--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Jan 24 09:29:49 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/6res/ML1306/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1110.95 -1116.25 2 -1111.01 -1114.04 -------------------------------------- TOTAL -1110.98 -1115.66 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898407 0.085046 0.358458 1.463366 0.868765 1501.00 1501.00 1.000 r(A<->C){all} 0.153167 0.017877 0.000109 0.426474 0.117168 192.00 193.11 1.001 r(A<->G){all} 0.172905 0.021451 0.000119 0.474471 0.134703 221.19 237.59 1.002 r(A<->T){all} 0.161169 0.018959 0.000053 0.442735 0.122687 415.33 424.54 1.000 r(C<->G){all} 0.179303 0.020589 0.000006 0.468777 0.147868 222.77 302.26 1.009 r(C<->T){all} 0.165050 0.021208 0.000008 0.466203 0.122026 165.04 169.95 1.000 r(G<->T){all} 0.168407 0.019792 0.000012 0.455699 0.130199 250.18 259.67 1.001 pi(A){all} 0.194612 0.000192 0.169568 0.224507 0.194529 1090.14 1220.43 1.001 pi(C){all} 0.289595 0.000241 0.259497 0.319912 0.289711 1156.27 1314.83 1.000 pi(G){all} 0.340704 0.000276 0.308668 0.373637 0.340468 1248.49 1315.05 1.000 pi(T){all} 0.175090 0.000174 0.150475 0.201502 0.174776 1204.26 1205.32 1.000 alpha{1,2} 0.421717 0.241729 0.000148 1.402246 0.246173 953.81 1075.28 1.002 alpha{3} 0.450212 0.242088 0.000236 1.412011 0.279265 1177.13 1250.52 1.000 pinvar{all} 0.998146 0.000005 0.994120 1.000000 0.998829 1047.43 1114.52 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1065.414469 Model 2: PositiveSelection -1065.414313 Model 0: one-ratio -1065.414765 Model 7: beta -1065.414313 Model 8: beta&w>1 -1065.414313 Model 0 vs 1 5.919999998695857E-4 Model 2 vs 1 3.120000001217704E-4 Model 8 vs 7 0.0
>C1 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C2 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C3 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C4 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C5 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C6 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=274 C1 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C2 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C3 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C4 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C5 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C6 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ ************************************************** C1 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C2 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C3 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C4 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C5 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C6 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA ************************************************** C1 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C2 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C3 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C4 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C5 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C6 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT ************************************************** C1 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C2 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C3 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C4 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C5 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C6 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV ************************************************** C1 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C2 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C3 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C4 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C5 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C6 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG ************************************************** C1 KIDGDALAAEFERYLRRRRPGFGR C2 KIDGDALAAEFERYLRRRRPGFGR C3 KIDGDALAAEFERYLRRRRPGFGR C4 KIDGDALAAEFERYLRRRRPGFGR C5 KIDGDALAAEFERYLRRRRPGFGR C6 KIDGDALAAEFERYLRRRRPGFGR ************************ PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 274 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 274 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [8220] Library Relaxation: Multi_proc [96] Relaxation Summary: [8220]--->[8220] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.500 Mb, Max= 30.831 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C2 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C3 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C4 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C5 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ C6 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ ************************************************** C1 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C2 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C3 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C4 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C5 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA C6 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA ************************************************** C1 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C2 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C3 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C4 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C5 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT C6 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT ************************************************** C1 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C2 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C3 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C4 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C5 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV C6 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV ************************************************** C1 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C2 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C3 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C4 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C5 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG C6 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG ************************************************** C1 KIDGDALAAEFERYLRRRRPGFGR C2 KIDGDALAAEFERYLRRRRPGFGR C3 KIDGDALAAEFERYLRRRRPGFGR C4 KIDGDALAAEFERYLRRRRPGFGR C5 KIDGDALAAEFERYLRRRRPGFGR C6 KIDGDALAAEFERYLRRRRPGFGR ************************ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC C2 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC C3 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC C4 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC C5 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC C6 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC ************************************************** C1 CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG C2 CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG C3 CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG C4 CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG C5 CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG C6 CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ************************************************** C1 ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG C2 ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG C3 ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG C4 ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG C5 ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG C6 ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG ************************************************** C1 GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA C2 GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA C3 GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA C4 GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA C5 GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA C6 GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA ************************************************** C1 CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG C2 CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG C3 CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG C4 CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG C5 CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG C6 CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG ************************************************** C1 AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG C2 AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG C3 AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG C4 AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG C5 AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG C6 AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG ************************************************** C1 GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA C2 GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA C3 GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA C4 GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA C5 GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA C6 GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA ************************************************** C1 CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG C2 CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG C3 CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG C4 CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG C5 CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG C6 CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG ************************************************** C1 AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA C2 AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA C3 AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA C4 AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA C5 AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA C6 AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA ************************************************** C1 GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC C2 GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC C3 GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC C4 GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC C5 GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC C6 GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC ************************************************** C1 GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC C2 GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC C3 GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC C4 GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC C5 GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC C6 GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC ************************************************** C1 CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC C2 CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC C3 CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC