencies: 0.000000
935500 -- (-1992.847) (-2001.524) (-1991.474) [-1997.845] * (-1995.157) (-1995.128) [-1991.391] (-1993.148) -- 0:00:09
936000 -- (-2002.535) (-2001.158) (-1992.187) [-1994.320] * (-1994.437) [-1995.768] (-1993.797) (-1999.857) -- 0:00:09
936500 -- (-1997.907) (-1993.417) (-1997.546) [-1997.909] * (-1992.815) (-1997.404) (-1999.600) [-1994.725] -- 0:00:09
937000 -- (-1996.337) (-1989.926) [-1993.736] (-1989.041) * (-1999.253) (-2005.046) [-1996.320] (-2001.656) -- 0:00:09
937500 -- (-1992.206) (-1999.322) (-1997.936) [-1990.410] * [-1998.283] (-1999.272) (-1997.068) (-1997.010) -- 0:00:09
938000 -- (-2001.346) [-1998.444] (-1997.136) (-1998.877) * (-1996.215) (-1991.373) [-1995.844] (-1995.975) -- 0:00:09
938500 -- (-1997.587) (-1999.116) (-1992.278) [-1994.435] * (-2001.934) (-1994.396) (-1998.531) [-1992.592] -- 0:00:09
939000 -- [-1993.091] (-1994.186) (-2000.248) (-1995.724) * (-2007.134) [-1991.535] (-1994.611) (-1999.832) -- 0:00:09
939500 -- (-1996.950) [-2002.334] (-1995.328) (-1994.001) * (-1996.935) (-2000.717) [-1989.400] (-1998.746) -- 0:00:09
940000 -- [-1993.656] (-1990.648) (-1991.605) (-2000.244) * (-1996.732) (-1995.691) (-1999.209) [-1997.238] -- 0:00:09
Average standard deviation of split frequencies: 0.000000
940500 -- [-1992.892] (-1996.467) (-1992.411) (-1997.599) * [-1990.374] (-1992.744) (-1995.696) (-1993.818) -- 0:00:09
941000 -- [-2000.569] (-1996.017) (-1994.018) (-1993.763) * (-1991.164) (-1994.041) (-1998.525) [-1996.575] -- 0:00:09
941500 -- (-1993.159) [-1993.550] (-1999.169) (-1999.089) * [-1995.771] (-1991.097) (-1995.029) (-1994.337) -- 0:00:09
942000 -- (-1997.655) [-1992.079] (-1990.675) (-1993.637) * (-1990.727) (-1991.436) (-1998.035) [-1994.595] -- 0:00:08
942500 -- (-1995.375) [-1997.048] (-1997.216) (-2000.354) * (-1992.084) (-1998.688) [-1995.681] (-1993.956) -- 0:00:08
943000 -- [-1991.686] (-2003.708) (-1995.407) (-1994.754) * (-1994.328) (-1991.688) (-1998.197) [-1991.829] -- 0:00:08
943500 -- [-1998.002] (-1993.033) (-2002.301) (-1993.007) * (-2002.901) (-2000.756) (-1995.160) [-1991.947] -- 0:00:08
944000 -- (-1994.973) [-1995.042] (-2000.638) (-1997.869) * [-1995.483] (-1993.727) (-2002.082) (-1996.135) -- 0:00:08
944500 -- (-1990.751) [-1996.704] (-1995.290) (-1996.709) * (-2004.045) (-1999.651) [-1998.485] (-1993.871) -- 0:00:08
945000 -- (-1992.496) [-1992.737] (-1999.025) (-2002.483) * (-2000.691) (-1996.656) (-2002.183) [-1994.068] -- 0:00:08
Average standard deviation of split frequencies: 0.000000
945500 -- (-1993.073) (-1994.100) [-1994.562] (-2003.812) * (-1995.385) [-1990.062] (-2002.799) (-2000.632) -- 0:00:08
946000 -- (-1994.591) (-1997.982) [-1993.403] (-1996.611) * (-1992.751) [-1991.434] (-1994.472) (-1997.998) -- 0:00:08
946500 -- [-1999.737] (-1993.194) (-1990.319) (-1993.690) * [-1992.557] (-1997.811) (-1998.637) (-1994.270) -- 0:00:08
947000 -- (-1994.174) (-1995.540) (-2001.827) [-1999.218] * (-1995.106) (-1995.187) [-1996.772] (-1989.553) -- 0:00:08
947500 -- (-2000.109) [-1993.972] (-2001.476) (-1993.553) * (-1993.035) [-1996.556] (-2003.674) (-1995.972) -- 0:00:08
948000 -- (-1998.201) (-1994.709) [-1992.302] (-1997.163) * (-1991.313) (-1996.095) (-1999.221) [-2001.738] -- 0:00:08
948500 -- [-1993.233] (-1998.688) (-1999.940) (-1990.361) * [-1992.961] (-1993.111) (-1997.230) (-1995.061) -- 0:00:07
949000 -- [-1998.101] (-1997.745) (-1997.435) (-1997.708) * (-2000.649) [-1996.243] (-2009.142) (-1995.825) -- 0:00:07
949500 -- (-1996.167) (-1996.658) (-1993.347) [-1991.260] * (-2002.867) [-1996.089] (-1993.979) (-1997.078) -- 0:00:07
950000 -- [-2000.121] (-1999.007) (-1996.216) (-2002.175) * (-2005.987) [-1997.527] (-1998.371) (-1992.761) -- 0:00:07
Average standard deviation of split frequencies: 0.000000
950500 -- (-1995.382) (-1990.478) [-1993.868] (-1993.627) * (-2000.013) (-1990.725) [-1993.393] (-1997.172) -- 0:00:07
951000 -- (-1992.042) (-1999.179) (-1992.364) [-1996.611] * (-2009.312) (-1994.403) (-1996.954) [-1996.057] -- 0:00:07
951500 -- [-2000.671] (-2004.664) (-1992.976) (-1992.659) * (-1999.558) (-1992.342) [-1992.883] (-1994.888) -- 0:00:07
952000 -- (-2005.452) [-2006.324] (-1994.465) (-1994.280) * (-1995.552) (-1997.510) [-1994.687] (-1995.827) -- 0:00:07
952500 -- (-1993.350) [-1997.092] (-1994.951) (-1995.396) * [-1992.762] (-1993.955) (-1995.049) (-1998.061) -- 0:00:07
953000 -- [-1999.447] (-1994.686) (-1998.015) (-1993.169) * (-1997.294) (-1998.712) (-1994.427) [-1990.241] -- 0:00:07
953500 -- (-1992.921) (-1993.220) [-2002.222] (-1995.954) * (-1992.079) (-1993.235) (-1991.044) [-1994.771] -- 0:00:07
954000 -- (-1991.877) (-1992.899) (-1992.587) [-1993.853] * (-1999.024) [-1995.194] (-1997.974) (-1995.975) -- 0:00:07
954500 -- (-1996.205) (-1998.377) (-1993.387) [-1993.140] * (-1995.082) (-1996.607) (-1995.544) [-1995.557] -- 0:00:07
955000 -- (-1995.015) [-1994.900] (-1994.904) (-1995.304) * [-1991.540] (-1994.239) (-1992.912) (-2002.124) -- 0:00:06
Average standard deviation of split frequencies: 0.000000
955500 -- (-1998.747) [-1995.158] (-2003.154) (-2003.774) * (-2000.758) (-1997.067) [-1997.235] (-2001.337) -- 0:00:06
956000 -- (-1991.855) [-1996.598] (-2001.383) (-1994.503) * (-1999.274) (-1992.486) (-1994.807) [-1998.043] -- 0:00:06
956500 -- (-1993.434) [-1995.828] (-1998.167) (-1994.375) * [-1993.677] (-2000.032) (-2001.687) (-1994.317) -- 0:00:06
957000 -- (-1998.149) [-1995.497] (-1995.290) (-1994.857) * (-2001.518) [-1997.748] (-1994.236) (-1999.111) -- 0:00:06
957500 -- (-1995.543) [-2000.549] (-1998.809) (-2000.354) * (-1991.369) [-1995.715] (-1995.357) (-1990.973) -- 0:00:06
958000 -- (-1994.209) (-1993.697) (-1993.442) [-1995.729] * (-1991.922) (-1992.147) [-1997.599] (-1997.796) -- 0:00:06
958500 -- (-1991.654) (-1994.132) [-1998.967] (-1993.881) * (-1990.311) (-1995.250) [-1988.895] (-1993.171) -- 0:00:06
959000 -- [-1993.876] (-2000.543) (-1992.386) (-1999.134) * (-1988.860) (-1992.533) (-1996.726) [-1992.519] -- 0:00:06
959500 -- (-1995.764) (-1994.764) [-2000.800] (-1993.030) * [-1998.251] (-1992.215) (-1994.830) (-1995.877) -- 0:00:06
960000 -- [-1993.054] (-1995.327) (-1998.434) (-1994.472) * (-1999.296) (-1994.597) (-1996.072) [-1995.930] -- 0:00:06
Average standard deviation of split frequencies: 0.000000
960500 -- (-1996.207) (-2000.286) [-1993.702] (-1999.044) * [-1991.977] (-1992.036) (-1987.450) (-1991.489) -- 0:00:06
961000 -- [-1999.052] (-1991.102) (-2000.316) (-1999.268) * [-1993.333] (-1992.360) (-1992.809) (-1996.329) -- 0:00:06
961500 -- (-1991.622) (-1998.378) [-1995.117] (-1998.823) * (-1994.645) (-1996.674) (-1998.179) [-1997.499] -- 0:00:05
962000 -- (-1995.012) (-1995.857) [-1995.770] (-2002.795) * [-1991.922] (-1993.756) (-1997.982) (-1995.250) -- 0:00:05
962500 -- (-1993.064) [-1994.331] (-1997.249) (-2001.216) * [-1992.552] (-2001.742) (-1992.884) (-1998.542) -- 0:00:05
963000 -- (-1991.135) (-1998.881) [-1992.789] (-1990.811) * (-1991.677) (-1994.471) [-1996.222] (-1993.182) -- 0:00:05
963500 -- (-1994.275) [-2003.188] (-1992.714) (-1997.308) * (-1997.600) (-1996.688) (-1993.507) [-1996.013] -- 0:00:05
964000 -- [-1993.512] (-2001.679) (-1992.451) (-1997.035) * (-1995.543) [-1994.880] (-1999.744) (-2003.529) -- 0:00:05
964500 -- [-1995.704] (-1996.516) (-1996.093) (-2000.980) * [-1994.897] (-1993.203) (-2001.983) (-2004.854) -- 0:00:05
965000 -- (-1998.381) (-1995.100) [-2001.753] (-1997.756) * (-1998.509) (-1997.524) [-1993.747] (-1997.316) -- 0:00:05
Average standard deviation of split frequencies: 0.000000
965500 -- (-1997.728) [-2002.696] (-1996.613) (-1998.000) * (-2000.033) (-1997.431) [-1995.336] (-2000.269) -- 0:00:05
966000 -- (-1995.166) (-1998.167) [-1989.288] (-1998.619) * (-2000.403) [-1996.401] (-1998.739) (-1992.831) -- 0:00:05
966500 -- (-1997.648) (-1996.016) (-1996.689) [-1996.510] * (-1993.185) (-1998.614) (-1993.315) [-1996.866] -- 0:00:05
967000 -- (-1992.627) (-2001.891) (-1997.510) [-2001.097] * (-1996.322) (-1988.619) [-1989.834] (-1999.667) -- 0:00:05
967500 -- (-1995.215) [-1994.966] (-1993.047) (-2001.813) * (-1995.175) (-1998.645) (-1995.029) [-1995.665] -- 0:00:05
968000 -- [-1993.628] (-1995.432) (-1998.156) (-1992.071) * (-1993.979) (-2000.528) (-1996.514) [-1993.508] -- 0:00:04
968500 -- (-1994.476) (-2001.663) (-1997.230) [-1992.997] * [-1992.924] (-1994.430) (-2001.532) (-1995.132) -- 0:00:04
969000 -- (-1994.139) [-1998.988] (-2000.534) (-1995.974) * (-2000.940) [-1990.076] (-2005.670) (-2002.838) -- 0:00:04
969500 -- (-1999.661) [-1994.105] (-1995.410) (-1997.589) * (-1994.711) (-1992.753) [-1993.693] (-1995.003) -- 0:00:04
970000 -- [-1996.725] (-1991.057) (-1996.076) (-1995.386) * (-1993.443) [-1998.020] (-1998.247) (-1998.141) -- 0:00:04
Average standard deviation of split frequencies: 0.000000
970500 -- (-1999.107) [-1994.569] (-1996.699) (-1991.115) * (-1992.909) [-1990.990] (-2000.524) (-1999.613) -- 0:00:04
971000 -- (-1994.776) (-1994.911) (-1994.378) [-1994.375] * (-1994.787) [-1993.897] (-2000.910) (-1991.656) -- 0:00:04
971500 -- (-1998.309) [-1995.386] (-1995.515) (-1995.372) * (-1996.493) [-1996.356] (-1997.394) (-1991.290) -- 0:00:04
972000 -- [-1995.486] (-1994.849) (-1992.492) (-2001.145) * [-1989.770] (-1994.403) (-1996.734) (-1991.706) -- 0:00:04
972500 -- [-1998.703] (-1995.286) (-1997.216) (-2001.066) * (-1994.216) [-2000.566] (-1996.950) (-1994.144) -- 0:00:04
973000 -- (-1993.432) [-1994.035] (-2001.517) (-1998.473) * [-1996.748] (-1992.190) (-2003.397) (-1995.154) -- 0:00:04
973500 -- (-1994.200) (-2000.285) (-1993.945) [-1994.372] * (-1997.093) [-1991.652] (-1997.174) (-2005.019) -- 0:00:04
974000 -- (-1991.287) (-1995.589) (-2001.795) [-1994.234] * [-1993.068] (-1993.984) (-1995.205) (-1998.053) -- 0:00:04
974500 -- (-1995.169) (-1996.175) (-1995.907) [-1990.244] * (-1996.924) (-1992.765) [-1997.105] (-1999.029) -- 0:00:03
975000 -- (-2001.524) (-2002.139) [-1993.131] (-1998.338) * (-1994.172) [-1991.656] (-1989.523) (-1996.830) -- 0:00:03
Average standard deviation of split frequencies: 0.000000
975500 -- (-1996.255) (-2001.850) [-1993.608] (-1996.366) * (-2002.048) (-1992.424) [-1996.798] (-1998.701) -- 0:00:03
976000 -- (-1995.947) (-1994.666) (-1993.149) [-1994.839] * (-1991.056) (-1994.776) [-1995.337] (-1997.459) -- 0:00:03
976500 -- (-2000.256) (-1994.023) (-1993.634) [-1993.537] * [-1994.164] (-1990.233) (-1993.435) (-1991.090) -- 0:00:03
977000 -- [-1991.189] (-1992.641) (-2001.265) (-1992.899) * (-1993.884) [-1993.238] (-1996.162) (-1990.130) -- 0:00:03
977500 -- [-1998.124] (-1995.938) (-2001.557) (-1991.147) * (-1996.321) (-1994.319) [-1994.694] (-1991.870) -- 0:00:03
978000 -- (-1993.015) [-1996.942] (-2001.285) (-2000.672) * (-1996.796) [-1995.340] (-1999.712) (-2000.359) -- 0:00:03
978500 -- [-1990.656] (-1997.171) (-1997.687) (-2000.981) * (-1995.883) (-1993.466) (-1991.613) [-1993.932] -- 0:00:03
979000 -- (-1998.229) (-1994.218) (-1999.524) [-2001.670] * [-1993.868] (-1992.752) (-1996.442) (-1994.936) -- 0:00:03
979500 -- [-1992.378] (-1998.851) (-1995.208) (-2001.012) * [-1994.513] (-1992.733) (-1998.779) (-1993.458) -- 0:00:03
980000 -- (-1992.831) (-2003.352) [-1990.466] (-1990.120) * (-1993.854) (-1993.507) [-1994.722] (-1991.504) -- 0:00:03
Average standard deviation of split frequencies: 0.000000
980500 -- (-1995.759) (-1994.132) [-1991.160] (-1990.558) * (-1989.495) (-2001.250) (-1993.661) [-1990.909] -- 0:00:03
981000 -- (-1998.071) (-1998.979) [-1992.664] (-1996.387) * (-1992.433) [-1997.396] (-1994.177) (-1997.114) -- 0:00:02
981500 -- (-1998.918) [-1996.450] (-1994.184) (-1994.643) * (-1999.494) (-2000.668) [-1997.152] (-1999.641) -- 0:00:02
982000 -- (-1994.842) (-1995.761) (-1997.053) [-1995.300] * (-2003.957) (-2001.478) [-1992.754] (-2002.965) -- 0:00:02
982500 -- (-2001.092) [-1992.275] (-1991.421) (-1997.821) * (-1999.502) (-2002.598) [-1995.688] (-1994.495) -- 0:00:02
983000 -- (-1996.087) (-1993.615) [-1994.355] (-1991.178) * [-1996.108] (-1991.275) (-1999.040) (-1999.776) -- 0:00:02
983500 -- (-1991.358) (-1995.607) [-1988.162] (-1993.198) * (-2000.742) (-1992.756) (-2001.873) [-1994.432] -- 0:00:02
984000 -- (-1997.204) [-1994.976] (-1993.546) (-2000.060) * (-1999.118) (-1999.825) (-1998.237) [-1991.709] -- 0:00:02
984500 -- (-1994.203) (-1997.075) [-1991.179] (-1997.124) * (-1997.269) (-1994.690) (-1996.641) [-1992.333] -- 0:00:02
985000 -- [-1994.841] (-1997.879) (-1991.650) (-1997.693) * [-1992.738] (-1991.263) (-1991.710) (-1996.607) -- 0:00:02
Average standard deviation of split frequencies: 0.000000
985500 -- [-1995.778] (-1993.842) (-1992.693) (-1997.936) * (-1994.230) (-1999.054) [-1997.447] (-1993.885) -- 0:00:02
986000 -- (-1996.768) [-2000.589] (-1995.725) (-1991.239) * (-1992.545) (-1999.460) (-1999.368) [-1997.847] -- 0:00:02
986500 -- (-1996.132) (-1999.375) [-1996.263] (-1990.729) * (-1995.555) (-1992.759) [-1991.557] (-1991.725) -- 0:00:02
987000 -- (-1995.880) [-2001.586] (-1992.074) (-1994.215) * (-1997.230) (-1993.283) [-1993.945] (-1999.938) -- 0:00:02
987500 -- [-1992.137] (-1993.810) (-1994.782) (-1998.824) * [-1995.747] (-1994.207) (-2001.910) (-1997.087) -- 0:00:01
988000 -- (-1996.698) (-1995.239) (-1999.964) [-1992.004] * (-1998.248) (-1990.015) (-1998.375) [-1993.013] -- 0:00:01
988500 -- (-1994.250) [-1996.324] (-1994.493) (-1999.110) * (-1992.535) [-1993.730] (-1994.616) (-1992.238) -- 0:00:01
989000 -- (-1995.968) [-1994.229] (-1991.938) (-1996.359) * (-1993.875) (-1997.625) [-1993.779] (-1997.255) -- 0:00:01
989500 -- (-1994.525) (-1994.536) [-1991.682] (-1999.842) * [-1993.210] (-1994.965) (-1996.627) (-1992.954) -- 0:00:01
990000 -- [-1988.365] (-1994.658) (-2003.693) (-1995.273) * (-1998.368) (-1997.537) [-1994.054] (-1996.125) -- 0:00:01
Average standard deviation of split frequencies: 0.000000
990500 -- [-1992.459] (-1994.833) (-1990.416) (-1994.544) * (-1990.911) (-1996.494) (-1991.414) [-1992.655] -- 0:00:01
991000 -- (-2003.925) (-1993.378) [-1991.112] (-1994.617) * (-1995.924) (-1991.218) [-1995.195] (-1997.701) -- 0:00:01
991500 -- (-1994.414) [-1992.663] (-1994.063) (-1996.941) * (-1999.040) (-1992.590) (-1991.308) [-1997.428] -- 0:00:01
992000 -- (-1989.835) [-1990.948] (-1992.695) (-1993.194) * (-1999.040) (-1990.246) [-1992.640] (-1999.076) -- 0:00:01
992500 -- [-1989.629] (-1992.091) (-2003.923) (-2007.671) * (-1997.517) (-1998.288) (-1996.591) [-2000.898] -- 0:00:01
993000 -- [-1994.468] (-1991.768) (-1994.291) (-1998.953) * [-1995.347] (-2000.728) (-1998.107) (-1995.234) -- 0:00:01
993500 -- (-2001.995) [-1996.721] (-2003.149) (-1994.640) * (-1992.585) [-1998.444] (-1997.065) (-1997.478) -- 0:00:01
994000 -- (-1993.213) (-1993.280) (-1992.473) [-1994.220] * [-2004.056] (-2004.768) (-1997.793) (-1996.277) -- 0:00:00
994500 -- [-1995.207] (-1998.746) (-1994.471) (-1995.095) * (-1995.002) (-1995.219) (-1991.764) [-1992.059] -- 0:00:00
995000 -- (-2000.967) (-1993.918) (-1993.771) [-1996.752] * (-1997.440) (-1999.785) [-1996.299] (-1992.623) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
995500 -- (-2004.749) (-1990.426) [-1998.607] (-1992.559) * [-1990.853] (-1999.149) (-1994.607) (-1997.717) -- 0:00:00
996000 -- (-1997.229) (-1999.989) [-1993.637] (-1994.001) * [-1994.825] (-1999.066) (-2004.435) (-1993.285) -- 0:00:00