C4 CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC C5 CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC C6 CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC ************************************************** C1 GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC C2 GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC C3 GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC C4 GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC C5 GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC C6 GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC ************************************************** C1 AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT C2 AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT C3 AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT C4 AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT C5 AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT C6 AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT ************************************************** C1 CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC C2 CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC C3 CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC C4 CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC C5 CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC C6 CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC ************************************************** C1 AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG C2 AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG C3 AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG C4 AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG C5 AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG C6 AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG ************************************************** C1 GCGGCGCCCGGGATTCGGGCGG C2 GCGGCGCCCGGGATTCGGGCGG C3 GCGGCGCCCGGGATTCGGGCGG C4 GCGGCGCCCGGGATTCGGGCGG C5 GCGGCGCCCGGGATTCGGGCGG C6 GCGGCGCCCGGGATTCGGGCGG ********************** >C1 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >C2 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >C3 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >C4 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >C5 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >C6 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >C1 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C2 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C3 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C4 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C5 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >C6 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 822 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579858103 Setting output file names to "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 1122418326 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5493071704 Seed = 1564511464 Swapseed = 1579858103 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1839.675407 -- -24.965149 Chain 2 -- -1839.675301 -- -24.965149 Chain 3 -- -1839.675126 -- -24.965149 Chain 4 -- -1839.675301 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1839.675126 -- -24.965149 Chain 2 -- -1839.675407 -- -24.965149 Chain 3 -- -1839.675407 -- -24.965149 Chain 4 -- -1839.675301 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1839.675] (-1839.675) (-1839.675) (-1839.675) * [-1839.675] (-1839.675) (-1839.675) (-1839.675) 500 -- (-1135.137) (-1129.426) (-1119.433) [-1122.601] * [-1122.606] (-1133.130) (-1148.106) (-1141.193) -- 0:00:00 1000 -- (-1134.299) (-1124.124) (-1119.472) [-1118.451] * (-1129.270) [-1115.187] (-1121.955) (-1117.502) -- 0:00:00 1500 -- (-1126.207) (-1119.461) [-1117.710] (-1121.322) * (-1125.621) [-1120.921] (-1119.482) (-1122.256) -- 0:00:00 2000 -- (-1117.293) (-1114.438) (-1121.554) [-1116.016] * [-1119.250] (-1116.191) (-1122.951) (-1119.280) -- 0:00:00 2500 -- (-1117.362) [-1119.387] (-1118.740) (-1122.527) * [-1116.385] (-1117.675) (-1122.070) (-1119.905) -- 0:06:39 3000 -- (-1117.080) (-1114.205) [-1117.847] (-1116.212) * [-1122.410] (-1119.686) (-1118.352) (-1121.422) -- 0:05:32 3500 -- [-1117.046] (-1120.499) (-1125.488) (-1121.903) * [-1123.257] (-1123.523) (-1119.079) (-1118.091) -- 0:04:44 4000 -- (-1124.122) (-1124.482) [-1115.470] (-1121.267) * (-1120.811) (-1122.132) [-1118.284] (-1120.115) -- 0:04:09 4500 -- (-1130.046) (-1116.824) [-1116.622] (-1124.345) * (-1122.692) (-1121.872) [-1123.089] (-1121.056) -- 0:03:41 5000 -- (-1121.109) (-1122.692) [-1113.963] (-1119.458) * (-1118.935) (-1116.806) (-1122.265) [-1117.675] -- 0:03:19 Average standard deviation of split frequencies: 0.088815 5500 -- (-1126.770) (-1116.376) (-1118.175) [-1120.810] * [-1124.401] (-1122.921) (-1119.529) (-1127.128) -- 0:03:00 6000 -- [-1120.556] (-1126.051) (-1118.227) (-1116.031) * [-1119.885] (-1120.376) (-1126.503) (-1121.510) -- 0:02:45 6500 -- (-1121.929) (-1116.734) (-1128.125) [-1117.503] * (-1125.399) (-1118.212) [-1119.446] (-1126.007) -- 0:02:32 7000 -- (-1124.513) (-1123.744) [-1123.761] (-1129.365) * (-1124.333) (-1121.951) (-1125.320) [-1121.905] -- 0:02:21 7500 -- [-1119.991] (-1122.727) (-1125.710) (-1122.341) * (-1133.486) (-1117.361) (-1122.437) [-1117.019] -- 0:02:12 8000 -- (-1122.702) (-1124.363) [-1119.740] (-1133.060) * (-1120.965) (-1124.020) [-1120.904] (-1118.417) -- 0:02:04 8500 -- (-1120.342) (-1125.047) [-1119.188] (-1126.314) * (-1123.505) (-1127.155) (-1125.780) [-1118.838] -- 0:01:56 9000 -- (-1117.034) (-1128.005) [-1118.296] (-1117.917) * (-1129.778) [-1118.342] (-1121.910) (-1124.571) -- 0:01:50 9500 -- [-1121.007] (-1120.822) (-1131.933) (-1113.960) * (-1123.831) (-1128.328) [-1120.941] (-1116.217) -- 0:01:44 10000 -- (-1120.144) (-1121.816) (-1123.317) [-1120.936] * (-1114.188) [-1118.156] (-1127.146) (-1126.852) -- 0:01:39 Average standard deviation of split frequencies: 0.067344 10500 -- (-1116.877) (-1121.152) [-1120.822] (-1119.608) * (-1120.681) [-1119.890] (-1127.326) (-1120.269) -- 0:01:34 11000 -- (-1122.819) [-1122.622] (-1121.651) (-1121.810) * (-1128.784) (-1118.615) (-1117.162) [-1120.163] -- 0:01:29 11500 -- (-1118.844) (-1123.965) [-1129.139] (-1124.538) * (-1121.617) [-1113.397] (-1111.936) (-1126.024) -- 0:01:25 12000 -- (-1123.230) (-1123.255) (-1115.086) [-1116.510] * (-1124.441) [-1116.103] (-1112.588) (-1121.312) -- 0:01:22 12500 -- (-1124.807) [-1123.669] (-1115.728) (-1118.994) * [-1122.582] (-1120.797) (-1114.067) (-1121.179) -- 0:01:19 13000 -- [-1117.543] (-1129.723) (-1120.105) (-1124.406) * (-1123.402) (-1120.776) [-1111.388] (-1122.445) -- 0:01:15 13500 -- (-1119.518) [-1120.732] (-1121.659) (-1120.052) * (-1120.335) (-1117.560) [-1110.965] (-1121.067) -- 0:01:13 14000 -- (-1119.964) (-1117.695) [-1117.447] (-1131.454) * (-1114.128) [-1123.633] (-1115.382) (-1121.793) -- 0:01:10 14500 -- (-1121.669) [-1120.357] (-1115.041) (-1118.526) * [-1115.741] (-1128.383) (-1118.154) (-1119.951) -- 0:01:07 15000 -- (-1122.174) (-1122.021) [-1118.303] (-1122.960) * (-1121.432) (-1128.806) (-1114.983) [-1121.361] -- 0:02:11 Average standard deviation of split frequencies: 0.081373 15500 -- [-1115.181] (-1118.192) (-1122.755) (-1120.044) * (-1125.365) [-1115.645] (-1110.773) (-1119.363) -- 0:02:07 16000 -- (-1120.935) (-1131.655) (-1120.092) [-1122.660] * (-1134.077) (-1117.042) (-1111.091) [-1116.616] -- 0:02:03 16500 -- [-1124.655] (-1125.425) (-1127.769) (-1113.104) * (-1121.382) [-1118.551] (-1111.450) (-1127.537) -- 0:01:59 17000 -- (-1127.396) (-1130.166) [-1114.307] (-1117.826) * [-1119.491] (-1122.459) (-1110.195) (-1120.566) -- 0:01:55 17500 -- (-1117.878) (-1125.604) (-1121.727) [-1112.436] * (-1123.699) (-1120.763) (-1109.900) [-1121.080] -- 0:01:52 18000 -- (-1113.703) (-1122.705) [-1122.121] (-1111.831) * (-1118.303) [-1117.578] (-1110.699) (-1118.064) -- 0:01:49 18500 -- (-1119.446) (-1117.772) [-1117.909] (-1110.563) * (-1126.697) (-1118.786) [-1110.388] (-1119.642) -- 0:01:46 19000 -- (-1125.149) [-1115.884] (-1117.116) (-1109.886) * (-1132.148) [-1119.669] (-1115.209) (-1123.466) -- 0:01:43 19500 -- (-1126.743) [-1132.323] (-1124.731) (-1111.673) * (-1127.377) [-1115.417] (-1113.071) (-1125.408) -- 0:01:40 20000 -- (-1123.967) (-1123.138) (-1123.384) [-1110.410] * (-1120.371) [-1117.116] (-1113.991) (-1119.631) -- 0:01:38 Average standard deviation of split frequencies: 0.078034 20500 -- (-1121.638) (-1118.684) [-1118.542] (-1110.582) * (-1116.201) (-1115.150) (-1116.553) [-1118.441] -- 0:01:35 21000 -- (-1127.579) (-1115.279) (-1119.777) [-1110.983] * (-1115.423) (-1120.893) [-1114.945] (-1117.361) -- 0:01:33 21500 -- (-1123.532) (-1118.407) [-1119.252] (-1110.433) * (-1112.314) [-1120.515] (-1115.958) (-1117.814) -- 0:01:31 22000 -- (-1119.139) (-1128.222) [-1118.831] (-1110.715) * [-1110.610] (-1122.825) (-1113.305) (-1125.119) -- 0:01:28 22500 -- [-1123.230] (-1122.322) (-1121.620) (-1110.655) * (-1112.256) (-1121.635) [-1112.108] (-1116.365) -- 0:01:26 23000 -- (-1117.895) [-1118.498] (-1120.179) (-1109.717) * (-1115.102) (-1122.237) [-1110.673] (-1117.288) -- 0:01:24 23500 -- (-1126.585) (-1120.477) (-1122.310) [-1109.976] * (-1113.775) [-1116.658] (-1109.858) (-1116.635) -- 0:01:23 24000 -- (-1120.477) (-1123.698) (-1128.294) [-1110.380] * (-1112.900) (-1117.372) [-1111.900] (-1120.570) -- 0:01:21 24500 -- [-1125.676] (-1119.770) (-1122.071) (-1111.510) * (-1111.528) (-1128.257) [-1109.904] (-1122.621) -- 0:01:19 25000 -- (-1119.262) [-1121.708] (-1125.148) (-1110.205) * (-1110.606) (-1125.657) (-1113.213) [-1121.624] -- 0:01:18 Average standard deviation of split frequencies: 0.063027 25500 -- (-1119.195) (-1124.548) (-1118.684) [-1110.071] * (-1113.327) (-1128.444) [-1112.060] (-1119.251) -- 0:01:16 26000 -- (-1124.076) (-1123.377) [-1117.991] (-1112.895) * [-1112.970] (-1121.092) (-1110.546) (-1116.618) -- 0:01:14 26500 -- [-1121.545] (-1119.684) (-1127.308) (-1112.046) * (-1110.289) (-1122.816) [-1114.649] (-1123.455) -- 0:01:13 27000 -- (-1116.211) (-1126.505) (-1119.441) [-1109.861] * (-1109.740) (-1123.409) [-1111.276] (-1121.703) -- 0:01:12 27500 -- (-1118.532) [-1121.555] (-1130.374) (-1110.887) * (-1112.601) (-1123.066) (-1110.993) [-1122.526] -- 0:01:10 28000 -- (-1137.164) (-1119.096) [-1118.840] (-1110.935) * (-1114.924) (-1127.928) (-1111.591) [-1120.580] -- 0:01:09 28500 -- (-1134.960) (-1116.916) (-1125.517) [-1111.866] * [-1110.239] (-1125.139) (-1111.664) (-1126.786) -- 0:01:08 29000 -- (-1110.177) (-1122.861) [-1121.095] (-1109.624) * (-1110.819) (-1126.214) (-1112.409) [-1114.903] -- 0:01:06 29500 -- [-1112.433] (-1125.683) (-1124.154) (-1110.747) * [-1111.697] (-1124.642) (-1110.677) (-1123.915) -- 0:01:38 30000 -- (-1113.209) [-1120.391] (-1118.649) (-1110.066) * (-1111.233) [-1110.069] (-1113.021) (-1121.950) -- 0:01:37 Average standard deviation of split frequencies: 0.067344 30500 -- (-1110.498) (-1128.158) [-1119.204] (-1112.640) * (-1113.797) (-1109.893) (-1111.693) [-1118.580] -- 0:01:35 31000 -- (-1110.614) (-1123.809) (-1114.910) [-1110.327] * (-1115.466) (-1110.446) [-1113.858] (-1120.251) -- 0:01:33 31500 -- (-1111.471) [-1120.668] (-1118.682) (-1111.775) * (-1117.834) (-1113.265) [-1110.925] (-1118.838) -- 