996500 -- (-1991.906) [-1994.822] (-1992.416) (-1998.163) * [-1994.968] (-1996.544) (-1995.181) (-1996.434) -- 0:00:00
997000 -- (-1995.846) (-1996.340) (-1991.402) [-1993.625] * (-1998.371) (-1996.288) (-2000.935) [-1991.836] -- 0:00:00
997500 -- (-1997.550) (-2001.581) [-1990.422] (-2004.155) * (-1992.287) (-2004.647) (-1999.737) [-1992.296] -- 0:00:00
998000 -- (-1990.436) [-1998.565] (-1997.236) (-1989.375) * [-1994.551] (-1996.072) (-1991.857) (-1994.950) -- 0:00:00
998500 -- (-1995.551) (-1993.841) [-1992.633] (-1996.982) * (-1995.261) (-1997.292) [-1992.267] (-2001.378) -- 0:00:00
999000 -- (-2001.446) (-1991.797) (-1996.866) [-1992.469] * (-1994.059) [-1998.292] (-1993.192) (-1994.940) -- 0:00:00
999500 -- (-2001.270) (-1991.354) (-2002.216) [-1999.892] * (-1996.724) [-1990.774] (-1993.312) (-1994.434) -- 0:00:00
1000000 -- (-1998.844) [-1995.509] (-1998.989) (-1995.710) * (-1992.454) [-1993.170] (-1992.102) (-1995.207) -- 0:00:00
Average standard deviation of split frequencies: 0.000000
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1998.844207 -- 10.246424
Chain 1 -- -1998.844207 -- 10.246424
Chain 2 -- -1995.509355 -- 10.344033
Chain 2 -- -1995.509355 -- 10.344033
Chain 3 -- -1998.988891 -- 5.581063
Chain 3 -- -1998.988891 -- 5.581063
Chain 4 -- -1995.710137 -- 9.134122
Chain 4 -- -1995.710137 -- 9.134122
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1992.453966 -- 9.202905
Chain 1 -- -1992.453966 -- 9.202905
Chain 2 -- -1993.169896 -- 10.979803
Chain 2 -- -1993.169896 -- 10.979803
Chain 3 -- -1992.101921 -- 9.254274
Chain 3 -- -1992.101921 -- 9.254274
Chain 4 -- -1995.206697 -- 11.721256
Chain 4 -- -1995.206697 -- 11.721256
Analysis completed in 2 mins 34 seconds
Analysis used 154.25 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1985.69
Likelihood of best state for "cold" chain of run 2 was -1986.03
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
51.7 % ( 43 %) Dirichlet(Revmat{all})
64.7 % ( 53 %) Slider(Revmat{all})
25.4 % ( 26 %) Dirichlet(Pi{all})
27.0 % ( 19 %) Slider(Pi{all})
58.8 % ( 22 %) Multiplier(Alpha{1,2})
41.2 % ( 26 %) Multiplier(Alpha{3})
53.4 % ( 27 %) Slider(Pinvar{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
25.9 % ( 26 %) Multiplier(V{all})
23.4 % ( 32 %) Nodeslider(V{all})
25.7 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
50.8 % ( 42 %) Dirichlet(Revmat{all})
64.4 % ( 38 %) Slider(Revmat{all})
25.4 % ( 20 %) Dirichlet(Pi{all})
27.1 % ( 26 %) Slider(Pi{all})
59.1 % ( 21 %) Multiplier(Alpha{1,2})
40.9 % ( 24 %) Multiplier(Alpha{3})
52.4 % ( 24 %) Slider(Pinvar{all})
0.0 % ( 0 %) NNI(Tau{all},V{all})
0.0 % ( 0 %) ParsSPR(Tau{all},V{all})
25.8 % ( 26 %) Multiplier(V{all})
23.3 % ( 23 %) Nodeslider(V{all})
25.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.85 0.72 0.60
2 | 166600 0.86 0.74
3 | 166339 166846 0.87
4 | 166810 166734 166671
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.85 0.71 0.60
2 | 166548 0.86 0.74
3 | 166490 167112 0.87
4 | 166323 166587 166940
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1993.57
| 1 1 |
| 1 1 1 2 2 1 1 2 1|
| 1 2 2 1 1 2 |
| 1 1 12 2 2 11 2 1 2* |
| 122 * 2 1 2 1 2 1 22 2|
|2 1 2 *1 2 1 11 12 21 2 2 1 |
|1 2 2 2 1 * 1 1 1 1 |
| 2 1 2 2 2 2 21 1 2 2 |
| 22 2 1 12 1 2 1 112 2 222 |
| 2 2 21 2 2 12 1 1 |
| 11 21 1 |
| 1 2 2 |
| 1 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1997.12
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1991.87 -2002.53
2 -1991.98 -2001.23
--------------------------------------
TOTAL -1991.92 -2002.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.332496 0.002879 0.229203 0.433222 0.327453 1031.69 1173.30 1.000
r(A<->C){all} 0.075611 0.000730 0.026556 0.128975 0.073943 809.45 850.25 1.000
r(A<->G){all} 0.190119 0.001901 0.112214 0.280409 0.186920 843.27 845.54 1.000
r(A<->T){all} 0.108213 0.001282 0.043584 0.179724 0.105112 844.45 991.85 1.000
r(C<->G){all} 0.039748 0.000338 0.007656 0.075205 0.037530 927.97 1031.50 1.000
r(C<->T){all} 0.465573 0.003902 0.347164 0.588151 0.464846 641.75 667.88 1.000
r(G<->T){all} 0.120736 0.001116 0.059806 0.186650 0.118597 693.59 951.84 1.000
pi(A){all} 0.249578 0.000187 0.221597 0.275023 0.249467 1213.11 1244.34 1.000
pi(C){all} 0.266669 0.000202 0.239197 0.294829 0.266650 1203.42 1284.49 1.000
pi(G){all} 0.274923 0.000211 0.247489 0.303375 0.274998 1159.70 1330.35 1.000
pi(T){all} 0.208831 0.000160 0.184585 0.233665 0.208557 1281.20 1306.31 1.000
alpha{1,2} 0.041770 0.000847 0.000167 0.095557 0.038512 1381.24 1382.24 1.000
alpha{3} 2.694875 0.792477 1.216518 4.481324 2.575224 1350.70 1365.88 1.000
pinvar{all} 0.401152 0.007453 0.232133 0.559242 0.411596 1112.38 1189.21 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- ..**
----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 3002 1.000000 0.000000 1.000000 1.000000 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.032179 0.000115 0.013536 0.053368 0.030938 1.000 2
length{all}[2] 0.039674 0.000133 0.018755 0.062326 0.038714 1.001 2
length{all}[3] 0.061427 0.000302 0.030953 0.097940 0.059461 1.000 2
length{all}[4] 0.069295 0.000374 0.032531 0.105119 0.066754 1.000 2
length{all}[5] 0.129922 0.000985 0.076943 0.195484 0.125772 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000000
Maximum standard deviation of split frequencies = 0.000000
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
| /------------------------------------ C3 (3)
\----------------100----------------+
\------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------ C1 (1)
|
|-------------- C2 (2)
+
| /---------------------- C3 (3)
\----------------------------------------------+
\------------------------- C4 (4)
|-----------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1 tree sampled):
99 % credible set contains 1 tree
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 4 ls = 912
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
163 patterns at 304 / 304 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
159088 bytes for conP
22168 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, (3, 4)); MP score: 141
0.056595 0.078964 0.193056 0.106306 0.109935 0.300000 1.300000
ntime & nrate & np: 5 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 7
lnL0 = -2082.364508
Iterating by ming2
Initial: fx= 2082.364508
x= 0.05660 0.07896 0.19306 0.10631 0.10993 0.30000 1.30000
1 h-m-p 0.0000 0.0062 205.2210 ++++YCYCCCC 2024.570238 6 0.0033 26 | 0/7
2 h-m-p 0.0004 0.0021 745.4078 YYCCCC 1992.739006 5 0.0007 44 | 0/7
3 h-m-p 0.0004 0.0018 173.1662 YCYCCC 1982.610611 5 0.0010 62 | 0/7
4 h-m-p 0.0001 0.0006 737.6445 +YCCCC 1972.337156 4 0.0003 80 | 0/7
5 h-m-p 0.0003 0.0013 509.8376 +YYYYYYYCCC 1930.401481 10 0.0010 103 | 0/7
6 h-m-p 0.0000 0.0001 1734.2436 CYCCCC 1928.430253 5 0.0000 122 | 0/7
7 h-m-p 0.0035 0.0174 5.6900 CCC 1928.396244 2 0.0007 136 | 0/7
8 h-m-p 0.0074 0.9784 0.5646 +++YYYC 1899.828669 3 0.4564 152 | 0/7
9 h-m-p 0.9805 4.9024 0.0762 CCCCC 1897.348526 4 1.3094 177 | 0/7
10 h-m-p 1.6000 8.0000 0.0236 CCCCC 1896.092069 4 1.6990 202 | 0/7
11 h-m-p 1.6000 8.0000 0.0115 YCCC 1895.886672 3 1.0970 224 | 0/7
12 h-m-p 0.9667 8.0000 0.0130 YC 1895.692455 1 2.2267 242 | 0/7
13 h-m-p 1.6000 8.0000 0.0106 C 1895.657337 0 1.5746 259 | 0/7
14 h-m-p 0.9061 8.0000 0.0185 +CC 1895.595603 1 4.4200 279 | 0/7
15 h-m-p 1.6000 8.0000 0.0243 CC 1895.569702 1 1.4235 298 | 0/7
16 h-m-p 1.6000 8.0000 0.0023 YC 1895.569600 1 1.0366 316 | 0/7
17 h-m-p 1.6000 8.0000 0.0002 Y 1895.569597 0 1.0432 333 | 0/7
18 h-m-p 1.6000 8.0000 0.0000 C 1895.569596 0 1.9716 350 | 0/7
19 h-m-p 1.1166 8.0000 0.0000 C 1895.569596 0 1.0966 367 | 0/7
20 h-m-p 1.6000 8.0000 0.0000 -------------C 1895.569596 0 0.0000 397
Out..