0:01:32 32000 -- (-1111.537) (-1116.322) [-1120.658] (-1112.849) * (-1116.525) (-1115.544) [-1110.885] (-1119.804) -- 0:01:30 32500 -- (-1112.533) (-1117.625) (-1118.119) [-1111.665] * (-1120.028) (-1112.383) [-1110.151] (-1124.954) -- 0:01:29 33000 -- (-1115.776) [-1126.786] (-1119.423) (-1112.147) * (-1111.675) [-1114.038] (-1110.916) (-1128.852) -- 0:01:27 33500 -- (-1110.196) (-1125.689) [-1118.280] (-1116.482) * (-1111.304) [-1112.792] (-1110.951) (-1120.774) -- 0:01:26 34000 -- [-1109.863] (-1131.101) (-1118.072) (-1112.422) * [-1110.804] (-1111.092) (-1109.933) (-1125.318) -- 0:01:25 34500 -- [-1110.568] (-1118.334) (-1123.159) (-1113.126) * (-1115.272) [-1111.289] (-1111.239) (-1115.466) -- 0:01:23 35000 -- [-1111.616] (-1118.255) (-1116.195) (-1111.348) * [-1115.756] (-1109.869) (-1109.872) (-1113.287) -- 0:01:22 Average standard deviation of split frequencies: 0.058271 35500 -- [-1112.040] (-1129.857) (-1118.970) (-1113.527) * [-1116.611] (-1110.006) (-1109.419) (-1114.271) -- 0:01:21 36000 -- (-1116.506) (-1128.053) [-1111.916] (-1112.057) * (-1115.145) (-1112.578) (-1111.535) [-1111.013] -- 0:01:20 36500 -- (-1110.204) (-1116.443) [-1122.912] (-1111.592) * (-1112.366) (-1111.885) (-1111.595) [-1111.260] -- 0:01:19 37000 -- (-1110.394) (-1128.697) (-1129.505) [-1109.735] * (-1113.531) (-1111.561) (-1112.609) [-1113.646] -- 0:01:18 37500 -- (-1111.218) [-1119.450] (-1127.125) (-1111.131) * (-1111.609) (-1114.043) (-1115.301) [-1112.700] -- 0:01:17 38000 -- (-1110.714) (-1120.123) [-1125.387] (-1110.193) * (-1110.168) (-1114.443) (-1109.761) [-1112.875] -- 0:01:15 38500 -- (-1110.235) (-1118.360) (-1125.111) [-1113.448] * (-1111.010) [-1111.372] (-1109.530) (-1111.355) -- 0:01:14 39000 -- [-1110.363] (-1122.696) (-1124.472) (-1113.043) * (-1110.389) (-1112.116) (-1113.152) [-1111.109] -- 0:01:13 39500 -- (-1112.771) [-1118.668] (-1118.034) (-1111.791) * [-1110.287] (-1111.056) (-1112.931) (-1110.001) -- 0:01:12 40000 -- (-1110.166) (-1120.149) (-1136.776) [-1111.653] * [-1112.111] (-1109.932) (-1112.810) (-1110.712) -- 0:01:12 Average standard deviation of split frequencies: 0.054909 40500 -- [-1110.390] (-1122.134) (-1129.128) (-1111.061) * (-1112.237) [-1110.726] (-1112.055) (-1112.463) -- 0:01:11 41000 -- [-1111.913] (-1120.702) (-1118.170) (-1111.432) * (-1112.136) (-1112.554) [-1110.753] (-1113.405) -- 0:01:10 41500 -- (-1110.261) (-1116.801) (-1120.376) [-1110.193] * (-1112.983) (-1112.383) [-1111.348] (-1110.513) -- 0:01:09 42000 -- (-1111.532) (-1122.828) (-1116.203) [-1110.750] * (-1110.326) (-1112.575) (-1109.941) [-1112.087] -- 0:01:08 42500 -- (-1110.770) (-1132.400) (-1121.953) [-1109.806] * (-1110.315) (-1111.447) (-1110.362) [-1112.650] -- 0:01:07 43000 -- [-1110.173] (-1130.388) (-1125.796) (-1110.273) * (-1111.986) (-1112.604) (-1113.054) [-1111.808] -- 0:01:06 43500 -- (-1110.567) (-1121.807) (-1119.212) [-1110.305] * (-1122.431) (-1111.085) (-1111.066) [-1110.322] -- 0:01:05 44000 -- [-1110.695] (-1125.287) (-1123.485) (-1112.407) * (-1112.294) [-1112.395] (-1113.206) (-1111.464) -- 0:01:05 44500 -- (-1111.819) (-1119.675) (-1116.401) [-1115.798] * (-1112.934) (-1112.632) (-1111.762) [-1110.654] -- 0:01:25 45000 -- [-1112.763] (-1122.553) (-1120.049) (-1113.075) * (-1112.800) (-1109.773) [-1111.038] (-1113.353) -- 0:01:24 Average standard deviation of split frequencies: 0.044718 45500 -- (-1110.528) (-1118.715) (-1122.813) [-1112.262] * (-1114.504) (-1114.391) [-1111.070] (-1110.373) -- 0:01:23 46000 -- (-1110.425) (-1136.835) [-1119.070] (-1115.116) * [-1111.876] (-1110.568) (-1110.866) (-1110.260) -- 0:01:22 46500 -- (-1112.412) (-1131.593) [-1119.703] (-1111.054) * [-1112.569] (-1114.955) (-1113.811) (-1110.606) -- 0:01:22 47000 -- (-1112.398) (-1116.859) [-1118.181] (-1110.062) * (-1110.540) [-1113.375] (-1113.894) (-1114.326) -- 0:01:21 47500 -- [-1111.427] (-1120.273) (-1131.342) (-1110.104) * (-1112.632) [-1111.441] (-1111.008) (-1111.651) -- 0:01:20 48000 -- (-1111.916) (-1124.199) (-1121.083) [-1110.980] * (-1113.225) (-1111.947) (-1111.386) [-1109.482] -- 0:01:19 48500 -- [-1112.617] (-1119.799) (-1122.724) (-1110.947) * (-1112.137) (-1111.419) [-1113.186] (-1110.361) -- 0:01:18 49000 -- (-1111.785) (-1121.079) (-1125.645) [-1111.183] * (-1113.738) [-1110.646] (-1111.366) (-1110.259) -- 0:01:17 49500 -- [-1111.028] (-1130.613) (-1129.715) (-1111.541) * (-1111.988) [-1110.868] (-1111.779) (-1110.209) -- 0:01:16 50000 -- [-1111.506] (-1121.483) (-1129.156) (-1113.008) * (-1113.190) [-1109.683] (-1117.420) (-1112.315) -- 0:01:16 Average standard deviation of split frequencies: 0.040599 50500 -- (-1111.144) (-1129.097) [-1124.511] (-1113.894) * (-1118.220) (-1109.677) (-1111.725) [-1110.276] -- 0:01:15 51000 -- (-1111.374) [-1117.693] (-1119.448) (-1115.198) * (-1111.320) (-1114.959) [-1111.370] (-1111.633) -- 0:01:14 51500 -- [-1113.891] (-1118.752) (-1117.295) (-1115.664) * (-1112.874) [-1112.795] (-1112.184) (-1110.194) -- 0:01:13 52000 -- (-1113.269) (-1119.484) [-1115.691] (-1119.497) * (-1112.645) [-1114.107] (-1110.020) (-1117.830) -- 0:01:12 52500 -- (-1110.861) (-1125.234) [-1116.103] (-1119.638) * [-1112.436] (-1116.816) (-1113.130) (-1116.572) -- 0:01:12 53000 -- (-1112.923) (-1126.050) (-1123.353) [-1115.038] * [-1111.066] (-1117.649) (-1114.642) (-1115.000) -- 0:01:11 53500 -- (-1112.385) (-1125.387) (-1126.312) [-1111.628] * [-1110.780] (-1117.304) (-1112.837) (-1114.141) -- 0:01:10 54000 -- (-1112.703) (-1124.863) (-1127.710) [-1112.137] * (-1111.191) [-1117.052] (-1113.751) (-1113.362) -- 0:01:10 54500 -- (-1112.616) (-1121.982) [-1110.776] (-1114.839) * (-1113.826) [-1113.349] (-1114.602) (-1111.584) -- 0:01:09 55000 -- (-1111.236) [-1117.478] (-1112.974) (-1113.639) * [-1112.610] (-1111.015) (-1114.623) (-1113.365) -- 0:01:08 Average standard deviation of split frequencies: 0.034514 55500 -- [-1110.982] (-1124.243) (-1111.457) (-1113.359) * [-1111.485] (-1110.624) (-1114.027) (-1110.527) -- 0:01:08 56000 -- [-1115.084] (-1118.396) (-1111.475) (-1113.837) * (-1110.460) (-1110.624) [-1112.459] (-1110.041) -- 0:01:07 56500 -- (-1118.445) [-1116.048] (-1111.592) (-1110.992) * (-1113.579) (-1111.974) [-1110.411] (-1112.359) -- 0:01:06 57000 -- (-1114.835) [-1112.861] (-1114.195) (-1110.887) * [-1111.512] (-1113.072) (-1111.684) (-1111.614) -- 0:01:06 57500 -- (-1116.571) (-1120.951) [-1111.016] (-1110.442) * (-1110.430) (-1111.715) (-1110.626) [-1110.731] -- 0:01:05 58000 -- (-1111.919) (-1116.960) [-1111.154] (-1111.192) * (-1110.425) (-1110.874) (-1111.273) [-1110.420] -- 0:01:04 58500 -- [-1110.827] (-1119.006) (-1110.266) (-1111.450) * (-1114.189) (-1109.799) [-1111.345] (-1110.897) -- 0:01:04 59000 -- (-1110.886) [-1117.623] (-1110.233) (-1111.352) * (-1112.964) (-1110.556) [-1110.851] (-1110.808) -- 0:01:03 59500 -- (-1111.478) (-1121.594) [-1112.910] (-1113.452) * (-1119.160) (-1111.418) (-1109.920) [-1110.996] -- 0:01:03 60000 -- (-1111.802) [-1126.452] (-1112.993) (-1111.418) * (-1110.823) (-1112.053) [-1110.157] (-1111.095) -- 0:01:18 Average standard deviation of split frequencies: 0.031452 60500 -- [-1110.299] (-1124.650) (-1113.077) (-1112.097) * [-1111.016] (-1111.475) (-1112.248) (-1111.210) -- 0:01:17 61000 -- (-1110.545) [-1118.999] (-1111.552) (-1113.371) * (-1111.477) (-1113.502) [-1110.888] (-1111.437) -- 0:01:16 61500 -- (-1111.256) (-1128.004) [-1112.141] (-1111.413) * (-1110.579) [-1111.087] (-1113.348) (-1111.254) -- 0:01:16 62000 -- (-1111.256) (-1118.558) [-1114.262] (-1113.510) * (-1112.678) [-1112.862] (-1110.080) (-1111.435) -- 0:01:15 62500 -- [-1111.025] (-1115.912) (-1115.682) (-1117.540) * (-1116.439) [-1110.924] (-1122.729) (-1111.554) -- 0:01:15 63000 -- [-1113.476] (-1121.012) (-1111.574) (-1116.399) * (-1115.898) (-1113.008) (-1112.340) [-1110.100] -- 0:01:14 63500 -- (-1111.849) (-1120.991) (-1112.063) [-1113.426] * (-1110.506) [-1114.543] (-1114.916) (-1110.732) -- 0:01:13 64000 -- [-1112.058] (-1121.564) (-1115.485) (-1113.197) * (-1114.082) (-1113.961) (-1112.625) [-1110.277] -- 0:01:13 64500 -- (-1111.631) (-1115.301) (-1110.305) [-1110.742] * (-1112.293) [-1114.314] (-1114.307) (-1114.139) -- 0:01:12 65000 -- [-1111.494] (-1113.552) (-1110.237) (-1110.849) * (-1110.220) (-1113.436) [-1111.704] (-1109.612) -- 0:01:11 Average standard deviation of split frequencies: 0.033115 65500 -- (-1112.336) (-1111.394) [-1110.199] (-1113.606) * (-1115.589) (-1113.435) [-1110.111] (-1113.647) -- 0:01:11 66000 -- (-1112.002) (-1116.645) (-1112.883) [-1110.306] * (-1113.944) (-1111.568) [-1111.015] (-1110.804) -- 0:01:10 66500 -- (-1111.396) [-1113.104] (-1111.730) (-1111.844) * [-1110.206] (-1112.271) (-1113.602) (-1113.389) -- 0:01:10 67000 -- (-1110.652) [-1110.073] (-1111.651) (-1110.195) * [-1110.126] (-1110.819) (-1113.736) (-1111.227) -- 0:01:09 67500 -- (-1110.948) [-1110.049] (-1114.063) (-1111.173) * [-1113.592] (-1110.587) (-1112.303) (-1115.986) -- 0:01:09 68000 -- (-1112.105) (-1111.335) [-1115.289] (-1113.038) * (-1112.968) [-1111.296] (-1114.247) (-1111.245) -- 0:01:08 68500 -- (-1112.153) (-1111.575) [-1112.236] (-1116.278) * (-1114.153) [-1111.326] (-1112.677) (-1112.671) -- 0:01:07 69000 -- (-1110.646) (-1110.586) [-1116.452] (-1111.206) * (-1113.221) [-1110.552] (-1114.157) (-1112.918) -- 0:01:07 69500 -- (-1110.801) [-1111.828] (-1121.386) (-1110.776) * (-1113.482) [-1111.063] (-1112.264) (-1115.455) -- 0:01:06 70000 -- (-1114.042) (-1112.423) [-1121.063] (-1113.538) * (-1115.198) [-1110.631] (-1110.786) (-1110.635) -- 0:01:06 Average standard deviation of split frequencies: 0.032444 70500 -- (-1112.083) (-1110.861) [-1111.597] (-1113.635) * (-1112.618) [-1113.816] (-1110.095) (-1111.081) -- 0:01:05 71000 -- (-1116.972) [-1112.354] (-1112.945) (-1113.561) * [-1109.886] (-1110.491) (-1113.097) (-1111.022) -- 0:01:05 71500 -- (-1113.720) (-1110.617) [-1111.140] (-1114.745) * [-1114.404] (-1112.495) (-1114.466) (-1111.078) -- 0:01:04 72000 -- (-1116.883) (-1109.711) (-1111.882) [-1111.906] * (-1111.803) [-1110.648] (-1114.307) (-1112.462) -- 0:01:04 72500 -- (-1113.597) (-1111.929) [-1112.723] (-1111.878) * (-1111.413) (-1110.119) [-1110.757] (-1113.078) -- 0:01:03 73000 -- (-1111.952) (-1116.503) (-1112.478) [-1113.470] * (-1112.172) [-1111.282] (-1109.606) (-1112.509) -- 0:01:03 73500 -- (-1111.789) (-1110.268) [-1114.741] (-1110.566) * [-1110.364] (-1114.120) (-1111.696) (-1113.973) -- 0:01:03 74000 -- [-1116.026] (-1110.889) (-1110.801) (-1114.976) * (-1109.858) (-1113.658) (-1110.852) [-1114.193] -- 0:01:02 74500 -- (-1115.117) (-1110.450) [-1112.901] (-1110.223) * (-1111.113) [-1113.764] (-1110.022) (-1113.979) -- 0:01:02 75000 -- (-1115.627) (-1110.053) [-1113.552] (-1110.383) * (-1111.631) [-1113.221] (-1115.481) (-1119.450) -- 0:01:01 Average standard deviation of split frequencies: 0.031859 75500 -- (-1111.372) [-1111.188] (-1117.489) (-1111.316) * [-1112.658] (-1111.803) (-1110.121) (-1117.262) -- 0:01:01 76000 -- (-1114.601) [-1110.921] (-1110.445) (-1111.124) * (-1116.045) (-1111.519) [-1110.491] (-1113.713) -- 0:01:12 76500 -- (-1114.935) (-1110.551) (-1111.083) [-1112.203] * (-1110.507) (-1112.694) (-1110.435) [-1115.463] -- 0:01:12 77000 -- (-1112.542) (-1113.484) (-1111.706) [-1113.553] * (-1112.784) (-1115.369) (-1110.245) [-1115.544] -- 