lnL = -1895.569596
398 lfun, 398 eigenQcodon, 1990 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, (3, 4)); MP score: 141
0.056595 0.078964 0.193056 0.106306 0.109935 1.649178 0.755520 0.234606
ntime & nrate & np: 5 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.327351
np = 8
lnL0 = -1927.056687
Iterating by ming2
Initial: fx= 1927.056687
x= 0.05660 0.07896 0.19306 0.10631 0.10993 1.64918 0.75552 0.23461
1 h-m-p 0.0000 0.0020 146.1653 ++++ 1902.723051 m 0.0020 15 | 0/8
2 h-m-p 0.0003 0.0016 51.9736 CYCCC 1901.993084 4 0.0005 33 | 0/8
3 h-m-p 0.0011 0.0057 18.6680 YYC 1901.767681 2 0.0009 46 | 0/8
4 h-m-p 0.0019 0.7360 9.2133 +YYCC 1900.042981 3 0.0108 62 | 0/8
5 h-m-p 0.0005 0.0027 118.2640 +YCCCC 1895.930945 4 0.0016 81 | 0/8
6 h-m-p 0.0005 0.0025 105.8747 CCCC 1894.722681 3 0.0006 98 | 0/8
7 h-m-p 0.0021 0.0104 17.4020 CC 1894.624807 1 0.0007 111 | 0/8
8 h-m-p 0.0051 0.4554 2.4046 +YC 1894.350468 1 0.0491 124 | 0/8
9 h-m-p 0.0009 0.0140 134.2672 +YYCCC 1893.366310 4 0.0029 142 | 0/8
10 h-m-p 1.5364 7.6818 0.2149 YCCC 1891.254650 3 1.1801 158 | 0/8
11 h-m-p 1.6000 8.0000 0.0507 CYC 1890.413297 2 1.7294 180 | 0/8
12 h-m-p 1.6000 8.0000 0.0205 CCC 1890.078271 2 1.5346 203 | 0/8
13 h-m-p 0.4247 8.0000 0.0742 YC 1889.983650 1 1.0400 223 | 0/8
14 h-m-p 1.6000 8.0000 0.0052 YC 1889.965363 1 1.0088 243 | 0/8
15 h-m-p 1.6000 8.0000 0.0020 YC 1889.964594 1 1.0820 263 | 0/8
16 h-m-p 1.6000 8.0000 0.0004 C 1889.964521 0 1.5252 282 | 0/8
17 h-m-p 1.6000 8.0000 0.0001 Y 1889.964519 0 1.0118 301 | 0/8
18 h-m-p 1.6000 8.0000 0.0000 Y 1889.964519 0 0.8869 320 | 0/8
19 h-m-p 1.6000 8.0000 0.0000 Y 1889.964519 0 0.9364 339 | 0/8
20 h-m-p 1.6000 8.0000 0.0000 --C 1889.964519 0 0.0250 360
Out..
lnL = -1889.964519
361 lfun, 1083 eigenQcodon, 3610 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, (3, 4)); MP score: 141
initial w for M2:NSpselection reset.
0.056595 0.078964 0.193056 0.106306 0.109935 1.709838 1.079469 0.409056 0.257593 2.430889
ntime & nrate & np: 5 3 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.745235
np = 10
lnL0 = -1962.958124
Iterating by ming2
Initial: fx= 1962.958124
x= 0.05660 0.07896 0.19306 0.10631 0.10993 1.70984 1.07947 0.40906 0.25759 2.43089
1 h-m-p 0.0000 0.0038 101.5134 +++++ 1950.042567 m 0.0038 18 | 1/10
2 h-m-p 0.0047 0.0415 62.2391 CCC 1942.783001 2 0.0057 35 | 1/10
3 h-m-p 0.0051 0.0311 69.3637 CCCC 1935.740302 3 0.0064 54 | 0/10
4 h-m-p 0.0004 0.0020 830.9913 CYCC 1934.899530 3 0.0001 72 | 0/10
5 h-m-p 0.0022 0.0109 29.0854 CCCCC 1934.115230 4 0.0026 93 | 0/10
6 h-m-p 0.0092 0.0745 8.1873 CCCC 1933.427501 3 0.0147 112 | 0/10
7 h-m-p 0.0041 0.0215 29.6264 ++ 1926.885052 m 0.0215 125 | 1/10
8 h-m-p 0.0003 0.0016 1254.9062 CYCCCC 1922.757714 5 0.0006 147 | 1/10
9 h-m-p 0.0100 0.0502 14.3399 +YCCCC 1920.080027 4 0.0276 168 | 1/10
10 h-m-p 0.0647 0.3237 3.2517 +YCYCCC 1911.045684 5 0.1970 190 | 1/10
11 h-m-p 0.3599 1.8011 1.7800 YCCCC 1898.812943 4 0.7429 210 | 0/10
12 h-m-p 0.0140 0.0701 34.6043 -CCC 1898.790599 2 0.0007 228 | 0/10
13 h-m-p 0.0020 0.2662 12.5698 +++YCYCCC 1894.924313 5 0.0908 252 | 0/10
14 h-m-p 1.2019 6.0095 0.4243 YCCC 1892.916562 3 0.9139 270 | 0/10
15 h-m-p 1.1555 6.3659 0.3356 YCCC 1891.929421 3 0.8478 298 | 0/10
16 h-m-p 0.2635 2.7172 1.0799 YCCC 1891.312216 3 0.4814 326 | 0/10
17 h-m-p 0.6326 3.1628 0.7738 YYC 1890.970440 2 0.4983 341 | 0/10
18 h-m-p 0.8164 8.0000 0.4723 CCC 1890.745395 2 0.6414 368 | 0/10
19 h-m-p 0.7542 8.0000 0.4016 CCC 1890.571303 2 0.9499 395 | 0/10
20 h-m-p 0.8889 8.0000 0.4292 YC 1890.387214 1 1.8145 419 | 0/10
21 h-m-p 0.9472 8.0000 0.8222 YC 1890.139756 1 1.6340 443 | 0/10
22 h-m-p 1.6000 8.0000 0.6545 YC 1890.071137 1 0.9165 467 | 0/10
23 h-m-p 1.3227 8.0000 0.4535 CCC 1890.039424 2 1.0174 494 | 0/10
24 h-m-p 1.2009 8.0000 0.3842 +YCC 1889.996122 2 3.5676 521 | 0/10
25 h-m-p 1.6000 8.0000 0.6574 CY 1889.977689 1 1.6683 546 | 0/10
26 h-m-p 1.6000 8.0000 0.4966 YCC 1889.970315 2 2.6197 572 | 0/10
27 h-m-p 1.6000 8.0000 0.5909 CC 1889.966798 1 2.1218 597 | 0/10
28 h-m-p 1.6000 8.0000 0.5276 YC 1889.965396 1 2.8272 621 | 0/10
29 h-m-p 1.6000 8.0000 0.5269 CC 1889.964877 1 2.2101 646 | 0/10
30 h-m-p 1.6000 8.0000 0.5288 YC 1889.964648 1 3.1052 670 | 0/10
31 h-m-p 1.6000 8.0000 0.5104 C 1889.964573 0 2.1895 693 | 0/10
32 h-m-p 1.6000 8.0000 0.4850 Y 1889.964541 0 3.0354 716 | 0/10
33 h-m-p 1.6000 8.0000 0.5074 C 1889.964528 0 2.2514 739 | 0/10
34 h-m-p 1.6000 8.0000 0.5015 Y 1889.964523 0 2.9447 762 | 0/10
35 h-m-p 1.6000 8.0000 0.5089 C 1889.964521 0 2.2563 785 | 0/10
36 h-m-p 1.6000 8.0000 0.5179 Y 1889.964520 0 2.9999 808 | 0/10
37 h-m-p 1.6000 8.0000 0.5509 C 1889.964519 0 2.2615 831 | 0/10
38 h-m-p 1.6000 8.0000 0.6148 Y 1889.964519 0 3.2130 854 | 0/10
39 h-m-p 1.6000 8.0000 0.9094 C 1889.964519 0 2.4440 877 | 0/10
40 h-m-p 0.8032 8.0000 2.7673 C 1889.964519 0 0.8032 900 | 0/10
41 h-m-p 1.0007 8.0000 2.2210 Y 1889.964519 0 0.4597 913 | 0/10
42 h-m-p 0.0325 2.7910 31.4583 --------Y 1889.964519 0 0.0000 934 | 0/10
43 h-m-p 0.0160 8.0000 0.0012 -------C 1889.964519 0 0.0000 954 | 0/10
44 h-m-p 0.0160 8.0000 0.0000 +++C 1889.964519 0 0.9118 980 | 0/10
45 h-m-p 1.2163 8.0000 0.0000 C 1889.964519 0 0.4320 1003 | 0/10
46 h-m-p 1.6000 8.0000 0.0000 Y 1889.964519 0 1.6000 1026 | 0/10
47 h-m-p 1.6000 8.0000 0.0000 C 1889.964519 0 1.6000 1049 | 0/10
48 h-m-p 1.6000 8.0000 0.0000 -----Y 1889.964519 0 0.0004 1077
Out..
lnL = -1889.964519
1078 lfun, 4312 eigenQcodon, 16170 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1899.783149 S = -1820.958205 -69.807268
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 163 patterns 0:09
did 20 / 163 patterns 0:10
did 30 / 163 patterns 0:10
did 40 / 163 patterns 0:10
did 50 / 163 patterns 0:10
did 60 / 163 patterns 0:10
did 70 / 163 patterns 0:10
did 80 / 163 patterns 0:10
did 90 / 163 patterns 0:10
did 100 / 163 patterns 0:10
did 110 / 163 patterns 0:10
did 120 / 163 patterns 0:10
did 130 / 163 patterns 0:10
did 140 / 163 patterns 0:10
did 150 / 163 patterns 0:10
did 160 / 163 patterns 0:10
did 163 / 163 patterns 0:10
Time used: 0:10
Model 3: discrete
TREE # 1
(1, 2, (3, 4)); MP score: 141
0.056595 0.078964 0.193056 0.106306 0.109935 1.709837 0.408838 0.998206 0.044733 0.097215 0.147073
ntime & nrate & np: 5 4 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 16.549015
np = 11
lnL0 = -1894.918983
Iterating by ming2
Initial: fx= 1894.918983
x= 0.05660 0.07896 0.19306 0.10631 0.10993 1.70984 0.40884 0.99821 0.04473 0.09722 0.14707
1 h-m-p 0.0000 0.0021 32.3384 +++CCC 1894.486884 2 0.0009 23 | 0/11
2 h-m-p 0.0001 0.0004 65.9391 ++ 1893.713675 m 0.0004 37 | 1/11
3 h-m-p 0.0001 0.0028 214.4715 +YCC 1893.541214 2 0.0002 55 | 1/11
4 h-m-p 0.0005 0.0027 89.5666 +YYCCC 1892.667368 4 0.0015 76 | 1/11
5 h-m-p 0.0004 0.0020 56.1906 CCC 1892.559049 2 0.0005 94 | 1/11
6 h-m-p 0.0032 0.0160 5.3554 YC 1892.509368 1 0.0018 109 | 1/11
7 h-m-p 0.0014 0.0206 6.8519 +CCC 1892.112645 2 0.0061 128 | 1/11
8 h-m-p 0.0017 0.0087 15.8900 YC 1892.016913 1 0.0009 143 | 1/11
9 h-m-p 0.1325 4.7672 0.1090 +YCCC 1890.905185 3 1.0940 163 | 1/11
10 h-m-p 0.0443 0.2215 2.4429 +CYC 1889.983054 2 0.1633 191 | 0/11
11 h-m-p 0.0008 0.0040 36.5462 ++ 1889.792773 m 0.0040 205 | 0/11
12 h-m-p 0.0000 0.0000 1.3239
h-m-p: 8.35056729e-19 4.17528364e-18 1.32386419e+00 1889.792773
.. | 0/11
13 h-m-p 0.0001 0.0404 39.6666 +CCC 1889.570205 2 0.0003 235 | 0/11
14 h-m-p 0.0013 0.0114 8.8860 YC 1889.541559 1 0.0008 250 | 0/11
15 h-m-p 0.0005 0.0025 11.0168 YC 1889.504662 1 0.0012 265 | 0/11
16 h-m-p 0.0007 0.0315 17.5829 CC 1889.460203 1 0.0010 281 | 0/11
17 h-m-p 0.0002 0.0008 27.7358 ++ 1889.395250 m 0.0008 295 | 0/11
18 h-m-p 0.0000 0.0000 11.0528
h-m-p: 6.49664942e-20 3.24832471e-19 1.10528098e+01 1889.395250
.. | 0/11
19 h-m-p 0.0001 0.0696 5.5545 +CC 1889.385320 1 0.0006 323 | 0/11
20 h-m-p 0.0001 0.0007 2.5508 ++ 1889.383517 m 0.0007 337 | 1/11
21 h-m-p 0.0006 0.1555 2.6533 CC 1889.382033 1 0.0008 353 | 1/11
22 h-m-p 0.0008 0.3619 2.4241 +YC 1889.378720 1 0.0025 369 | 1/11
23 h-m-p 0.0013 0.1400 4.6536 CC 1889.376202 1 0.0011 385 | 1/11
24 h-m-p 0.0022 0.1369 2.4020 YC 1889.375191 1 0.0011 400 | 1/11
25 h-m-p 0.0008 0.0387 3.3770 ++YC 1889.365026 1 0.0084 417 | 1/11
26 h-m-p 0.0312 2.3678 0.9077 CC 1889.356530 1 0.0393 433 | 1/11
27 h-m-p 0.1944 1.1854 0.1834 ++ 1889.322878 m 1.1854 457 | 1/11
28 h-m-p -0.0000 -0.0000 189.1716
h-m-p: -9.29721253e-23 -4.64860627e-22 1.89171644e+02 1889.322878
.. | 1/11
29 h-m-p 0.0005 0.2556 4.5605 YC 1889.319448 1 0.0003 493 | 1/11
30 h-m-p 0.0044 2.2162 0.6586 -C 1889.319358 0 0.0004 508 | 1/11
31 h-m-p 0.0008 0.0445 0.3671 C 1889.319320 0 0.0007 532 | 1/11
32 h-m-p 0.0006 0.0799 0.4197 ++C 1889.318959 0 0.0083 558 | 1/11
33 h-m-p 0.0007 0.0089 4.7711 ++ 1889.315950 m 0.0089 582 | 2/11
34 h-m-p 0.0015 0.0709 28.5827 YC 1889.312741 1 0.0011 597 | 2/11
35 h-m-p 0.0049 0.1270 6.4203 -CC 1889.312437 1 0.0005 614 | 2/11
36 h-m-p 0.0112 2.4128 0.2681 YC 1889.312002 1 0.0198 629 | 2/11
37 h-m-p 0.0179 8.0000 0.2973 +C 1889.310605 0 0.0656 653 | 2/11
38 h-m-p 1.0591 8.0000 0.0184 YC 1889.307920 1 0.6930 677 | 2/11
39 h-m-p 1.6000 8.0000 0.0001 Y 1889.307920 0 1.0099 700 | 2/11
40 h-m-p 1.6000 8.0000 0.0000 Y 1889.307920 0 1.0483 723 | 2/11
41 h-m-p 1.6000 8.0000 0.0000 N 1889.307920 0 0.4000 746 | 2/11
42 h-m-p 0.7210 8.0000 0.0000 C 1889.307920 0 1.1167 769 | 2/11
43 h-m-p 1.6000 8.0000 0.0000 ----Y 1889.307920 0 0.0016 796
Out..
lnL = -1889.307920
797 lfun, 3188 eigenQcodon, 11955 P(t)
Time used: 0:15
Model 7: beta
TREE # 1
(1, 2, (3, 4)); MP score: 141
0.056595 0.078964 0.193056 0.106306 0.109935 1.679872 0.996708 1.805788
ntime & nrate & np: 5 1 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.174143
np = 8
lnL0 = -1920.140950
Iterating by ming2
Initial: fx= 1920.140950
x= 0.05660 0.07896 0.19306 0.10631 0.10993 1.67987 0.99671 1.80579
1 h-m-p 0.0000 0.0154 45.2178 +++YCCC 1919.134233 3 0.0011 21 | 0/8
2 h-m-p 0.0004 0.0087 112.0157 +CYCCCC 1911.483164 5 0.0032 42 | 0/8
3 h-m-p 0.0001 0.0007 1105.2277 YCYCCC 1901.105124 5 0.0004 62 | 0/8
4 h-m-p 0.0001 0.0005 649.8728 CCCCC 1899.486328 4 0.0001 81 | 0/8
5 h-m-p 0.0061 0.0305 12.4459 YCCC 1899.158010 3 0.0040 97 | 0/8
6 h-m-p 0.0008 0.0610 62.9604 ++YCCCC 1896.234718 4 0.0088 117 | 0/8
7 h-m-p 0.0009 0.0043 227.4672 CCCC 1894.920653 3 0.0010 134 | 0/8
8 h-m-p 0.0777 0.9253 2.8445 +YYCCC 1892.764527 4 0.2608 152 | 0/8
9 h-m-p 1.0076 5.0379 0.5410 YCCC 1891.440408 3 0.4591 168 | 0/8
10 h-m-p 1.6000 8.0000 0.1472 CCC 1890.919876 2 1.3514 191 | 0/8
11 h-m-p 1.6000 8.0000 0.0296 CYC 1890.734160 2 1.5803 213 | 0/8
12 h-m-p 0.3637 8.0000 0.1287 +CC 1890.654561 1 2.0551 235 | 0/8
13 h-m-p 1.2418 8.0000 0.2130 ++ 1889.842355 m 8.0000 254 | 0/8
14 h-m-p 0.0419 0.2095 7.2398 YCCCCC 1889.734114 5 0.0581 282 | 0/8
15 h-m-p 0.4394 2.1968 0.3558 YYYYC 1889.626533 4 0.4260 297 | 0/8
16 h-m-p 1.1873 8.0000 0.1277 YCCC 1889.474392 3 0.7148 321 | 0/8
17 h-m-p 1.1409 8.0000 0.0800 CYC 1889.461726 2 1.0192 343 | 0/8
18 h-m-p 1.6000 8.0000 0.0378 CC 1889.460635 1 0.6037 364 | 0/8
19 h-m-p 1.6000 8.0000 0.0008 Y 1889.460514 0 1.2578 383 | 0/8
20 h-m-p 1.6000 8.0000 0.0006 Y 1889.460509 0 1.0508 402 | 0/8
21 h-m-p 1.6000 8.0000 0.0001 Y 1889.460509 0 1.0178 421 | 0/8
22 h-m-p 1.6000 8.0000 0.0000 Y 1889.460509 0 1.0230 440 | 0/8
23 h-m-p 1.6000 8.0000 0.0000 C 1889.460509 0 2.0588 459 | 0/8
24 h-m-p 1.6000 8.0000 0.0000 ---N 1889.460509 0 0.0063 481
Out..
lnL = -1889.460509
482 lfun, 5302 eigenQcodon, 24100 P(t)
Time used: 0:24
Model 8: beta&w>1
TREE # 1
(1, 2, (3, 4)); MP score: 141
initial w for M8:NSbetaw>1 reset.
0.056595 0.078964 0.193056 0.106306 0.109935 1.681062 0.900000 0.709770 1.329016 2.821721
ntime & nrate & np: 5 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.488334
np = 10
lnL0 = -1935.851318
Iterating by ming2
Initial: fx= 1935.851318
x= 0.05660 0.07896 0.19306 0.10631 0.10993 1.68106 0.90000 0.70977 1.32902 2.82172
1 h-m-p 0.0000 0.0005 218.2504 +++ 1918.605478 m 0.0005 16 | 1/10
2 h-m-p 0.0007 0.0112 65.0614 +CYYCCC 1904.764937 5 0.0068 39 | 1/10
3 h-m-p 0.0001 0.0003 1168.7921 CYCCCC 1900.602620 5 0.0001 62 | 1/10
4 h-m-p 0.0020 0.0099 22.2610 YC 1900.378840 1 0.0011 76 | 0/10
5 h-m-p 0.0004 0.0158 59.7341 YCCC 1900.001024 3 0.0002 94 | 0/10
6 h-m-p 0.0006 0.0412 21.5761 ++YCC 1899.064864 2 0.0068 112 | 0/10
7 h-m-p 0.0018 0.0089 57.3492 ++ 1896.015134 m 0.0089 125 | 0/10
8 h-m-p 0.0000 0.0000 11.2924
h-m-p: 0.00000000e+00 0.00000000e+00 1.12923515e+01 1896.015134
.. | 0/10
9 h-m-p 0.0000 0.0013 118.3671 +++YYCCC 1891.718795 4 0.0006 157 | 0/10
10 h-m-p 0.0000 0.0001 75.7453 ++ 1891.238635 m 0.0001 170 | 1/10
11 h-m-p 0.0002 0.0065 38.7310 +YCC 1890.997676 2 0.0005 187 | 1/10
12 h-m-p 0.0007 0.0131 27.3348 CCC 1890.797185 2 0.0007 204 | 1/10
13 h-m-p 0.0010 0.0086 19.2666 YC 1890.734006 1 0.0005 218 | 1/10
14 h-m-p 0.0011 0.0317 9.0927 CC 1890.703972 1 0.0010 233 | 1/10
15 h-m-p 0.0017 0.1654 5.3283 +CC 1890.632295 1 0.0073 249 | 1/10
16 h-m-p 0.0008 0.0414 50.6584 +YCCC 1889.959030 3 0.0069 268 | 1/10
17 h-m-p 0.9642 5.9559 0.3625 YCYCCC 1889.722601 5 2.0898 289 | 1/10
18 h-m-p 0.1664 0.8319 2.0973 YYYCCCC 1889.592514 6 0.1744 320 | 1/10
19 h-m-p 0.7410 3.7052 0.3946 CCCC 1889.492125 3 0.8604 339 | 1/10
20 h-m-p 0.9320 8.0000 0.3643 YCC 1889.463458 2 0.3525 364 | 1/10
21 h-m-p 1.6000 8.0000 0.0302 YC 1889.460960 1 0.8281 387 | 1/10
22 h-m-p 1.6000 8.0000 0.0050 YC 1889.460870 1 0.7383 410 | 1/10
23 h-m-p 1.6000 8.0000 0.0012 Y 1889.460867 0 0.9068 432 | 1/10
24 h-m-p 1.6000 8.0000 0.0002 C 1889.460867 0 1.6818 454 | 1/10
25 h-m-p 1.0462 8.0000 0.0004 ++ 1889.460866 m 8.0000 476 | 1/10
26 h-m-p 0.0437 8.0000 0.0729 +++Y 1889.460831 0 2.0226 501 | 1/10
27 h-m-p 1.6000 8.0000 0.0687 ++ 1889.460607 m 8.0000 523 | 1/10
28 h-m-p 0.0478 0.2392 0.8926 ++ 1889.460547 m 0.2392 545 | 2/10
29 h-m-p 0.3279 8.0000 0.0017 +Y 1889.460533 0 1.0159 568 | 2/10
30 h-m-p 1.6000 8.0000 0.0001 Y 1889.460533 0 0.9887 589 | 2/10
31 h-m-p 1.6000 8.0000 0.0000 C 1889.460533 0 0.4000 610 | 2/10
32 h-m-p 0.6626 8.0000 0.0000 ----------------.. | 2/10
33 h-m-p 0.0160 8.0000 0.0000 ------------- | 2/10
34 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -1889.460533
710 lfun, 8520 eigenQcodon, 39050 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1901.025437 S = -1821.326304 -71.395350
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 163 patterns 0:40
did 20 / 163 patterns 0:40
did 30 / 163 patterns 0:40
did 40 / 163 patterns 0:41
did 50 / 163 patterns 0:41
did 60 / 163 patterns 0:41
did 70 / 163 patterns 0:41
did 80 / 163 patterns 0:41
did 90 / 163 patterns 0:42
did 100 / 163 patterns 0:42
did 110 / 163 patterns 0:42
did 120 / 163 patterns 0:42
did 130 / 163 patterns 0:42
did 140 / 163 patterns 0:43
did 150 / 163 patterns 0:43
did 160 / 163 patterns 0:43
did 163 / 163 patterns 0:43
Time used: 0:43
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=304
D_melanogaster_CG4036-PB MNTIRPCGCKGVRTCLSCEQDFHIAKTSLREQFQQLEAWSYCIQCDLLQR
D_sechellia_CG4036-PB MNTIRPCGCKGVRTCLSCEQNFQIAKTSLKEQFQQLEAWSYCIQCDLLQP
D_yakuba_CG4036-PB MNTIRPCGCKGVRTCLGCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
D_erecta_CG4036-PB MNTIRPCGCKGVRTCLSCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP
****************.***:*:***.**:*******************
D_melanogaster_CG4036-PB GWDTNHVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
D_sechellia_CG4036-PB GWDTNQVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD
D_yakuba_CG4036-PB GWDTTKVQKDHEHHKKDEGLPLPGILVQENFLSEEEGSQLIADLDDLPWD
D_erecta_CG4036-PB GWDTTKVQKDHEHHKKDEGLPLPGILVQEKFLSAEEGSRLIADLDDLPWD
****.:******:****************:*** :**::***********
D_melanogaster_CG4036-PB ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
D_sechellia_CG4036-PB ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF
D_yakuba_CG4036-PB ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
D_erecta_CG4036-PB ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF
******************************************:*******
D_melanogaster_CG4036-PB QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
D_sechellia_CG4036-PB QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
D_yakuba_CG4036-PB QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV
D_erecta_CG4036-PB QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDAVLTLTPFEV
****************************************:******:**
D_melanogaster_CG4036-PB QQSGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
D_sechellia_CG4036-PB QQQGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG
D_yakuba_CG4036-PB QQPGKYNLDLVASYENELVAPLLIEDQLVSFEGKVLRIPMPNLSLIALYG
D_erecta_CG4036-PB QPPGKYNLDLVASYEDELLAPLLNEDQLASFEGKVLRIPMPNLSLIVLYG
* ************:**:**** :***.:****************.***
D_melanogaster_CG4036-PB PARYQFEHSVLREDVQERRVCVAYREFTPMYINGVDIQKGDPVREKSQIF
D_sechellia_CG4036-PB PARYQFEHSVLREDVQERRVCVAYREFTPMYINGADIQKGDPVREKSQIF
D_yakuba_CG4036-PB PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQQGDPVREKSQIF
D_erecta_CG4036-PB PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQKGDPVREKSHIF
********************************** ***:********:**
D_melanogaster_CG4036-PB WQIN
D_sechellia_CG4036-PB WQIN
D_yakuba_CG4036-PB WQIN
D_erecta_CG4036-PB WQIN
****
>D_melanogaster_CG4036-PB ATGAATACAATTCGTCCTTGCGGTTGTAAGGGCGTTCGCACCTGCTTGAG CTGCGAACAGGACTTTCATATAGCGAAGACCTCGCTACGGGAACAATTCC AGCAACTGGAAGCATGGTCCTACTGTATCCAGTGCGACCTTCTGCAGCGC GGTTGGGATACCAATCATGTCCAAAAGGATCATGAAAATCACAAAAAAGA TGAGGGCCTCCCACTGCCGGGCATCCTGGTGCAGGAGGAATTCCTTAGCG TTGATGAGGGCGCCCAACTTATAGCCGACTTGGATGACCTGCCATGGGAC ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT TAAAAAGCGCAAACTGCGGCTGGGATCCTTTGCCGGATTCCCCAGGACAA CGGAATATGTGCAACGGCGCTTCGAAGACGTTCCCCTGCTTCGTGGCTTT CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG CATAGATCCGCACGTGGACGATTGCTGGATCTGGGGCGAGCGTGTGGTCA CTGTCAACTGCCTCGGCGACTCAGTGCTCACTTTGACGCCCTACGAAGTT CAACAATCGGGCAAGTACAACTTGGACTTGGTTGCCAGCTACGAAGATGA ACTATTGGCGCCTCTACTGACAGATGACCAACTTGCAACTTTTGAGGGAA AGGTGCTGCGCATACCTATGCCAAACCTCTCCTTGATAGTTTTGTATGGG CCAGCGAGGTACCAGTTTGAGCATTCTGTACTACGCGAGGATGTCCAAGA GCGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATCAATG GCGTAGACATCCAAAAGGGAGATCCTGTCCGAGAAAAGTCTCAGATATTC TGGCAAATAAAC >D_sechellia_CG4036-PB ATGAATACAATTCGTCCTTGCGGTTGTAAGGGCGTGCGCACCTGCTTGAG CTGCGAACAGAACTTTCAGATAGCGAAGACCTCGCTAAAGGAGCAATTCC AGCAACTGGAAGCTTGGTCCTACTGTATCCAGTGCGATCTTCTGCAGCCC GGTTGGGATACCAATCAAGTCCAAAAGGATCATGAAAATCACAAAAAAGA TGAGGGCCTCCCACTGCCGGGCATCCTGGTGCAGGAGGAATTTCTTAGCG TGGATGAGGGCGCCCAACTTATAGCCGACTTGGATGACCTGCCATGGGAC ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT TAAAAAGCGGAAACTGCGGTTGGGTTCCTTTGCAGGATTTCCTAGGACTA CGGAATATGTGCAACGGCGCTTCGAAGACGTTCCCCTTCTTCGTGGCTTC CAGACCATTGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG CATAGATCCGCACGTGGACGATTGCTGGATCTGGGGCGAGCGTGTGGTCA CTGTAAACTGCCTCGGCGACTCAGTGCTCACTCTGACGCCGTACGAAGTC CAACAACAGGGCAAGTACAACTTGGACCTGGTGGCCAGCTACGAAGATGA ACTATTGGCGCCTCTGCTGACAGATGACCAACTTGCAACTTTTGAGGGAA AGGTGCTGCGCATACCTATGCCAAACCTCTCCCTGATAGTTTTGTATGGA CCAGCGAGGTACCAGTTTGAGCATTCTGTACTACGCGAGGATGTCCAAGA GCGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATTAATG GAGCAGACATCCAGAAGGGAGATCCTGTCCGAGAGAAGTCTCAGATATTC TGGCAAATAAAC >D_yakuba_CG4036-PB ATGAATACAATTCGTCCTTGCGGTTGCAAGGGTGTGCGCACCTGCTTAGG CTGCGAACAGGACTTTCAGATAGCGAAGCCCTCGCTGCAGGAACAGTTCC AGCAACTGGAAGCCTGGTCCTACTGCATCCAGTGCGACCTACTGCAGCCC GGTTGGGATACCACTAAAGTCCAAAAGGATCATGAACATCACAAAAAGGA TGAGGGCCTTCCGCTGCCGGGCATCCTGGTGCAGGAGAACTTCCTCAGTG AGGAGGAAGGCTCCCAACTGATAGCCGACCTGGACGACCTGCCATGGGAC ATCTCGCAGAGCGGCAGGCGAAAACAGAACTTCGGACCCAAGACCAACTT CAAGAAACGCAAACTGCGGTTGGGATCCTTTGCAGGATTCCCCAGGACAA CGGAATACGTGCAGCGGCGCTTCGAAGAGGTTCCCCTGCTTCGTGGCTTT CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGGGCCAG CATAGATCCGCACGTGGACGACTGCTGGATCTGGGGCGAGCGAGTGGTCA CTGTCAACTGCCTCGGCGACTCTGTGCTCACTCTGACTCCCTACGAAGTC CAGCAACCGGGGAAGTATAACTTGGACTTGGTGGCTAGCTACGAAAATGA ACTGGTGGCGCCTCTGTTGATTGAGGACCAACTTGTCAGTTTCGAAGGAA AGGTGTTGCGGATTCCTATGCCAAATCTCTCCCTGATTGCGTTGTATGGA CCAGCGAGGTACCAGTTCGAGCATTCTGTACTCCGCGAGGATGTCCAGGA ACGCCGCGTTTGTGTAGCCTACCGGGAGTTTACGCCCATGTACATCAATG GAGAAGATATCCAACAGGGGGATCCTGTTCGTGAAAAGTCCCAGATATTT TGGCAAATAAAC >D_erecta_CG4036-PB ATGAATACAATTCGTCCTTGTGGTTGCAAGGGTGTGCGCACCTGCTTAAG CTGCGAACAGGACTTTCAGATAGCGAAGCCCTCGCTGCAGGAGCAGTTCC AGCAACTGGAAGCCTGGTCCTACTGCATCCAGTGCGATCTTCTGCAGCCG GGTTGGGATACCACTAAAGTCCAAAAGGATCATGAACATCACAAAAAGGA CGAGGGCCTTCCACTGCCGGGCATCCTGGTGCAGGAGAAATTCCTCAGTG CGGAGGAGGGCTCCCGACTGATAGCCGACCTGGATGACCTGCCATGGGAC ATCTCGCAGAGCGGCAGGCGGAAACAGAACTTCGGACCCAAGACTAACTT CAAAAAGCGCAAGCTGCGTTTGGGATCTTTTGCAGGATTCCCCAGGACAA CGGAATACGTGCAGCGGCGCTTCGAAGAGGTTCCCCTGCTTCGTGGCTTT CAGACCATCGAACAGTGCTCCCTGGAGTACGAGCCCAGCAAAGGAGCCAG CATAGATCCGCACGTGGACGATTGCTGGATTTGGGGAGAGCGAGTGGTGA CTGTCAACTGCCTCGGCGACGCCGTGCTCACGCTGACGCCCTTCGAAGTC CAACCACCGGGCAAGTATAACTTGGACTTGGTGGCTAGCTACGAGGATGA ACTGCTGGCGCCGCTGTTGAATGAGGACCAACTTGCCAGTTTCGAGGGCA AGGTGCTGCGCATCCCTATGCCAAATCTTTCCTTGATAGTTTTGTATGGA CCAGCGAGGTACCAGTTTGAGCATTCCGTGCTCCGCGAGGATGTCCAGGA ACGCCGCGTGTGTGTTGCCTACCGGGAGTTTACGCCCATGTACATCAATG GAGAAGATATCCAAAAGGGGGATCCTGTCCGAGAAAAGTCCCACATATTT TGGCAAATAAAC
>D_melanogaster_CG4036-PB MNTIRPCGCKGVRTCLSCEQDFHIAKTSLREQFQQLEAWSYCIQCDLLQR GWDTNHVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV QQSGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG PARYQFEHSVLREDVQERRVCVAYREFTPMYINGVDIQKGDPVREKSQIF WQIN >D_sechellia_CG4036-PB MNTIRPCGCKGVRTCLSCEQNFQIAKTSLKEQFQQLEAWSYCIQCDLLQP GWDTNQVQKDHENHKKDEGLPLPGILVQEEFLSVDEGAQLIADLDDLPWD ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEDVPLLRGF QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV QQQGKYNLDLVASYEDELLAPLLTDDQLATFEGKVLRIPMPNLSLIVLYG PARYQFEHSVLREDVQERRVCVAYREFTPMYINGADIQKGDPVREKSQIF WQIN >D_yakuba_CG4036-PB MNTIRPCGCKGVRTCLGCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP GWDTTKVQKDHEHHKKDEGLPLPGILVQENFLSEEEGSQLIADLDDLPWD ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDSVLTLTPYEV QQPGKYNLDLVASYENELVAPLLIEDQLVSFEGKVLRIPMPNLSLIALYG PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQQGDPVREKSQIF WQIN >D_erecta_CG4036-PB MNTIRPCGCKGVRTCLSCEQDFQIAKPSLQEQFQQLEAWSYCIQCDLLQP GWDTTKVQKDHEHHKKDEGLPLPGILVQEKFLSAEEGSRLIADLDDLPWD ISQSGRRKQNFGPKTNFKKRKLRLGSFAGFPRTTEYVQRRFEEVPLLRGF QTIEQCSLEYEPSKGASIDPHVDDCWIWGERVVTVNCLGDAVLTLTPFEV QPPGKYNLDLVASYEDELLAPLLNEDQLASFEGKVLRIPMPNLSLIVLYG PARYQFEHSVLREDVQERRVCVAYREFTPMYINGEDIQKGDPVREKSHIF WQIN
#NEXUS
[ID: 1906359323]
begin taxa;
dimensions ntax=4;
taxlabels
D_melanogaster_CG4036-PB
D_sechellia_CG4036-PB
D_yakuba_CG4036-PB
D_erecta_CG4036-PB
;
end;
begin trees;
translate
1 D_melanogaster_CG4036-PB,
2 D_sechellia_CG4036-PB,
3 D_yakuba_CG4036-PB,
4 D_erecta_CG4036-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.03093808,2:0.03871397,(3:0.05946061,4:0.06675446)1.000:0.125772);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.03093808,2:0.03871397,(3:0.05946061,4:0.06675446):0.125772);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1991.87 -2002.53
2 -1991.98 -2001.23
--------------------------------------
TOTAL -1991.92 -2002.08
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/138/CG4036-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.332496 0.002879 0.229203 0.433222 0.327453 1031.69 1173.30 1.000
r(A<->C){all} 0.075611 0.000730 0.026556 0.128975 0.073943 809.45 850.25 1.000
r(A<->G){all} 0.190119 0.001901 0.112214 0.280409 0.186920 843.27 845.54 1.000
r(A<->T){all} 0.108213 0.001282 0.043584 0.179724 0.105112 844.45 991.85 1.000
r(C<->G){all} 0.039748 0.000338 0.007656 0.075205 0.037530 927.97 1031.50 1.000
r(C<->T){all} 0.465573 0.003902 0.347164 0.588151 0.464846 641.75 667.88 1.000
r(G<->T){all} 0.120736 0.001116 0.059806 0.186650 0.118597 693.59 951.84 1.000
pi(A){all} 0.249578 0.000187 0.221597 0.275023 0.249467 1213.11 1244.34 1.000
pi(C){all} 0.266669 0.000202 0.239197 0.294829 0.266650 1203.42 1284.49 1.000
pi(G){all} 0.274923 0.000211 0.247489 0.303375 0.274998 1159.70 1330.35 1.000
pi(T){all} 0.208831 0.000160 0.184585 0.233665 0.208557 1281.20 1306.31 1.000
alpha{1,2} 0.041770 0.000847 0.000167 0.095557 0.038512 1381.24 1382.24 1.000
alpha{3} 2.694875 0.792477 1.216518 4.481324 2.575224 1350.70 1365.88 1.000
pinvar{all} 0.401152 0.007453 0.232133 0.559242 0.411596 1112.38 1189.21 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/138/CG4036-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 304
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 7 8 5 6 | Ser TCT 2 2 2 1 | Tyr TAT 2 2 2 2 | Cys TGT 3 3 1 2
TTC 6 5 8 8 | TCC 4 4 6 6 | TAC 8 8 8 7 | TGC 7 7 9 8
Leu TTA 0 0 1 1 | TCA 1 1 0 0 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 8 6 6 6 | TCG 3 2 2 2 | TAG 0 0 0 0 | Trp TGG 6 6 6 6
------------------------------------------------------------------------------------------------------
Leu CTT 5 6 3 5 | Pro CCT 4 5 4 3 | His CAT 4 2 3 3 | Arg CGT 3 3 3 3
CTC 4 4 5 4 | CCC 6 5 8 7 | CAC 2 2 2 3 | CGC 8 6 6 7
CTA 4 3 1 0 | CCA 4 4 3 5 | Gln CAA 11 11 7 6 | CGA 2 2 2 3
CTG 11 13 15 16 | CCG 2 3 4 5 | CAG 11 14 18 15 | CGG 4 4 4 3
------------------------------------------------------------------------------------------------------
Ile ATT 1 3 4 2 | Thr ACT 3 4 4 3 | Asn AAT 4 4 4 4 | Ser AGT 0 0 2 2
ATC 7 5 7 7 | ACC 5 5 4 3 | AAC 6 7 6 5 | AGC 6 6 4 5
ATA 7 7 5 6 | ACA 3 2 2 2 | Lys AAA 6 6 6 6 | Arg AGA 0 0 0 0
Met ATG 3 3 3 3 | ACG 3 3 2 4 | AAG 9 10 9 11 | AGG 3 3 3 3
------------------------------------------------------------------------------------------------------
Val GTT 7 3 3 3 | Ala GCT 0 1 1 1 | Asp GAT 11 12 7 10 | Gly GGT 2 3 3 3
GTC 5 5 6 5 | GCC 6 5 4 6 | GAC 11 9 11 9 | GGC 10 9 8 8
GTA 3 3 2 0 | GCA 2 3 1 1 | Glu GAA 12 10 15 11 | GGA 6 7 6 7
GTG 6 9 9 11 | GCG 3 3 4 4 | GAG 11 13 12 15 | GGG 1 0 3 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG4036-PB
position 1: T:0.18750 C:0.27961 A:0.21711 G:0.31579
position 2: T:0.27632 C:0.16776 A:0.35526 G:0.20066
position 3: T:0.19079 C:0.33224 A:0.20066 G:0.27632
Average T:0.21820 C:0.25987 A:0.25768 G:0.26425
#2: D_sechellia_CG4036-PB
position 1: T:0.17763 C:0.28618 A:0.22368 G:0.31250
position 2: T:0.27303 C:0.17105 A:0.36184 G:0.19408
position 3: T:0.20066 C:0.30263 A:0.19408 G:0.30263
Average T:0.21711 C:0.25329 A:0.25987 G:0.26974
#3: D_yakuba_CG4036-PB
position 1: T:0.18421 C:0.28947 A:0.21382 G:0.31250
position 2: T:0.27303 C:0.16776 A:0.36184 G:0.19737
position 3: T:0.16776 C:0.33553 A:0.16776 G:0.32895
Average T:0.20833 C:0.26425 A:0.24781 G:0.27961
#4: D_erecta_CG4036-PB
position 1: T:0.18092 C:0.28947 A:0.21711 G:0.31250
position 2: T:0.27303 C:0.17434 A:0.35197 G:0.20066
position 3: T:0.17434 C:0.32237 A:0.15789 G:0.34539
Average T:0.20943 C:0.26206 A:0.24232 G:0.28618
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 26 | Ser S TCT 7 | Tyr Y TAT 8 | Cys C TGT 9
TTC 27 | TCC 20 | TAC 31 | TGC 31
Leu L TTA 2 | TCA 2 | *** * TAA 0 | *** * TGA 0
TTG 26 | TCG 9 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 19 | Pro P CCT 16 | His H CAT 12 | Arg R CGT 12
CTC 17 | CCC 26 | CAC 9 | CGC 27
CTA 8 | CCA 16 | Gln Q CAA 35 | CGA 9
CTG 55 | CCG 14 | CAG 58 | CGG 15
------------------------------------------------------------------------------
Ile I ATT 10 | Thr T ACT 14 | Asn N AAT 16 | Ser S AGT 4
ATC 26 | ACC 17 | AAC 24 | AGC 21
ATA 25 | ACA 9 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 39 | AGG 12
------------------------------------------------------------------------------
Val V GTT 16 | Ala A GCT 3 | Asp D GAT 40 | Gly G GGT 11
GTC 21 | GCC 21 | GAC 40 | GGC 35
GTA 8 | GCA 7 | Glu E GAA 48 | GGA 26
GTG 35 | GCG 14 | GAG 51 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18257 C:0.28618 A:0.21793 G:0.31332
position 2: T:0.27385 C:0.17023 A:0.35773 G:0.19819
position 3: T:0.18339 C:0.32319 A:0.18010 G:0.31332
Average T:0.21327 C:0.25987 A:0.25192 G:0.27495
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG4036-PB
D_sechellia_CG4036-PB 0.0792 (0.0122 0.1544)
D_yakuba_CG4036-PB 0.0970 (0.0373 0.3844) 0.0766 (0.0336 0.4379)
D_erecta_CG4036-PB 0.0842 (0.0343 0.4074) 0.0711 (0.0313 0.4410) 0.0830 (0.0202 0.2441)
Model 0: one-ratio
TREE # 1: (1, 2, (3, 4)); MP score: 141
lnL(ntime: 5 np: 7): -1895.569596 +0.000000
5..1 5..2 5..6 6..3 6..4
0.061671 0.074705 0.188927 0.110544 0.111287 1.649178 0.089466
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.54713
(1: 0.061671, 2: 0.074705, (3: 0.110544, 4: 0.111287): 0.188927);
(D_melanogaster_CG4036-PB: 0.061671, D_sechellia_CG4036-PB: 0.074705, (D_yakuba_CG4036-PB: 0.110544, D_erecta_CG4036-PB: 0.111287): 0.188927);
Detailed output identifying parameters
kappa (ts/tv) = 1.64918
omega (dN/dS) = 0.08947
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.062 693.6 218.4 0.0895 0.0060 0.0668 4.1 14.6
5..2 0.075 693.6 218.4 0.0895 0.0072 0.0810 5.0 17.7
5..6 0.189 693.6 218.4 0.0895 0.0183 0.2048 12.7 44.7
6..3 0.111 693.6 218.4 0.0895 0.0107 0.1198 7.4 26.2
6..4 0.111 693.6 218.4 0.0895 0.0108 0.1206 7.5 26.3
tree length for dN: 0.0531
tree length for dS: 0.5931
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, (3, 4)); MP score: 141
lnL(ntime: 5 np: 8): -1889.964519 +0.000000
5..1 5..2 5..6 6..3 6..4
0.061936 0.077067 0.196292 0.111448 0.113250 1.709838 0.929033 0.038484
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.55999
(1: 0.061936, 2: 0.077067, (3: 0.111448, 4: 0.113250): 0.196292);
(D_melanogaster_CG4036-PB: 0.061936, D_sechellia_CG4036-PB: 0.077067, (D_yakuba_CG4036-PB: 0.111448, D_erecta_CG4036-PB: 0.113250): 0.196292);
Detailed output identifying parameters
kappa (ts/tv) = 1.70984
dN/dS (w) for site classes (K=2)
p: 0.92903 0.07097
w: 0.03848 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.062 692.1 219.9 0.1067 0.0068 0.0641 4.7 14.1
5..2 0.077 692.1 219.9 0.1067 0.0085 0.0797 5.9 17.5
5..6 0.196 692.1 219.9 0.1067 0.0217 0.2031 15.0 44.7
6..3 0.111 692.1 219.9 0.1067 0.0123 0.1153 8.5 25.4
6..4 0.113 692.1 219.9 0.1067 0.0125 0.1172 8.7 25.8
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, (3, 4)); MP score: 141
lnL(ntime: 5 np: 10): -1889.964519 +0.000000
5..1 5..2 5..6 6..3 6..4
0.061936 0.077067 0.196292 0.111448 0.113250 1.709837 0.929033 0.070967 0.038484 3.483966
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.55999
(1: 0.061936, 2: 0.077067, (3: 0.111448, 4: 0.113250): 0.196292);
(D_melanogaster_CG4036-PB: 0.061936, D_sechellia_CG4036-PB: 0.077067, (D_yakuba_CG4036-PB: 0.111448, D_erecta_CG4036-PB: 0.113250): 0.196292);
Detailed output identifying parameters
kappa (ts/tv) = 1.70984
dN/dS (w) for site classes (K=3)
p: 0.92903 0.07097 0.00000
w: 0.03848 1.00000 3.48397
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.062 692.1 219.9 0.1067 0.0068 0.0641 4.7 14.1
5..2 0.077 692.1 219.9 0.1067 0.0085 0.0797 5.9 17.5
5..6 0.196 692.1 219.9 0.1067 0.0217 0.2031 15.0 44.7
6..3 0.111 692.1 219.9 0.1067 0.0123 0.1153 8.5 25.4
6..4 0.113 692.1 219.9 0.1067 0.0125 0.1172 8.7 25.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG4036-PB)
Pr(w>1) post mean +- SE for w
56 H 0.542 1.319 +- 0.618
80 E 0.511 1.274 +- 0.604
203 S 0.528 1.301 +- 0.632
224 T 0.624 1.433 +- 0.660
285 V 0.550 1.333 +- 0.639
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.829 0.138 0.024 0.006 0.002 0.001 0.000 0.000 0.000 0.000
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.996
sum of density on p0-p1 = 1.000000
Time used: 0:10
Model 3: discrete (3 categories)
TREE # 1: (1, 2, (3, 4)); MP score: 141
lnL(ntime: 5 np: 11): -1889.307920 +0.000000
5..1 5..2 5..6 6..3 6..4
0.061958 0.075871 0.194083 0.110802 0.112749 1.679872 0.589591 0.189912 0.000001 0.000001 0.438094
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.55546
(1: 0.061958, 2: 0.075871, (3: 0.110802, 4: 0.112749): 0.194083);
(D_melanogaster_CG4036-PB: 0.061958, D_sechellia_CG4036-PB: 0.075871, (D_yakuba_CG4036-PB: 0.110802, D_erecta_CG4036-PB: 0.112749): 0.194083);
Detailed output identifying parameters
kappa (ts/tv) = 1.67987
dN/dS (w) for site classes (K=3)
p: 0.58959 0.18991 0.22050
w: 0.00000 0.00000 0.43809
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.062 692.8 219.2 0.0966 0.0064 0.0658 4.4 14.4
5..2 0.076 692.8 219.2 0.0966 0.0078 0.0806 5.4 17.7
5..6 0.194 692.8 219.2 0.0966 0.0199 0.2062 13.8 45.2
6..3 0.111 692.8 219.2 0.0966 0.0114 0.1177 7.9 25.8
6..4 0.113 692.8 219.2 0.0966 0.0116 0.1198 8.0 26.3
Naive Empirical Bayes (NEB) analysis
Time used: 0:15
Model 7: beta (10 categories)
TREE # 1: (1, 2, (3, 4)); MP score: 141
lnL(ntime: 5 np: 8): -1889.460509 +0.000000
5..1 5..2 5..6 6..3 6..4
0.061916 0.076122 0.194500 0.110947 0.112792 1.681062 0.109894 0.977360
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.55628
(1: 0.061916, 2: 0.076122, (3: 0.110947, 4: 0.112792): 0.194500);
(D_melanogaster_CG4036-PB: 0.061916, D_sechellia_CG4036-PB: 0.076122, (D_yakuba_CG4036-PB: 0.110947, D_erecta_CG4036-PB: 0.112792): 0.194500);
Detailed output identifying parameters
kappa (ts/tv) = 1.68106
Parameters in M7 (beta):
p = 0.10989 q = 0.97736
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00007 0.00072 0.00449 0.02054 0.07545 0.23482 0.63889
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.062 692.8 219.2 0.0975 0.0064 0.0656 4.4 14.4
5..2 0.076 692.8 219.2 0.0975 0.0079 0.0807 5.5 17.7
5..6 0.195 692.8 219.2 0.0975 0.0201 0.2062 13.9 45.2
6..3 0.111 692.8 219.2 0.0975 0.0115 0.1176 7.9 25.8
6..4 0.113 692.8 219.2 0.0975 0.0117 0.1196 8.1 26.2
Time used: 0:24
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, (3, 4)); MP score: 141
check convergence..
lnL(ntime: 5 np: 10): -1889.460533 +0.000000
5..1 5..2 5..6 6..3 6..4
0.061916 0.076122 0.194501 0.110947 0.112792 1.681066 0.999990 0.109896 0.977454 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.55628
(1: 0.061916, 2: 0.076122, (3: 0.110947, 4: 0.112792): 0.194501);
(D_melanogaster_CG4036-PB: 0.061916, D_sechellia_CG4036-PB: 0.076122, (D_yakuba_CG4036-PB: 0.110947, D_erecta_CG4036-PB: 0.112792): 0.194501);
Detailed output identifying parameters
kappa (ts/tv) = 1.68107
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.10990 q = 0.97745
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00007 0.00072 0.00449 0.02054 0.07544 0.23480 0.63885 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.062 692.8 219.2 0.0975 0.0064 0.0656 4.4 14.4
5..2 0.076 692.8 219.2 0.0975 0.0079 0.0807 5.5 17.7
5..6 0.195 692.8 219.2 0.0975 0.0201 0.2062 13.9 45.2
6..3 0.111 692.8 219.2 0.0975 0.0115 0.1176 7.9 25.8
6..4 0.113 692.8 219.2 0.0975 0.0117 0.1196 8.1 26.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG4036-PB)
Pr(w>1) post mean +- SE for w
30 R 0.557 1.071 +- 0.648
56 H 0.642 1.182 +- 0.625
80 E 0.603 1.131 +- 0.630
84 V 0.583 1.105 +- 0.640
203 S 0.620 1.154 +- 0.634
224 T 0.744 1.315 +- 0.590
285 V 0.649 1.193 +- 0.628
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.004 0.025 0.077 0.166 0.290 0.438
ws: 0.921 0.070 0.007 0.001 0.000 0.000 0.000 0.000 0.000 0.000
Time used: 0:43
Model 1: NearlyNeutral -1889.964519 Model 2: PositiveSelection -1889.964519 Model 0: one-ratio -1895.569596 Model 3: discrete -1889.30792 Model 7: beta -1889.460509 Model 8: beta&w>1 -1889.460533 Model 0 vs 1 11.210153999999875 Model 2 vs 1 0.0 Model 8 vs 7 4.799999987881165E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