0:01:11 77500 -- (-1112.585) (-1113.502) (-1111.452) [-1111.200] * [-1111.543] (-1113.824) (-1112.558) (-1113.538) -- 0:01:11 78000 -- [-1111.918] (-1115.594) (-1110.521) (-1113.466) * (-1118.509) (-1114.874) (-1115.451) [-1111.890] -- 0:01:10 78500 -- (-1110.806) (-1111.844) (-1111.012) [-1111.572] * (-1117.589) (-1114.196) (-1115.393) [-1111.889] -- 0:01:10 79000 -- (-1112.297) [-1111.431] (-1116.568) (-1111.705) * (-1112.039) (-1111.727) (-1111.689) [-1118.129] -- 0:01:09 79500 -- (-1111.829) [-1111.688] (-1110.806) (-1111.606) * (-1109.921) (-1112.081) [-1112.516] (-1111.986) -- 0:01:09 80000 -- (-1112.740) (-1111.565) [-1112.332] (-1109.950) * [-1110.319] (-1112.082) (-1112.174) (-1112.229) -- 0:01:09 Average standard deviation of split frequencies: 0.030096 80500 -- (-1110.485) [-1112.135] (-1112.419) (-1110.381) * (-1112.228) [-1113.678] (-1111.322) (-1112.973) -- 0:01:08 81000 -- (-1112.739) [-1112.904] (-1112.497) (-1113.001) * (-1110.361) (-1113.187) (-1109.853) [-1110.487] -- 0:01:08 81500 -- (-1109.829) [-1112.054] (-1110.780) (-1111.999) * (-1110.265) (-1112.832) [-1115.557] (-1111.483) -- 0:01:07 82000 -- (-1109.920) (-1113.577) [-1112.260] (-1111.536) * (-1111.732) (-1114.513) (-1113.130) [-1110.683] -- 0:01:07 82500 -- [-1111.340] (-1113.629) (-1114.840) (-1112.205) * [-1110.789] (-1114.060) (-1111.176) (-1111.414) -- 0:01:06 83000 -- (-1112.423) (-1109.642) (-1109.955) [-1113.236] * (-1112.228) [-1114.407] (-1111.735) (-1112.652) -- 0:01:06 83500 -- (-1111.611) [-1109.730] (-1112.390) (-1110.943) * (-1111.802) (-1111.774) [-1111.524] (-1109.901) -- 0:01:05 84000 -- (-1110.791) (-1112.420) (-1113.140) [-1113.946] * [-1111.189] (-1111.771) (-1113.139) (-1109.584) -- 0:01:05 84500 -- (-1113.439) (-1110.074) [-1113.476] (-1113.118) * (-1111.943) (-1115.395) (-1113.219) [-1111.711] -- 0:01:05 85000 -- [-1110.345] (-1110.953) (-1110.799) (-1112.887) * (-1115.374) [-1115.701] (-1113.116) (-1110.102) -- 0:01:04 Average standard deviation of split frequencies: 0.027407 85500 -- (-1113.089) (-1111.551) [-1115.883] (-1111.882) * (-1111.603) [-1110.637] (-1112.919) (-1109.775) -- 0:01:04 86000 -- [-1109.854] (-1111.402) (-1120.398) (-1110.168) * (-1111.436) (-1110.511) [-1114.930] (-1110.013) -- 0:01:03 86500 -- (-1109.938) [-1110.033] (-1116.162) (-1112.373) * (-1112.425) (-1109.933) [-1110.923] (-1110.387) -- 0:01:03 87000 -- (-1110.014) (-1112.559) (-1110.214) [-1110.132] * [-1109.858] (-1109.855) (-1111.082) (-1110.281) -- 0:01:02 87500 -- (-1111.900) (-1112.046) (-1113.770) [-1110.545] * (-1112.040) (-1114.176) (-1114.151) [-1111.503] -- 0:01:02 88000 -- (-1110.069) (-1110.403) [-1112.288] (-1111.206) * (-1110.422) [-1112.789] (-1114.736) (-1110.524) -- 0:01:02 88500 -- (-1110.758) (-1110.298) [-1113.786] (-1111.373) * [-1112.290] (-1112.588) (-1112.585) (-1109.733) -- 0:01:01 89000 -- (-1110.914) (-1110.022) (-1115.919) [-1112.174] * (-1111.231) (-1113.863) (-1119.530) [-1111.423] -- 0:01:01 89500 -- (-1114.785) (-1110.630) (-1111.199) [-1110.228] * (-1111.691) (-1117.447) [-1113.389] (-1113.588) -- 0:01:01 90000 -- (-1112.347) (-1110.877) [-1111.854] (-1111.495) * (-1111.591) [-1110.555] (-1115.418) (-1110.176) -- 0:01:00 Average standard deviation of split frequencies: 0.026517 90500 -- (-1112.878) [-1109.476] (-1111.385) (-1111.970) * [-1114.288] (-1111.194) (-1115.225) (-1110.438) -- 0:01:00 91000 -- (-1114.660) (-1110.290) (-1111.102) [-1112.368] * (-1112.847) [-1110.783] (-1110.161) (-1109.936) -- 0:00:59 91500 -- (-1118.371) (-1110.690) [-1110.823] (-1111.520) * (-1111.880) (-1110.636) [-1115.581] (-1113.785) -- 0:00:59 92000 -- (-1117.363) (-1110.775) [-1110.352] (-1111.330) * [-1112.020] (-1112.850) (-1110.856) (-1111.953) -- 0:01:09 92500 -- (-1116.012) [-1111.214] (-1110.565) (-1110.396) * (-1111.744) (-1110.023) [-1111.153] (-1111.402) -- 0:01:08 93000 -- (-1111.772) [-1111.810] (-1110.973) (-1111.831) * (-1115.810) (-1110.328) (-1110.960) [-1112.462] -- 0:01:08 93500 -- (-1115.165) (-1111.848) (-1109.539) [-1110.741] * (-1117.629) (-1111.094) [-1111.688] (-1111.382) -- 0:01:07 94000 -- (-1111.797) [-1111.678] (-1110.628) (-1112.940) * (-1111.685) [-1109.943] (-1112.224) (-1113.345) -- 0:01:07 94500 -- (-1112.223) (-1110.384) (-1110.848) [-1110.248] * (-1112.366) (-1110.438) [-1109.821] (-1111.025) -- 0:01:07 95000 -- (-1111.997) (-1112.500) [-1109.879] (-1112.646) * (-1113.986) (-1110.834) [-1110.566] (-1110.539) -- 0:01:06 Average standard deviation of split frequencies: 0.028995 95500 -- [-1111.983] (-1110.979) (-1111.410) (-1113.463) * (-1113.250) (-1111.727) (-1113.018) [-1110.164] -- 0:01:06 96000 -- (-1112.934) (-1116.722) [-1110.673] (-1113.422) * [-1114.629] (-1119.216) (-1111.700) (-1113.077) -- 0:01:05 96500 -- (-1115.225) (-1118.048) [-1113.660] (-1110.870) * [-1111.555] (-1117.907) (-1112.749) (-1116.943) -- 0:01:05 97000 -- (-1112.634) (-1114.963) (-1112.510) [-1111.070] * (-1110.484) (-1109.993) [-1110.091] (-1116.846) -- 0:01:05 97500 -- (-1111.624) [-1111.372] (-1110.064) (-1110.258) * [-1114.547] (-1110.887) (-1113.895) (-1109.805) -- 0:01:04 98000 -- (-1112.541) (-1109.887) [-1109.610] (-1111.215) * (-1116.157) (-1111.222) (-1111.648) [-1110.315] -- 0:01:04 98500 -- [-1112.349] (-1113.715) (-1114.941) (-1112.385) * [-1114.926] (-1109.502) (-1113.004) (-1112.823) -- 0:01:04 99000 -- [-1113.092] (-1113.069) (-1112.329) (-1115.052) * (-1111.921) [-1111.894] (-1111.834) (-1112.950) -- 0:01:03 99500 -- (-1110.767) (-1112.851) (-1111.855) [-1113.386] * (-1112.140) (-1111.859) [-1111.770] (-1111.527) -- 0:01:03 100000 -- [-1112.095] (-1110.734) (-1113.429) (-1110.104) * (-1112.117) (-1110.554) [-1109.985] (-1111.121) -- 0:01:02 Average standard deviation of split frequencies: 0.025421 100500 -- (-1114.180) [-1110.784] (-1113.050) (-1112.130) * (-1115.370) (-1113.063) [-1110.699] (-1110.693) -- 0:01:02 101000 -- (-1115.373) (-1112.868) [-1110.916] (-1110.188) * (-1113.789) (-1113.424) (-1111.000) [-1110.562] -- 0:01:02 101500 -- (-1110.865) (-1111.381) [-1112.247] (-1111.590) * [-1113.816] (-1111.632) (-1111.708) (-1116.021) -- 0:01:01 102000 -- [-1110.802] (-1112.052) (-1112.446) (-1110.690) * (-1113.338) (-1110.753) [-1113.622] (-1113.060) -- 0:01:01 102500 -- (-1112.033) [-1112.508] (-1120.435) (-1110.368) * (-1112.046) (-1112.009) [-1115.511] (-1113.952) -- 0:01:01 103000 -- (-1117.675) (-1113.492) (-1111.459) [-1110.453] * (-1112.393) (-1111.001) [-1113.443] (-1116.685) -- 0:01:00 103500 -- (-1111.795) (-1112.866) (-1113.565) [-1111.952] * (-1111.855) [-1110.925] (-1112.792) (-1114.872) -- 0:01:00 104000 -- (-1111.193) (-1112.761) (-1113.734) [-1110.493] * (-1111.241) [-1111.578] (-1110.066) (-1113.495) -- 0:01:00 104500 -- (-1111.735) (-1111.748) [-1112.921] (-1110.045) * (-1110.012) (-1118.455) (-1110.886) [-1110.925] -- 0:00:59 105000 -- (-1110.680) (-1111.384) (-1112.530) [-1114.115] * (-1111.834) (-1113.332) [-1113.190] (-1110.802) -- 0:00:59 Average standard deviation of split frequencies: 0.024777 105500 -- (-1110.134) (-1109.757) [-1112.296] (-1110.926) * [-1109.981] (-1112.827) (-1112.266) (-1114.306) -- 0:00:59 106000 -- (-1109.952) (-1110.895) (-1114.066) [-1115.056] * (-1111.181) (-1113.297) [-1112.211] (-1111.651) -- 0:00:59 106500 -- [-1112.469] (-1111.096) (-1112.727) (-1114.621) * [-1110.681] (-1112.686) (-1112.037) (-1111.137) -- 0:00:58 107000 -- (-1113.053) [-1110.473] (-1112.033) (-1111.275) * (-1112.952) (-1109.466) (-1110.813) [-1110.249] -- 0:00:58 107500 -- (-1114.166) [-1111.502] (-1110.758) (-1111.405) * (-1111.218) (-1109.468) (-1110.316) [-1111.852] -- 0:00:58 108000 -- (-1113.007) (-1114.689) [-1111.675] (-1109.975) * (-1112.114) (-1110.266) (-1113.383) [-1115.040] -- 0:00:57 108500 -- (-1110.624) (-1110.755) (-1115.139) [-1109.919] * (-1112.755) (-1110.101) (-1111.710) [-1112.910] -- 0:01:05 109000 -- (-1110.300) (-1111.333) [-1111.601] (-1109.926) * (-1115.665) [-1110.746] (-1110.423) (-1116.772) -- 0:01:05 109500 -- [-1113.252] (-1114.650) (-1114.744) (-1110.198) * (-1112.038) (-1110.536) [-1112.572] (-1114.458) -- 0:01:05 110000 -- [-1110.225] (-1110.406) (-1111.351) (-1110.161) * [-1110.388] (-1110.104) (-1116.924) (-1114.323) -- 0:01:04 Average standard deviation of split frequencies: 0.022313 110500 -- (-1111.940) (-1109.679) [-1110.880] (-1110.516) * (-1110.095) [-1110.050] (-1114.063) (-1112.424) -- 0:01:04 111000 -- (-1109.957) (-1110.292) (-1117.759) [-1110.666] * (-1109.828) (-1113.665) (-1112.158) [-1112.355] -- 0:01:04 111500 -- [-1110.727] (-1114.487) (-1118.760) (-1110.745) * [-1110.824] (-1114.651) (-1110.926) (-1112.505) -- 0:01:03 112000 -- (-1110.524) (-1110.913) [-1115.232] (-1110.175) * (-1113.487) (-1115.355) [-1112.368] (-1114.642) -- 0:01:03 112500 -- (-1110.260) (-1111.650) [-1110.788] (-1111.023) * [-1114.763] (-1119.241) (-1113.461) (-1112.823) -- 0:01:03 113000 -- (-1113.714) (-1109.761) [-1110.270] (-1111.253) * (-1112.269) (-1113.136) (-1112.213) [-1113.972] -- 0:01:02 113500 -- [-1110.170] (-1109.752) (-1109.809) (-1109.634) * (-1110.774) [-1115.490] (-1114.049) (-1114.590) -- 0:01:02 114000 -- (-1110.369) (-1110.554) [-1113.594] (-1110.233) * (-1111.917) (-1113.094) (-1109.670) [-1110.993] -- 0:01:02 114500 -- (-1111.842) [-1112.849] (-1110.789) (-1112.372) * (-1111.751) (-1113.594) [-1109.588] (-1110.911) -- 0:01:01 115000 -- (-1114.639) [-1111.630] (-1110.344) (-1109.872) * (-1110.971) (-1113.226) (-1111.058) [-1109.634] -- 0:01:01 Average standard deviation of split frequencies: 0.021602 115500 -- (-1112.138) (-1111.630) (-1110.516) [-1111.257] * (-1110.213) (-1114.261) (-1112.252) [-1109.976] -- 0:01:01 116000 -- (-1112.610) [-1110.420] (-1110.490) (-1113.657) * [-1111.658] (-1111.817) (-1112.413) (-1110.455) -- 0:01:00 116500 -- (-1111.927) (-1110.029) [-1110.634] (-1110.804) * [-1110.906] (-1111.921) (-1112.766) (-1110.842) -- 0:01:00 117000 -- (-1112.290) [-1112.432] (-1110.935) (-1110.888) * (-1109.951) (-1111.923) [-1111.338] (-1111.810) -- 0:01:00 117500 -- (-1112.150) (-1110.621) [-1109.376] (-1109.605) * (-1110.849) (-1110.781) [-1111.259] (-1111.736) -- 0:01:00 118000 -- (-1111.527) (-1110.384) (-1112.664) [-1109.812] * [-1110.863] (-1111.073) (-1111.366) (-1110.131) -- 0:00:59 118500 -- (-1110.959) (-1111.548) (-1111.973) [-1110.179] * (-1109.637) (-1113.752) [-1111.264] (-1111.544) -- 0:00:59 119000 -- (-1111.273) (-1112.130) [-1112.784] (-1111.872) * [-1109.586] (-1115.243) (-1113.280) (-1115.083) -- 0:00:59 119500 -- (-1113.304) (-1112.861) [-1110.010] (-1118.046) * (-1109.633) [-1111.411] (-1113.476) (-1114.899) -- 0:00:58 120000 -- (-1115.720) (-1114.716) [-1111.484] (-1112.171) * (-1113.333) [-1111.410] (-1110.596) (-1114.170) -- 0:00:58 Average standard deviation of split frequencies: 0.023874 120500 -- (-1117.354) [-1116.796] (-1110.005) (-1112.580) * (-1111.526) (-1112.910) (-1111.009) [-1112.859] -- 0:00:58 121000 -- (-1117.344) (-1118.820) [-1110.272] (-1113.418) * [-1110.226] (-1110.491) (-1113.279) (-1114.286) -- 0:00:58 121500 -- [-1112.702] (-1113.306) (-1113.042) (-1113.625) * (-1112.698) (-1118.230) [-1112.039] (-1111.910) -- 0:00:57 122000 -- (-1112.895) (-1113.994) [-1110.979] (-1112.449) * (-1111.685) (-1115.858) (-1111.424) [-1109.482] -- 0:00:57 122500 -- (-1113.753) [-1112.447] (-1110.854) (-1113.557) * (-1113.063) (-1111.003) [-1110.711] (-1114.699) -- 0:00:57 123000 -- (-1112.239) (-1110.958) [-1112.204] (-1113.021) * (-1112.840) [-1109.758] (-1112.908) (-1110.412) -- 0:00:57 123500 -- (-1114.952) (-1111.239) [-1112.407] (-1111.124) * (-1115.894) (-1110.782) (-1110.632) [-1110.444] -- 0:00:56 124000 -- (-1118.661) (-1111.111) [-1110.958] (-1114.292) * (-1114.213) (-1110.691) (-1110.598) [-1112.253] -- 0:00:56 124500 -- [-1118.473] (-1114.885) (-1112.852) (-1117.115) * (-1118.638) [-1111.179] (-1110.163) (-1110.195) -- 0:00:56 125000 -- (-1116.682) (-1116.137) [-1113.199] (-1115.022) * (-1116.193) (-1111.193) (-1110.760) [-1110.892] -- 0:01:03 Average standard deviation of split frequencies: 0.021857 125500 -- [-1116.132] (-1112.819) (-1113.389) (-1111.360) * (-1115.645) [-1111.384] (-1111.051) (-1110.981) -- 0:01:02 126000 -- (-1113.297) (-1111.149) (-1113.341) [-1112.772] * [-1112.070] (-1111.125) (-1112.493) (-1109.911) -- 0:01:02 126500 -- (-1114.554) [-1110.070] (-1112.432) (-1113.831) * (-1113.889) (-1110.332) (-1114.076) [-1110.586] -- 0:01:02 127000 -- (-1113.146) [-1111.097] (-1111.750) (-1111.892) * (-1112.607) [-1111.220] (-1114.208) (-1110.436) -- 0:01:01 127500 -- (-1113.346) [-1112.447] (-1111.414) (-1112.278) * (-1114.447) (-1110.745) [-1115.158] (-1114.049) -- 0:01:01 128000 -- (-1111.571) [-1112.515] (-1114.223) (-1112.086) * (-1111.474) (-1111.051) (-1112.209) [-1111.622] -- 0:01:01 128500 -- (-1112.135) [-1110.498] (-1111.353) (-1111.521) * (-1112.553) (-1113.198) [-1113.983] (-1112.319) -- 0:01:01 129000 -- (-1111.978) (-1111.336) (-1110.518) [-1110.849] * (-1112.514) [-1112.227] (-1111.259) (-1112.417) -- 0:01:00 129500 -- (-1111.588) (-1110.953) [-1109.760] (-1111.940) * [-1113.243] (-1113.744) (-1110.438) (-1112.297) -- 0:01:00 130000 -- [-1111.880] (-1114.037) (-1110.378) (-1111.973) * [-1113.101] (-1110.308) (-1112.260) (-1111.267) -- 0:01:00 Average standard deviation of split frequencies: 0.022007 130500 -- [-1110.487] (-1111.695) (-1111.008) (-1110.879) * (-1111.120) (-1110.396) [-1113.284] (-1111.706) -- 0:00:59 131000 -- (-1109.692) [-1109.958] (-1111.572) (-1117.614) * [-1110.960] (-1111.808) (-1110.285) (-1111.457) -- 0:00:59 131500 -- [-1110.705] (-1113.613) (-1111.068) (-1119.706) * (-1113.270) (-1114.140) [-1110.188] (-1111.093) -- 0:00:59 132000 -- (-1110.547) (-1109.505) [-1113.533] (-1114.588) * [-1112.290] (-1112.355) (-1117.212) (-1110.978) -- 0:00:59 132500 -- (-1110.035) (-1112.789) [-1113.363] (-1113.162) * (-1110.340) (-1114.218) (-1115.215) [-1112.217] -- 0:00:58 133000 -- [-1111.632] (-1111.799) (-1113.690) (-1113.914) * (-1109.590) (-1113.278) (-1109.714) [-1110.110] -- 0:00:58 133500 -- (-1110.865) (-1111.150) (-1112.064) [-1109.935] * (-1109.784) (-1114.424) (-1109.926) [-1110.000] -- 0:00:58 134000 -- (-1110.842) (-1110.368) (-1114.470) [-1112.654] * (-1109.529) (-1111.352) [-1109.877] (-1114.515) -- 0:00:58 134500 -- (-1112.392) (-1109.826) (-1113.942) [-1109.824] * (-1110.668) [-1112.137] (-1110.368) (-1112.039) -- 0:00:57 135000 -- (-1115.056) (-1110.344) (-1111.452) [-1110.956] * (-1111.320) (-1110.368) (-1110.304) [-1110.129] -- 0:00:57 Average standard deviation of split frequencies: 0.020624 135500 -- (-1111.900) (-1110.806) [-1111.355] (-1111.786) * (-1111.514) (-1113.069) (-1113.118) [-1110.948] -- 0:00:57 136000 -- [-1110.813] (-1109.615) (-1113.872) (-1109.967) * [-1111.773] (-1113.154) (-1111.026) (-1111.649) -- 0:00:57 136500 -- (-1113.648) (-1110.935) [-1114.193] (-1110.370) * (-1113.655) (-1113.659) (-1113.468) [-1111.144] -- 0:00:56 137000 -- (-1111.373) [-1111.416] (-1111.638) (-1110.450) * (-1112.765) (-1111.354) (-1113.817) [-1111.384] -- 0:00:56 137500 -- (-1118.141) [-1111.359] (-1110.830) (-1112.793) * (-1112.240) (-1111.362) [-1111.961] (-1111.497) -- 0:00:56 138000 -- [-1110.469] (-1112.468) (-1112.813) (-1112.677) * (-1112.686) [-1111.834] (-1111.860) (-1111.200) -- 0:00:56 138500 -- (-1109.919) [-1115.771] (-1112.557) (-1114.222) * (-1112.765) (-1114.485) [-1111.500] (-1113.310) -- 0:00:55 139000 -- (-1110.973) (-1112.456) [-1113.098] (-1111.385) * (-1114.068) [-1110.457] (-1119.695) (-1111.106) -- 0:00:55 139500 -- [-1113.115] (-1111.485) (-1116.121) (-1112.407) * (-1112.177) (-1112.930) (-1111.125) [-1110.890] -- 0:00:55 140000 -- (-1113.536) (-1110.654) [-1112.935] (-1109.833) * (-1113.672) (-1112.605) [-1111.970] (-1110.648) -- 0:00:55 Average standard deviation of split frequencies: 0.020442 140500 -- [-1110.376] (-1111.726) (-1111.043) (-1111.461) * (-1110.653) (-1114.496) (-1111.279) [-1110.215] -- 0:00:55 141000 -- (-1114.918) (-1113.535) [-1113.418] (-1109.561) * (-1113.252) (-1112.110) [-1111.278] (-1110.749) -- 0:01:00 141500 -- [-1111.962] (-1117.975) (-1110.915) (-1111.898) * (-1110.712) [-1111.582] (-1110.772) (-1113.005) -- 0:01:00 142000 -- (-1115.855) (-1110.762) (-1110.706) [-1110.911] * (-1112.987) (-1111.727) [-1110.208] (-1113.104) -- 0:01:00 142500 -- (-1111.584) (-1110.281) [-1110.717] (-1115.151) * [-1113.044] (-1111.934) (-1111.319) (-1111.657) -- 0:01:00 143000 -- (-1111.787) (-1110.689) [-1110.846] (-1113.022) * (-1111.546) (-1112.294) (-1111.441) [-1110.549] -- 0:00:59 143500 -- (-1112.926) [-1109.718] (-1110.214) (-1110.026) * (-1111.771) (-1112.099) [-1110.817] (-1109.438) -- 0:00:59 144000 -- [-1112.248] (-1109.710) (-1113.369) (-1115.210) * (-1111.079) (-1112.377) (-1110.520) [-1110.326] -- 0:00:59 144500 -- (-1113.512) (-1110.868) [-1111.016] (-1114.251) * (-1111.615) (-1110.682) [-1110.211] (-1110.319) -- 0:00:59 145000 -- (-1111.267) (-1110.519) [-1110.452] (-1111.288) * (-1114.767) [-1110.852] (-1111.585) (-1110.015) -- 0:00:58 Average standard deviation of split frequencies: 0.020341 145500 -- (-1110.852) (-1111.432) [-1110.318] (-1111.285) * (-1111.864) (-1112.504) (-1116.064) [-1110.550] -- 0:00:58 146000 -- (-1111.694) (-1111.783) [-1111.279] (-1110.267) * [-1110.889] (-1112.346) (-1111.608) (-1114.589) -- 0:00:58 146500 -- (-1110.551) (-1111.081) [-1119.257] (-1109.704) * (-1112.592) [-1110.350] (-1111.172) (-1110.947) -- 0:00:58 147000 -- (-1114.974) (-1110.539) (-1114.986) [-1109.737] * (-1111.849) [-1110.222] (-1114.731) (-1110.965) -- 0:00:58 147500 -- (-1112.778) (-1110.533) (-1120.437) [-1112.090] * (-1112.435) (-1111.302) (-1114.241) [-1111.039] -- 0:00:57 148000 -- (-1112.654) (-1118.011) (-1118.816) [-1111.195] * (-1111.900) (-1110.174) [-1110.725] (-1110.442) -- 0:00:57 148500 -- (-1109.705) (-1117.637) [-1110.440] (-1112.273) * (-1110.873) [-1110.202] (-1110.524) (-1110.709) -- 0:00:57 149000 -- [-1111.333] (-1109.898) (-1116.490) (-1112.022) * (-1110.391) [-1113.206] (-1111.271) (-1113.159) -- 0:00:57 149500 -- (-1111.085) (-1111.414) [-1113.213] (-1119.555) * (-1110.691) (-1110.150) (-1113.864) [-1113.227] -- 0:00:56 150000 -- [-1118.661] (-1110.311) (-1113.109) (-1110.744) * [-1110.969] (-1113.477) (-1111.697) (-1111.051) -- 0:00:56 Average standard deviation of split frequencies: 0.019399 150500 -- (-1113.987) [-1111.916] (-1113.862) (-1111.728) * (-1115.375) (-1111.861) [-1112.616] (-1111.046) -- 0:00:56 151000 -- (-1115.598) (-1112.050) (-1111.674) [-1110.613] * (-1114.717) (-1112.648) [-1110.252] (-1112.140) -- 0:00:56 151500 -- [-1113.771] (-1111.703) (-1111.069) (-1111.635) * (-1113.460) (-1113.567) [-1111.062] (-1111.874) -- 0:00:56 152000 -- [-1114.772] (-1112.265) (-1112.874) (-1114.176) * [-1112.328] (-1114.401) (-1111.339) (-1110.356) -- 0:00:55 152500 -- (-1110.888) (-1115.366) (-1110.996) [-1112.642] * [-1111.606] (-1112.151) (-1114.721) (-1110.380) -- 0:00:55 153000 -- (-1109.985) (-1113.631) [-1110.091] (-1110.782) * (-1109.771) (-1111.426) (-1119.824) [-1111.830] -- 0:00:55 153500 -- (-1112.073) (-1112.299) (-1110.231) [-1114.684] * (-1113.094) [-1111.727] (-1118.110) (-1111.020) -- 0:00:55 154000 -- (-1112.293) [-1116.402] (-1110.113) (-1112.445) * (-1116.150) (-1111.292) (-1110.100) [-1111.330] -- 0:00:54 154500 -- (-1116.431) (-1113.520) [-1112.956] (-1111.362) * (-1114.462) [-1110.961] (-1114.063) (-1110.570) -- 0:00:54 155000 -- (-1112.083) [-1112.132] (-1113.299) (-1110.452) * (-1113.430) [-1112.314] (-1112.087) (-1109.339) -- 0:00:54 Average standard deviation of split frequencies: 0.018290 155500 -- (-1114.329) [-1112.076] (-1116.649) (-1109.636) * (-1112.595) [-1112.963] (-1113.119) (-1109.920) -- 0:00:54 156000 -- [-1112.491] (-1110.635) (-1119.960) (-1111.087) * (-1112.372) [-1111.608] (-1111.528) (-1110.324) -- 0:00:54 156500 -- (-1115.339) (-1113.174) (-1115.228) [-1109.584] * (-1112.939) (-1111.376) [-1110.237] (-1110.804) -- 0:00:53 157000 -- (-1114.422) (-1111.830) [-1111.975] (-1109.580) * (-1112.464) (-1109.728) (-1116.873) [-1111.976] -- 0:00:53 157500 -- (-1112.327) (-1111.973) (-1109.668) [-1111.598] * (-1111.522) [-1113.293] (-1113.040) (-1111.463) -- 0:00:58 158000 -- (-1112.376) [-1110.496] (-1109.812) (-1112.125) * (-1111.419) (-1113.716) (-1113.193) [-1111.640] -- 0:00:58 158500 -- [-1110.891] (-1113.108) (-1112.278) (-1113.560) * (-1109.864) (-1110.348) (-1114.532) [-1112.160] -- 0:00:58 159000 -- (-1111.310) [-1111.284] (-1110.438) (-1110.887) * (-1115.797) (-1115.572) (-1111.626) [-1114.447] -- 0:00:58 159500 -- (-1112.703) (-1109.866) [-1110.313] (-1110.632) * (-1111.824) (-1115.785) (-1111.469) [-1115.906] -- 0:00:57 160000 -- (-1115.067) (-1110.358) (-1110.070) [-1110.766] * (-1110.467) (-1115.747) [-1114.532] (-1111.627) -- 0:00:57 Average standard deviation of split frequencies: 0.016463 160500 -- (-1119.294) (-1111.269) (-1115.591) [-1110.974] * (-1110.449) (-1112.521) (-1111.253) [-1110.436] -- 0:00:57 161000 -- (-1115.771) [-1112.263] (-1112.853) (-1111.813) * [-1112.281] (-1115.939) (-1111.780) (-1117.155) -- 0:00:57 161500 -- (-1114.545) (-1110.525) [-1110.117] (-1115.690) * (-1112.924) (-1111.880) [-1111.639] (-1112.343) -- 0:00:57 162000 -- (-1111.040) (-1112.188) (-1111.532) [-1114.324] * (-1111.424) [-1110.981] (-1113.599) (-1113.763) -- 0:00:56 162500 -- (-1112.325) (-1113.858) (-1109.497) [-1110.717] * (-1110.998) (-1110.010) (-1110.081) [-1112.805] -- 0:00:56 163000 -- [-1113.170] (-1111.654) (-1110.842) (-1112.750) * (-1109.998) (-1112.098) [-1109.661] (-1109.709) -- 0:00:56 163500 -- (-1110.251) (-1113.175) (-1114.786) [-1114.854] * [-1112.840] (-1111.780) (-1117.685) (-1110.691) -- 0:00:56 164000 -- (-1111.101) (-1111.900) (-1113.189) [-1111.776] * (-1113.067) (-1111.101) (-1109.597) [-1113.250] -- 0:00:56 164500 -- (-1112.993) (-1116.644) (-1109.912) [-1112.429] * (-1110.459) [-1111.480] (-1109.582) (-1113.128) -- 0:00:55 165000 -- (-1111.787) (-1112.801) (-1109.816) [-1110.814] * (-1110.424) [-1110.394] (-1109.617) (-1110.863) -- 0:00:55 Average standard deviation of split frequencies: 0.015232 165500 -- [-1113.128] (-1113.954) (-1109.656) (-1111.535) * (-1114.002) (-1114.611) [-1111.011] (-1111.083) -- 0:00:55 166000 -- (-1112.771) (-1110.816) (-1112.184) [-1111.244] * (-1109.916) (-1111.635) [-1110.473] (-1110.764) -- 0:00:55 166500 -- (-1111.293) (-1112.712) [-1113.060] (-1110.838) * (-1110.636) (-1112.020) [-1112.255] (-1116.147) -- 0:00:55 167000 -- (-1120.482) (-1114.626) (-1112.411) [-1111.683] * (-1113.076) (-1110.925) [-1113.220] (-1115.218) -- 0:00:54 167500 -- (-1122.954) [-1115.120] (-1111.410) (-1111.866) * (-1112.143) (-1112.297) [-1111.630] (-1114.283) -- 0:00:54 168000 -- (-1115.365) (-1115.079) [-1110.246] (-1110.818) * (-1111.791) (-1112.808) [-1113.870] (-1112.432) -- 0:00:54 168500 -- (-1111.116) (-1110.460) [-1111.231] (-1112.012) * (-1109.942) (-1110.907) (-1118.164) [-1112.530] -- 0:00:54 169000 -- (-1115.292) (-1110.881) [-1111.058] (-1111.086) * (-1112.434) (-1115.006) [-1112.231] (-1113.389) -- 0:00:54 169500 -- (-1109.992) (-1111.430) (-1115.215) [-1112.761] * (-1113.966) (-1112.033) [-1114.071] (-1113.404) -- 0:00:53 170000 -- (-1113.268) [-1111.614] (-1113.196) (-1110.615) * (-1111.363) [-1113.550] (-1115.906) (-1111.541) -- 0:00:53 Average standard deviation of split frequencies: 0.015468 170500 -- (-1112.597) [-1111.255] (-1110.698) (-1111.260) * (-1110.450) [-1115.841] (-1114.432) (-1109.557) -- 0:00:53 171000 -- (-1111.007) [-1110.661] (-1112.262) (-1114.215) * (-1112.626) [-1111.750] (-1117.460) (-1109.933) -- 0:00:53 171500 -- (-1113.422) (-1110.064) (-1109.495) [-1112.420] * (-1110.721) (-1111.464) (-1112.444) [-1110.038] -- 0:00:53 172000 -- (-1112.784) (-1109.455) [-1110.256] (-1111.264) * (-1111.301) (-1111.575) (-1114.223) [-1110.571] -- 0:00:52 172500 -- [-1109.921] (-1109.439) (-1113.355) (-1109.907) * (-1111.575) (-1114.682) [-1111.260] (-1115.093) -- 0:00:52 173000 -- (-1111.505) [-1112.917] (-1112.254) (-1110.745) * (-1112.371) (-1112.144) [-1114.014] (-1112.019) -- 0:00:52 173500 -- (-1110.929) (-1110.783) [-1110.882] (-1109.653) * [-1114.269] (-1112.113) (-1113.662) (-1111.267) -- 0:00:52 174000 -- [-1110.321] (-1112.579) (-1111.015) (-1109.626) * (-1113.719) (-1110.703) (-1113.506) [-1110.114] -- 0:00:56 174500 -- (-1111.050) [-1110.964] (-1109.725) (-1110.219) * (-1112.118) (-1111.940) [-1110.064] (-1114.911) -- 0:00:56 175000 -- (-1112.788) (-1114.843) [-1111.901] (-1109.876) * (-1111.486) (-1110.883) [-1111.711] (-1113.107) -- 0:00:56 Average standard deviation of split frequencies: 0.018326 175500 -- (-1113.000) (-1113.887) [-1112.455] (-1109.824) * (-1112.526) (-1111.455) [-1112.240] (-1113.219) -- 0:00:56 176000 -- (-1113.059) [-1111.661] (-1115.800) (-1110.008) * [-1110.745] (-1111.156) (-1109.707) (-1112.902) -- 0:00:56 176500 -- (-1115.055) (-1109.517) (-1115.379) [-1110.026] * (-1110.699) [-1110.911] (-1111.361) (-1112.947) -- 0:00:55 177000 -- (-1111.147) [-1110.325] (-1118.587) (-1110.188) * (-1110.103) (-1110.099) [-1109.872] (-1114.834) -- 0:00:55 177500 -- (-1111.250) (-1109.850) (-1110.793) [-1112.341] * (-1110.990) (-1110.064) [-1114.920] (-1115.809) -- 0:00:55 178000 -- (-1110.118) (-1115.573) [-1110.929] (-1112.053) * [-1111.802] (-1111.317) (-1117.194) (-1112.843) -- 0:00:55 178500 -- [-1110.199] (-1112.160) (-1111.775) (-1112.791) * (-1111.168) (-1110.894) [-1114.155] (-1112.372) -- 0:00:55 179000 -- [-1110.315] (-1115.500) (-1112.918) (-1112.788) * [-1110.050] (-1110.319) (-1111.508) (-1112.696) -- 0:00:55 179500 -- (-1112.123) (-1111.609) (-1117.465) [-1111.252] * (-1111.113) [-1111.499] (-1113.199) (-1112.552) -- 0:00:54 180000 -- (-1110.628) [-1110.820] (-1111.986) (-1111.879) * (-1111.335) (-1112.018) (-1110.834) [-1110.548] -- 0:00:54 Average standard deviation of split frequencies: 0.018265 180500 -- (-1114.760) (-1111.154) (-1112.134) [-1110.227] * [-1110.546] (-1115.373) (-1110.862) (-1111.181) -- 0:00:54 181000 -- (-1111.729) [-1110.196] (-1115.963) (-1110.946) * (-1112.042) [-1111.789] (-1112.073) (-1112.113) -- 0:00:54 181500 -- [-1112.059] (-1111.363) (-1111.514) (-1112.703) * [-1111.727] (-1112.080) (-1112.281) (-1113.297) -- 0:00:54 182000 -- [-1113.038] (-1109.998) (-1114.227) (-1115.733) * (-1110.745) (-1110.680) [-1112.061] (-1111.446) -- 0:00:53 182500 -- (-1115.020) (-1111.476) (-1113.758) [-1111.735] * (-1112.590) (-1113.663) (-1110.687) [-1111.528] -- 0:00:53 183000 -- (-1115.049) [-1111.651] (-1113.652) (-1113.874) * (-1110.355) (-1110.384) (-1111.202) [-1111.186] -- 0:00:53 183500 -- (-1112.237) [-1113.036] (-1112.742) (-1111.906) * (-1112.051) (-1115.169) (-1110.824) [-1110.553] -- 0:00:53 184000 -- [-1113.235] (-1111.924) (-1109.623) (-1111.393) * (-1113.093) [-1111.062] (-1110.761) (-1110.287) -- 0:00:53 184500 -- [-1111.891] (-1110.373) (-1111.682) (-1111.394) * [-1111.995] (-1111.819) (-1111.320) (-1112.771) -- 0:00:53 185000 -- (-1113.472) (-1113.842) (-1113.800) [-1109.767] * [-1111.469] (-1111.855) (-1110.611) (-1111.739) -- 0:00:52 Average standard deviation of split frequencies: 0.016935 185500 -- (-1112.143) (-1112.684) (-1113.507) [-1110.923] * (-1110.066) (-1111.415) (-1110.485) [-1110.178] -- 0:00:52 186000 -- [-1111.097] (-1111.026) (-1111.535) (-1110.956) * [-1111.243] (-1111.018) (-1112.081) (-1114.605) -- 0:00:52 186500 -- (-1111.321) (-1117.079) (-1110.184) [-1113.137] * [-1110.512] (-1113.024) (-1110.057) (-1109.885) -- 0:00:52 187000 -- (-1110.684) (-1119.827) [-1112.604] (-1112.474) * (-1111.519) (-1111.621) (-1109.897) [-1109.814] -- 0:00:52 187500 -- (-1110.480) [-1110.629] (-1115.189) (-1113.688) * (-1114.485) [-1112.947] (-1112.633) (-1109.517) -- 0:00:52 188000 -- (-1111.161) (-1114.461) [-1111.827] (-1109.955) * (-1114.734) (-1114.442) (-1111.341) [-1109.796] -- 0:00:51 188500 -- [-1112.037] (-1114.918) (-1111.143) (-1110.662) * (-1115.202) [-1112.378] (-1112.274) (-1109.796) -- 0:00:51 189000 -- (-1111.825) [-1110.792] (-1110.278) (-1113.884) * (-1111.624) [-1111.638] (-1111.048) (-1109.387) -- 0:00:51 189500 -- (-1112.662) [-1111.710] (-1111.386) (-1111.342) * (-1112.540) (-1112.149) [-1112.392] (-1109.687) -- 0:00:51 190000 -- (-1110.915) (-1113.036) [-1111.755] (-1121.762) * (-1113.776) [-1114.638] (-1110.791) (-1113.331) -- 0:00:55 Average standard deviation of split frequencies: 0.017032 190500 -- [-1115.677] (-1111.712) (-1113.266) (-1116.363) * (-1111.444) [-1112.611] (-1113.329) (-1115.306) -- 0:00:55 191000 -- (-1112.523) (-1111.812) [-1115.076] (-1110.550) * (-1110.482) [-1109.643] (-1114.881) (-1113.297) -- 0:00:55 191500 -- (-1111.932) (-1111.396) (-1116.709) [-1110.464] * (-1111.519) [-1109.905] (-1115.492) (-1115.434) -- 0:00:54 192000 -- (-1112.432) (-1111.841) [-1113.231] (-1110.136) * (-1110.553) (-1109.742) (-1112.702) [-1110.274] -- 0:00:54 192500 -- (-1115.754) (-1111.848) (-1111.664) [-1113.610] * (-1112.058) (-1111.389) [-1114.280] (-1115.671) -- 0:00:54 193000 -- (-1117.449) [-1114.823] (-1111.375) (-1111.585) * (-1110.708) [-1111.346] (-1114.367) (-1114.015) -- 0:00:54 193500 -- (-1113.244) [-1117.803] (-1111.024) (-1110.735) * (-1110.872) [-1110.542] (-1119.107) (-1115.278) -- 0:00:54 194000 -- (-1111.683) (-1110.979) (-1113.241) [-1111.843] * (-1111.185) (-1111.386) [-1112.322] (-1114.834) -- 0:00:54 194500 -- (-1116.660) (-1112.056) (-1110.274) [-1112.491] * (-1114.316) (-1110.776) [-1112.914] (-1115.052) -- 0:00:53 195000 -- (-1110.479) (-1111.649) [-1110.215] (-1110.838) * (-1114.111) (-1113.598) [-1110.932] (-1110.679) -- 0:00:53 Average standard deviation of split frequencies: 0.018840 195500 -- (-1110.948) (-1112.718) (-1115.394) [-1113.708] * [-1109.607] (-1114.749) (-1110.930) (-1110.728) -- 0:00:53 196000 -- (-1114.054) [-1111.285] (-1110.952) (-1110.668) * (-1112.997) (-1111.731) (-1110.883) [-1111.657] -- 0:00:53 196500 -- [-1111.024] (-1112.325) (-1112.811) (-1111.377) * (-1109.618) (-1112.190) (-1110.666) [-1111.366] -- 0:00:53 197000 -- [-1115.325] (-1111.980) (-1114.363) (-1115.249) * (-1111.817) (-1111.283) (-1114.348) [-1114.598] -- 0:00:52 197500 -- (-1113.104) (-1112.351) (-1111.070) [-1111.055] * (-1112.504) (-1111.825) [-1113.191] (-1111.989) -- 0:00:52 198000 -- (-1112.922) [-1113.128] (-1109.999) (-1112.779) * (-1111.078) [-1111.093] (-1114.376) (-1112.797) -- 0:00:52 198500 -- (-1112.229) (-1111.834) (-1112.582) [-1111.936] * (-1111.473) (-1111.373) [-1114.562] (-1111.163) -- 0:00:52 199000 -- (-1115.264) [-1111.877] (-1111.580) (-1112.638) * (-1111.561) (-1111.382) (-1117.200) [-1114.750] -- 0:00:52 199500 -- (-1114.133) (-1113.854) (-1111.627) [-1112.278] * [-1112.663] (-1111.016) (-1114.932) (-1110.435) -- 0:00:52 200000 -- (-1111.278) [-1115.970] (-1109.671) (-1111.699) * [-1109.692] (-1111.763) (-1111.490) (-1109.613) -- 0:00:51 Average standard deviation of split frequencies: 0.017826 200500 -- (-1113.928) (-1113.097) [-1109.351] (-1111.862) * [-1111.086] (-1114.019) (-1112.893) (-1113.449) -- 0:00:51 201000 -- (-1113.168) (-1111.923) (-1109.604) [-1110.700] * [-1110.059] (-1112.915) (-1112.419) (-1112.593) -- 0:00:51 201500 -- (-1112.768) (-1110.206) (-1109.642) [-1110.647] * (-1110.793) [-1110.932] (-1113.326) (-1112.586) -- 0:00:51 202000 -- (-1111.682) (-1112.432) (-1111.820) [-1113.193] * (-1111.446) [-1113.232] (-1112.482) (-1111.864) -- 0:00:51 202500 -- (-1112.375) (-1110.611) [-1110.529] (-1115.662) * [-1114.273] (-1112.839) (-1113.125) (-1115.274) -- 0:00:51 203000 -- (-1109.937) [-1109.833] (-1110.888) (-1110.845) * (-1112.186) (-1110.767) (-1111.817) [-1114.033] -- 0:00:51 203500 -- (-1110.950) [-1109.947] (-1111.434) (-1112.781) * (-1112.812) (-1110.291) (-1116.121) [-1110.983] -- 0:00:50 204000 -- (-1110.843) [-1112.547] (-1111.249) (-1117.999) * (-1112.698) (-1114.786) (-1112.705) [-1111.597] -- 0:00:50 204500 -- (-1111.867) (-1111.352) [-1111.106] (-1113.968) * [-1114.946] (-1111.429) (-1115.244) (-1111.013) -- 0:00:50 205000 -- (-1111.554) (-1111.418) [-1112.403] (-1112.031) * (-1112.001) (-1114.714) (-1111.285) [-1112.291] -- 0:00:50 Average standard deviation of split frequencies: 0.016527 205500 -- (-1109.859) (-1111.738) [-1111.381] (-1111.263) * (-1111.244) (-1113.190) [-1110.710] (-1114.689) -- 0:00:50 206000 -- (-1109.859) (-1113.109) (-1110.293) [-1110.237] * (-1112.117) (-1114.831) [-1112.753] (-1117.827) -- 0:00:53 206500 -- [-1112.397] (-1110.605) (-1114.388) (-1112.271) * (-1116.609) [-1112.172] (-1116.893) (-1117.707) -- 0:00:53 207000 -- (-1112.214) (-1110.939) (-1113.659) [-1110.685] * (-1112.407) [-1113.790] (-1111.757) (-1113.317) -- 0:00:53 207500 -- (-1110.523) (-1109.712) [-1114.076] (-1111.405) * [-1114.263] (-1113.570) (-1110.639) (-1111.132) -- 0:00:53 208000 -- (-1110.149) (-1109.938) [-1109.653] (-1110.607) * [-1109.620] (-1112.318) (-1113.232) (-1112.217) -- 0:00:53 208500 -- (-1110.584) [-1113.747] (-1112.208) (-1116.931) * (-1113.246) (-1110.739) (-1112.371) [-1111.583] -- 0:00:53 209000 -- (-1110.628) (-1111.955) [-1111.197] (-1112.837) * (-1109.483) [-1111.310] (-1111.729) (-1113.314) -- 0:00:52 209500 -- (-1110.602) (-1113.558) (-1110.759) [-1112.959] * (-1109.483) (-1111.738) [-1110.533] (-1117.979) -- 0:00:52 210000 -- (-1112.173) (-1110.012) [-1109.912] (-1111.313) * (-1110.750) [-1111.780] (-1109.619) (-1117.583) -- 0:00:52 Average standard deviation of split frequencies: 0.015664 210500 -- [-1112.978] (-1116.530) (-1113.446) (-1111.701) * (-1110.955) (-1110.575) (-1110.954) [-1110.586] -- 0:00:52 211000 -- [-1110.796] (-1110.306) (-1111.793) (-1110.719) * (-1113.253) (-1112.653) (-1110.083) [-1110.651] -- 0:00:52 211500 -- (-1110.602) [-1109.747] (-1111.563) (-1112.551) * (-1114.112) (-1111.551) (-1110.611) [-1112.060] -- 0:00:52 212000 -- (-1110.173) [-1110.301] (-1114.340) (-1112.697) * [-1112.932] (-1113.123) (-1115.859) (-1111.473) -- 0:00:52 212500 -- [-1111.404] (-1111.223) (-1110.661) (-1112.551) * [-1111.248] (-1110.042) (-1113.119) (-1111.128) -- 0:00:51 213000 -- [-1112.745] (-1110.830) (-1110.528) (-1112.052) * (-1111.544) [-1110.526] (-1111.659) (-1110.612) -- 0:00:51 213500 -- [-1111.665] (-1111.938) (-1110.981) (-1113.077) * [-1113.605] (-1111.777) (-1112.089) (-1109.829) -- 0:00:51 214000 -- (-1111.977) (-1111.428) (-1113.746) [-1112.029] * (-1114.877) (-1112.297) [-1114.890] (-1110.806) -- 0:00:51 214500 -- [-1112.990] (-1112.538) (-1111.747) (-1113.540) * (-1112.492) [-1110.127] (-1114.086) (-1110.800) -- 0:00:51 215000 -- (-1111.819) (-1122.913) [-1110.882] (-1111.024) * (-1111.476) (-1112.082) (-1111.290) [-1111.568] -- 0:00:51 Average standard deviation of split frequencies: 0.017459 215500 -- (-1113.765) (-1112.351) (-1111.087) [-1111.629] * (-1110.607) [-1110.571] (-1111.114) (-1111.262) -- 0:00:50 216000 -- (-1110.567) (-1111.145) [-1110.692] (-1110.385) * (-1111.648) [-1109.838] (-1111.880) (-1110.794) -- 0:00:50 216500 -- (-1111.031) (-1109.824) (-1115.999) [-1111.685] * (-1112.031) (-1109.942) [-1111.983] (-1112.134) -- 0:00:50 217000 -- (-1110.480) (-1111.095) (-1111.009) [-1111.494] * (-1110.006) [-1109.816] (-1111.988) (-1112.965) -- 0:00:50 217500 -- (-1117.244) (-1110.081) [-1109.779] (-1115.233) * (-1111.605) (-1112.266) [-1111.469] (-1109.324) -- 0:00:50 218000 -- (-1115.537) (-1112.287) [-1109.779] (-1115.420) * (-1112.569) (-1113.578) (-1114.098) [-1111.083] -- 0:00:50 218500 -- (-1112.897) [-1112.064] (-1113.992) (-1113.365) * (-1112.649) (-1112.104) [-1114.234] (-1109.488) -- 0:00:50 219000 -- (-1112.631) (-1110.924) (-1110.557) [-1111.958] * (-1111.316) (-1110.482) [-1111.104] (-1113.805) -- 0:00:49 219500 -- (-1112.049) [-1116.409] (-1111.697) (-1112.368) * (-1116.404) [-1112.199] (-1111.093) (-1115.943) -- 0:00:49 220000 -- (-1111.534) (-1112.432) (-1113.652) [-1110.465] * (-1112.516) [-1109.998] (-1110.053) (-1112.138) -- 0:00:49 Average standard deviation of split frequencies: 0.016378 220500 -- (-1113.442) [-1113.455] (-1111.742) (-1113.543) * (-1113.511) (-1112.868) [-1110.777] (-1111.746) -- 0:00:49 221000 -- [-1110.124] (-1113.734) (-1113.435) (-1113.100) * (-1110.062) (-1114.065) [-1110.147] (-1111.349) -- 0:00:49 221500 -- (-1111.084) (-1111.488) [-1110.486] (-1112.677) * (-1111.795) (-1114.694) (-1110.059) [-1110.569] -- 0:00:49 222000 -- (-1113.710) (-1110.991) (-1111.582) [-1111.248] * [-1111.448] (-1112.569) (-1117.129) (-1111.890) -- 0:00:49 222500 -- (-1113.941) [-1111.034] (-1112.182) (-1111.314) * (-1110.612) (-1112.780) [-1113.534] (-1112.103) -- 0:00:52 223000 -- (-1112.560) [-1110.419] (-1112.044) (-1110.880) * [-1110.945] (-1114.452) (-1110.558) (-1110.990) -- 0:00:52 223500 -- [-1112.143] (-1110.904) (-1111.975) (-1111.287) * (-1111.603) (-1112.769) [-1110.511] (-1111.660) -- 0:00:52 224000 -- (-1112.803) (-1111.787) [-1111.429] (-1112.592) * (-1112.146) (-1110.251) (-1112.407) [-1110.890] -- 0:00:51 224500 -- [-1112.420] (-1112.375) (-1113.439) (-1110.735) * (-1116.636) (-1111.891) [-1110.396] (-1112.129) -- 0:00:51 225000 -- (-1111.813) [-1112.446] (-1112.551) (-1111.821) * (-1112.716) (-1113.681) (-1110.035) [-1109.768] -- 0:00:51 Average standard deviation of split frequencies: 0.014949 225500 -- (-1111.798) (-1109.854) (-1112.030) [-1111.692] * (-1111.403) [-1112.053] (-1110.025) (-1110.341) -- 0:00:51 226000 -- (-1110.665) [-1112.358] (-1111.261) (-1111.679) * (-1111.738) (-1113.039) [-1110.905] (-1114.302) -- 0:00:51 226500 -- (-1111.340) (-1112.631) (-1112.983) [-1111.635] * (-1110.322) (-1115.260) (-1109.838) [-1112.013] -- 0:00:51 227000 -- [-1112.469] (-1113.553) (-1112.218) (-1111.666) * [-1110.522] (-1113.298) (-1115.049) (-1113.060) -- 0:00:51 227500 -- (-1113.646) [-1115.971] (-1110.759) (-1111.838) * (-1111.774) (-1113.327) (-1113.414) [-1112.853] -- 0:00:50 228000 -- (-1113.646) [-1111.672] (-1113.498) (-1110.139) * (-1112.257) (-1111.956) [-1109.764] (-1113.319) -- 0:00:50 228500 -- (-1112.924) [-1112.761] (-1113.126) (-1110.945) * (-1112.348) (-1112.627) [-1110.668] (-1112.095) -- 0:00:50 229000 -- (-1115.547) (-1110.738) [-1111.898] (-1111.622) * (-1115.160) (-1110.090) [-1111.373] (-1112.573) -- 0:00:50 229500 -- [-1112.063] (-1111.259) (-1109.981) (-1114.761) * [-1112.869] (-1111.966) (-1112.513) (-1113.452) -- 0:00:50 230000 -- (-1116.663) [-1109.552] (-1110.889) (-1110.061) * (-1113.229) (-1117.101) (-1114.525) [-1110.538] -- 0:00:50 Average standard deviation of split frequencies: 0.015782 230500 -- (-1113.743) (-1110.139) [-1115.472] (-1110.115) * (-1110.001) (-1112.525) (-1112.538) [-1109.941] -- 0:00:50 231000 -- (-1117.148) (-1112.315) [-1114.535] (-1111.463) * [-1110.076] (-1110.922) (-1113.514) (-1113.415) -- 0:00:49 231500 -- (-1112.771) (-1116.524) (-1110.784) [-1113.465] * [-1109.932] (-1113.806) (-1112.606) (-1111.467) -- 0:00:49 232000 -- [-1110.932] (-1112.498) (-1111.481) (-1114.492) * (-1111.525) (-1110.294) (-1113.157) [-1110.976] -- 0:00:49 232500 -- (-1112.759) (-1111.742) (-1110.333) [-1111.983] * (-1113.376) (-1112.906) [-1111.659] (-1111.590) -- 0:00:49 233000 -- (-1111.693) [-1110.531] (-1111.090) (-1112.018) * (-1110.848) (-1111.026) (-1111.240) [-1109.808] -- 0:00:49 233500 -- (-1110.637) (-1115.877) [-1111.475] (-1112.809) * (-1111.385) (-1113.842) [-1111.232] (-1110.347) -- 0:00:49 234000 -- (-1110.674) [-1113.804] (-1111.806) (-1113.214) * (-1112.281) (-1111.031) [-1115.184] (-1111.448) -- 0:00:49 234500 -- (-1115.286) [-1111.166] (-1111.155) (-1110.336) * (-1111.997) (-1110.696) (-1110.341) [-1109.851] -- 0:00:48 235000 -- (-1112.013) [-1112.113] (-1111.767) (-1110.940) * (-1110.447) (-1113.114) [-1113.090] (-1110.581) -- 0:00:48 Average standard deviation of split frequencies: 0.014759 235500 -- (-1113.916) (-1113.161) [-1111.795] (-1112.089) * (-1113.378) [-1112.783] (-1110.993) (-1111.219) -- 0:00:48 236000 -- [-1110.461] (-1115.055) (-1111.521) (-1112.397) * (-1117.038) (-1112.508) (-1109.519) [-1117.388] -- 0:00:48 236500 -- (-1110.067) (-1112.975) [-1111.639] (-1112.326) * (-1112.415) [-1113.315] (-1109.598) (-1111.645) -- 0:00:48 237000 -- [-1109.894] (-1110.186) (-1111.666) (-1109.985) * (-1112.417) (-1112.230) [-1112.792] (-1112.405) -- 0:00:48 237500 -- (-1110.688) (-1113.248) (-1111.120) [-1111.652] * (-1113.439) [-1111.316] (-1114.010) (-1111.102) -- 0:00:48 238000 -- (-1110.668) (-1112.706) (-1111.964) [-1109.520] * (-1110.353) (-1112.610) [-1110.778] (-1111.497) -- 0:00:48 238500 -- (-1113.956) [-1112.205] (-1115.984) (-1109.990) * [-1111.306] (-1111.479) (-1112.560) (-1110.830) -- 0:00:51 239000 -- (-1111.590) (-1118.367) [-1114.261] (-1110.474) * (-1112.245) (-1109.693) (-1112.154) [-1112.351] -- 0:00:50 239500 -- (-1111.681) (-1112.369) (-1114.531) [-1110.898] * [-1111.217] (-1112.114) (-1109.840) (-1112.925) -- 0:00:50 240000 -- [-1111.618] (-1113.447) (-1113.387) (-1111.256) * (-1110.470) [-1113.913] (-1112.154) (-1112.627) -- 0:00:50 Average standard deviation of split frequencies: 0.014146 240500 -- (-1113.679) (-1111.786) (-1113.478) [-1110.402] * [-1113.382] (-1115.141) (-1112.425) (-1111.976) -- 0:00:50 241000 -- (-1113.389) (-1113.289) (-1113.744) [-1110.726] * (-1113.346) [-1114.464] (-1113.669) (-1110.566) -- 0:00:50 241500 -- (-1115.664) (-1112.076) [-1110.301] (-1111.616) * (-1114.179) [-1112.288] (-1112.501) (-1112.513) -- 0:00:50 242000 -- (-1112.187) (-1110.214) [-1113.622] (-1112.852) * [-1115.376] (-1111.657) (-1111.479) (-1110.587) -- 0:00:50 242500 -- (-1110.444) (-1110.821) [-1112.915] (-1114.092) * (-1118.164) (-1115.470) (-1111.829) [-1109.783] -- 0:00:49 243000 -- (-1110.775) (-1116.043) [-1112.556] (-1111.029) * (-1113.845) (-1111.043) [-1109.666] (-1111.011) -- 0:00:49 243500 -- (-1111.707) [-1112.867] (-1111.351) (-1110.762) * (-1110.966) [-1111.143] (-1112.578) (-1111.811) -- 0:00:49 244000 -- (-1112.335) (-1112.367) (-1110.553) [-1112.267] * [-1112.219] (-1110.425) (-1112.883) (-1111.548) -- 0:00:49 244500 -- [-1114.395] (-1114.264) (-1110.531) (-1113.481) * (-1111.577) (-1112.229) (-1111.020) [-1112.691] -- 0:00:49 245000 -- (-1110.146) (-1112.359) [-1113.420] (-1112.176) * (-1112.870) (-1115.554) [-1110.216] (-1113.738) -- 0:00:49 Average standard deviation of split frequencies: 0.015935 245500 -- (-1110.175) (-1114.275) [-1109.992] (-1112.099) * (-1111.713) [-1111.366] (-1112.422) (-1111.707) -- 0:00:49 246000 -- [-1110.912] (-1111.918) (-1110.507) (-1113.928) * (-1112.522) (-1111.510) (-1110.646) [-1110.491] -- 0:00:49 246500 -- (-1111.465) (-1113.239) [-1109.594] (-1111.989) * [-1112.515] (-1112.234) (-1111.626) (-1110.355) -- 0:00:48 247000 -- (-1115.298) (-1113.322) (-1114.855) [-1111.488] * (-1114.303) [-1113.856] (-1110.196) (-1111.694) -- 0:00:48 247500 -- (-1117.881) (-1110.368) (-1112.960) [-1111.566] * (-1111.926) [-1115.532] (-1110.433) (-1115.215) -- 0:00:48 248000 -- (-1113.524) [-1111.504] (-1112.572) (-1111.616) * (-1113.733) (-1113.661) [-1111.356] (-1111.478) -- 0:00:48 248500 -- [-1112.142] (-1113.115) (-1113.974) (-1111.855) * (-1119.723) (-1115.403) (-1112.619) [-1111.165] -- 0:00:48 249000 -- (-1112.749) (-1109.813) [-1115.136] (-1112.070) * (-1111.269) (-1112.236) [-1110.310] (-1111.638) -- 0:00:48 249500 -- (-1112.774) (-1110.109) [-1110.693] (-1111.397) * (-1111.864) (-1113.343) (-1109.397) [-1110.849] -- 0:00:48 250000 -- (-1112.343) (-1111.879) [-1112.251] (-1113.838) * (-1111.565) (-1113.980) [-1109.392] (-1111.275) -- 0:00:48 Average standard deviation of split frequencies: 0.016628 250500 -- [-1112.068] (-1112.360) (-1112.134) (-1111.764) * (-1115.258) (-1114.674) [-1111.473] (-1113.456) -- 0:00:47 251000 -- (-1111.404) (-1112.553) [-1110.256] (-1111.728) * (-1114.547) (-1112.025) (-1113.975) [-1110.536] -- 0:00:47 251500 -- (-1113.038) [-1109.582] (-1113.364) (-1112.049) * (-1113.654) (-1110.678) [-1113.953] (-1111.925) -- 0:00:47 252000 -- (-1112.385) [-1112.848] (-1111.975) (-1110.764) * (-1114.539) (-1112.586) [-1110.699] (-1112.657) -- 0:00:47 252500 -- (-1111.702) (-1113.124) (-1112.089) [-1111.426] * (-1112.841) (-1113.900) [-1111.645] (-1112.122) -- 0:00:47 253000 -- (-1111.705) (-1113.104) [-1113.509] (-1110.624) * (-1112.829) (-1110.604) (-1114.260) [-1113.960] -- 0:00:47 253500 -- (-1109.739) (-1116.851) (-1114.282) [-1111.300] * (-1112.559) (-1111.221) (-1111.298) [-1111.631] -- 0:00:47 254000 -- (-1111.188) (-1115.123) (-1114.373) [-1110.219] * (-1110.240) [-1111.988] (-1112.382) (-1114.874) -- 0:00:46 254500 -- (-1111.121) (-1115.047) [-1113.884] (-1110.547) * (-1111.360) (-1112.293) [-1110.136] (-1116.067) -- 0:00:46 255000 -- [-1112.787] (-1113.243) (-1111.445) (-1111.843) * [-1110.847] (-1113.246) (-1111.878) (-1111.201) -- 0:00:49 Average standard deviation of split frequencies: 0.016960 255500 -- (-1112.184) [-1113.519] (-1112.608) (-1110.574) * (-1111.119) (-1112.815) (-1111.172) [-1113.494] -- 0:00:49 256000 -- (-1111.557) (-1110.526) [-1113.820] (-1111.488) * (-1113.710) [-1113.374] (-1111.873) (-1112.618) -- 0:00:49 256500 -- (-1111.083) (-1110.531) [-1112.652] (-1110.474) * (-1113.844) [-1112.305] (-1116.697) (-1112.411) -- 0:00:49 257000 -- [-1109.926] (-1110.475) (-1111.285) (-1110.258) * (-1114.584) [-1110.828] (-1113.802) (-1114.070) -- 0:00:49 257500 -- [-1110.931] (-1111.313) (-1111.621) (-1110.807) * (-1113.716) [-1110.053] (-1113.529) (-1112.071) -- 0:00:49 258000 -- (-1110.038) (-1111.251) [-1112.086] (-1110.980) * (-1112.033) (-1110.328) [-1115.806] (-1114.927) -- 0:00:48 258500 -- (-1109.964) (-1110.651) (-1111.681) [-1110.571] * (-1112.310) [-1110.059] (-1121.147) (-1114.646) -- 0:00:48 259000 -- (-1110.677) (-1109.902) [-1109.880] (-1110.915) * (-1111.015) (-1112.363) (-1115.015) [-1112.398] -- 0:00:48 259500 -- [-1111.109] (-1111.994) (-1111.563) (-1114.684) * (-1112.108) (-1113.277) (-1112.952) [-1111.461] -- 0:00:48 260000 -- [-1110.267] (-1111.994) (-1111.624) (-1112.897) * (-1115.001) [-1111.580] (-1114.925) (-1110.037) -- 0:00:48 Average standard deviation of split frequencies: 0.016752 260500 -- (-1111.669) (-1110.592) [-1112.362] (-1114.012) * (-1112.428) (-1111.378) [-1111.653] (-1109.480) -- 0:00:48 261000 -- (-1111.742) (-1110.457) (-1111.661) [-1109.709] * (-1110.018) (-1111.208) (-1111.038) [-1110.350] -- 0:00:48 261500 -- (-1111.621) (-1111.227) [-1111.605] (-1110.146) * [-1110.821] (-1110.657) (-1111.092) (-1110.184) -- 0:00:48 262000 -- (-1110.797) (-1112.158) [-1112.295] (-1110.974) * (-1118.217) [-1109.984] (-1109.859) (-1110.286) -- 0:00:47 262500 -- (-1113.280) [-1114.122] (-1112.693) (-1110.842) * (-1111.671) (-1113.424) [-1111.106] (-1114.713) -- 0:00:47 263000 -- (-1111.802) [-1112.636] (-1112.520) (-1112.883) * [-1111.338] (-1110.975) (-1112.640) (-1116.569) -- 0:00:47 263500 -- (-1110.199) [-1112.874] (-1113.891) (-1114.123) * (-1111.795) (-1113.223) (-1112.095) [-1110.397] -- 0:00:47 264000 -- (-1112.696) (-1110.538) [-1110.632] (-1112.773) * (-1114.411) (-1111.906) [-1110.915] (-1111.991) -- 0:00:47 264500 -- (-1110.646) [-1112.518] (-1110.575) (-1112.366) * [-1112.236] (-1110.146) (-1110.972) (-1110.665) -- 0:00:47 265000 -- [-1111.701] (-1111.273) (-1112.327) (-1110.314) * [-1113.394] (-1111.460) (-1111.437) (-1112.130) -- 0:00:47 Average standard deviation of split frequencies: 0.017256 265500 -- (-1111.306) [-1110.727] (-1114.282) (-1111.243) * (-1113.860) (-1112.597) [-1111.223] (-1113.476) -- 0:00:47 266000 -- (-1110.254) [-1111.371] (-1116.594) (-1110.631) * (-1111.513) [-1111.597] (-1114.971) (-1112.835) -- 0:00:46 266500 -- (-1111.503) [-1112.060] (-1115.762) (-1110.028) * (-1111.210) [-1111.691] (-1110.749) (-1110.961) -- 0:00:46 267000 -- [-1110.468] (-1113.022) (-1115.233) (-1111.629) * (-1111.295) (-1111.523) [-1112.917] (-1110.266) -- 0:00:46 267500 -- (-1111.222) (-1113.775) (-1114.653) [-1112.210] * (-1110.024) [-1112.002] (-1114.502) (-1111.757) -- 0:00:46 268000 -- (-1111.414) (-1116.448) (-1113.151) [-1110.827] * (-1110.493) [-1114.189] (-1111.776) (-1111.749) -- 0:00:46 268500 -- [-1114.824] (-1112.415) (-1112.849) (-1114.397) * (-1114.805) [-1111.026] (-1110.405) (-1111.856) -- 0:00:46 269000 -- [-1111.289] (-1111.182) (-1113.283) (-1111.232) * [-1110.029] (-1114.808) (-1113.322) (-1109.824) -- 0:00:46 269500 -- (-1110.994) [-1110.942] (-1114.983) (-1113.835) * (-1109.530) (-1113.035) (-1110.371) [-1110.539] -- 0:00:48 270000 -- (-1117.555) (-1111.164) (-1110.131) [-1109.847] * [-1109.803] (-1112.528) (-1112.307) (-1113.951) -- 0:00:48 Average standard deviation of split frequencies: 0.017029 270500 -- (-1111.139) (-1117.273) (-1110.359) [-1109.951] * (-1111.606) [-1113.374] (-1114.084) (-1111.245) -- 0:00:48 271000 -- (-1111.602) [-1111.969] (-1109.946) (-1112.279) * (-1110.936) (-1114.148) (-1113.349) [-1112.297] -- 0:00:48 271500 -- (-1112.436) [-1109.390] (-1109.819) (-1110.415) * [-1111.460] (-1111.538) (-1109.945) (-1111.127) -- 0:00:48 272000 -- (-1110.979) (-1112.846) (-1113.444) [-1110.443] * (-1110.266) [-1109.839] (-1110.197) (-1110.977) -- 0:00:48 272500 -- [-1111.321] (-1113.425) (-1112.888) (-1113.137) * (-1110.190) (-1110.035) (-1110.246) [-1110.349] -- 0:00:48 273000 -- (-1112.853) (-1114.384) (-1112.733) [-1114.450] * (-1112.175) [-1112.023] (-1110.542) (-1110.348) -- 0:00:47 273500 -- (-1114.009) (-1115.174) [-1112.566] (-1111.016) * (-1109.684) [-1109.565] (-1112.334) (-1112.732) -- 0:00:47 274000 -- (-1112.216) [-1111.822] (-1111.644) (-1111.398) * (-1109.692) [-1111.506] (-1115.341) (-1111.852) -- 0:00:47 274500 -- (-1113.045) [-1112.820] (-1111.919) (-1111.197) * [-1112.656] (-1113.922) (-1115.030) (-1112.003) -- 0:00:47 275000 -- (-1116.129) [-1111.613] (-1110.934) (-1111.009) * (-1111.197) [-1113.219] (-1111.670) (-1111.976) -- 0:00:47 Average standard deviation of split frequencies: 0.017080 275500 -- (-1111.811) (-1113.005) (-1110.901) [-1111.181] * (-1115.938) (-1111.500) (-1112.769) [-1112.245] -- 0:00:47 276000 -- (-1110.755) [-1110.341] (-1110.159) (-1113.101) * (-1112.376) (-1112.770) (-1113.102) [-1109.724] -- 0:00:47 276500 -- (-1111.637) [-1112.066] (-1112.071) (-1112.855) * (-1116.022) (-1115.147) [-1111.825] (-1112.943) -- 0:00:47 277000 -- (-1110.837) (-1112.648) (-1110.308) [-1109.924] * [-1114.491] (-1112.667) (-1111.079) (-1117.580) -- 0:00:46 277500 -- (-1112.976) (-1110.023) (-1111.212) [-1110.830] * (-1110.947) (-1109.981) (-1111.630) [-1111.889] -- 0:00:46 278000 -- (-1112.383) (-1110.293) [-1111.411] (-1112.614) * [-1110.026] (-1110.486) (-1112.993) (-1111.056) -- 0:00:46 278500 -- (-1116.140) (-1114.865) [-1113.443] (-1112.457) * (-1112.760) [-1109.519] (-1113.191) (-1111.036) -- 0:00:46 279000 -- (-1113.590) (-1115.239) [-1111.583] (-1112.114) * [-1113.449] (-1109.716) (-1115.060) (-1112.266) -- 0:00:46 279500 -- (-1112.220) (-1112.305) [-1111.132] (-1110.102) * (-1113.528) [-1110.799] (-1117.742) (-1115.304) -- 0:00:46 280000 -- (-1111.607) [-1112.218] (-1113.338) (-1110.251) * (-1113.246) [-1112.683] (-1113.688) (-1111.449) -- 0:00:46 Average standard deviation of split frequencies: 0.017356 280500 -- (-1111.481) [-1112.021] (-1110.987) (-1111.212) * (-1113.004) (-1112.181) (-1113.319) [-1110.739] -- 0:00:46 281000 -- [-1110.795] (-1110.065) (-1111.842) (-1112.791) * (-1111.975) (-1111.419) [-1113.833] (-1111.039) -- 0:00:46 281500 -- (-1111.328) [-1110.964] (-1110.659) (-1114.143) * (-1111.362) (-1112.931) [-1111.699] (-1110.104) -- 0:00:45 282000 -- (-1112.528) [-1110.096] (-1111.897) (-1114.983) * [-1111.685] (-1110.372) (-1110.258) (-1110.236) -- 0:00:45 282500 -- [-1110.372] (-1110.162) (-1110.833) (-1113.638) * (-1110.571) (-1111.595) (-1113.851) [-1110.913] -- 0:00:45 283000 -- (-1114.862) (-1111.448) [-1109.976] (-1112.218) * (-1112.023) (-1109.583) (-1113.871) [-1110.003] -- 0:00:45 283500 -- (-1112.115) (-1110.200) [-1110.404] (-1109.888) * [-1111.239] (-1109.767) (-1113.849) (-1111.887) -- 0:00:45 284000 -- [-1110.794] (-1110.200) (-1118.239) (-1110.423) * (-1113.107) (-1109.378) [-1112.475] (-1111.979) -- 0:00:45 284500 -- (-1110.091) (-1112.056) [-1111.881] (-1112.186) * (-1113.896) [-1110.737] (-1112.057) (-1111.651) -- 0:00:45 285000 -- [-1110.584] (-1112.080) (-1112.031) (-1110.441) * (-1113.730) (-1111.700) (-1112.015) [-1111.797] -- 0:00:45 Average standard deviation of split frequencies: 0.016849 285500 -- (-1110.460) (-1111.521) [-1113.746] (-1112.384) * (-1113.338) (-1113.971) (-1111.316) [-1110.386] -- 0:00:47 286000 -- (-1111.225) (-1113.143) (-1113.799) [-1111.866] * (-1110.776) (-1111.663) [-1112.518] (-1111.128) -- 0:00:47 286500 -- (-1110.208) (-1113.143) (-1114.148) [-1110.502] * (-1111.828) [-1111.250] (-1115.650) (-1111.151) -- 0:00:47 287000 -- (-1114.526) [-1114.418] (-1110.314) (-1109.702) * [-1112.559] (-1113.266) (-1113.731) (-1115.687) -- 0:00:47 287500 -- [-1111.377] (-1111.912) (-1111.773) (-1110.348) * (-1112.303) (-1111.686) (-1112.411) [-1110.748] -- 0:00:47 288000 -- (-1110.726) [-1110.614] (-1111.736) (-1110.188) * (-1119.341) (-1111.497) [-1112.234] (-1110.831) -- 0:00:46 288500 -- [-1110.699] (-1109.577) (-1115.079) (-1109.739) * (-1118.574) (-1111.898) [-1110.941] (-1110.679) -- 0:00:46 289000 -- [-1112.135] (-1109.756) (-1110.549) (-1109.666) * [-1110.744] (-1111.652) (-1111.337) (-1112.623) -- 0:00:46 289500 -- (-1114.190) [-1109.784] (-1110.549) (-1112.688) * (-1110.981) [-1113.012] (-1110.865) (-1111.627) -- 0:00:46 290000 -- [-1112.113] (-1109.580) (-1110.162) (-1109.989) * [-1111.758] (-1113.289) (-1110.045) (-1112.570) -- 0:00:46 Average standard deviation of split frequencies: 0.016047 290500 -- (-1111.205) (-1109.589) [-1111.553] (-1115.229) * [-1110.501] (-1113.024) (-1110.299) (-1111.972) -- 0:00:46 291000 -- (-1111.383) (-1109.697) [-1109.898] (-1114.633) * (-1113.892) [-1112.250] (-1109.580) (-1112.206) -- 0:00:46 291500 -- (-1110.870) [-1109.738] (-1109.915) (-1111.327) * (-1112.642) (-1110.409) [-1113.502] (-1114.455) -- 0:00:46 292000 -- (-1112.755) (-1109.557) (-1112.640) [-1111.438] * (-1110.550) (-1110.496) (-1116.258) [-1112.852] -- 0:00:46 292500 -- (-1112.650) (-1110.150) [-1110.724] (-1111.839) * (-1110.249) (-1111.774) (-1113.019) [-1112.576] -- 0:00:45 293000 -- (-1114.157) (-1111.798) [-1111.928] (-1109.878) * (-1111.070) [-1113.584] (-1110.758) (-1110.166) -- 0:00:45 293500 -- (-1109.997) (-1111.687) [-1111.773] (-1109.731) * (-1111.440) (-1113.059) [-1111.938] (-1110.011) -- 0:00:45 294000 -- [-1111.524] (-1110.655) (-1115.346) (-1110.930) * (-1110.102) (-1116.305) (-1114.620) [-1110.844] -- 0:00:45 294500 -- (-1111.487) (-1110.870) [-1112.570] (-1110.772) * (-1113.186) [-1114.661] (-1112.019) (-1112.964) -- 0:00:45 295000 -- [-1110.016] (-1110.582) (-1111.710) (-1111.247) * (-1112.231) (-1119.363) [-1111.661] (-1115.166) -- 0:00:45 Average standard deviation of split frequencies: 0.015758 295500 -- (-1112.307) [-1110.194] (-1110.395) (-1112.726) * (-1112.763) [-1112.180] (-1111.587) (-1114.933) -- 0:00:45 296000 -- [-1111.943] (-1113.177) (-1112.213) (-1111.184) * (-1112.324) [-1111.298] (-1113.363) (-1115.269) -- 0:00:45 296500 -- [-1110.622] (-1113.383) (-1110.974) (-1111.703) * (-1112.388) (-1111.515) [-1114.468] (-1113.369) -- 0:00:45 297000 -- [-1109.986] (-1111.721) (-1112.121) (-1112.640) * (-1109.890) (-1111.415) (-1116.374) [-1114.331] -- 0:00:44 297500 -- (-1111.230) [-1113.143] (-1111.173) (-1113.329) * [-1110.302] (-1114.829) (-1119.979) (-1112.063) -- 0:00:44 298000 -- (-1112.862) [-1111.146] (-1111.250) (-1112.470) * [-1109.693] (-1111.951) (-1114.771) (-1111.081) -- 0:00:44 298500 -- (-1112.563) [-1110.202] (-1111.788) (-1110.593) * [-1111.220] (-1111.612) (-1111.627) (-1111.095) -- 0:00:44 299000 -- [-1112.782] (-1110.888) (-1113.028) (-1110.107) * (-1110.894) [-1110.117] (-1110.537) (-1111.232) -- 0:00:44 299500 -- (-1111.780) [-1114.562] (-1110.352) (-1112.568) * (-1117.070) (-1110.304) [-1110.436] (-1110.795) -- 0:00:44 300000 -- (-1110.908) [-1115.031] (-1110.373) (-1117.342) * (-1112.863) (-1114.466) (-1113.149) [-1112.279] -- 0:00:44 Average standard deviation of split frequencies: 0.016091 300500 -- [-1110.528] (-1111.813) (-1113.601) (-1110.850) * [-1109.865] (-1113.406) (-1113.260) (-1111.850) -- 0:00:44 301000 -- (-1111.658) (-1111.114) (-1111.212) [-1111.214] * (-1110.388) [-1110.481] (-1111.062) (-1111.374) -- 0:00:44 301500 -- (-1112.666) (-1110.576) (-1114.994) [-1114.135] * [-1112.017] (-1111.731) (-1111.004) (-1111.081) -- 0:00:46 302000 -- [-1114.067] (-1109.751) (-1118.099) (-1110.188) * [-1111.701] (-1112.864) (-1110.468) (-1111.079) -- 0:00:46 302500 -- [-1111.346] (-1112.593) (-1111.698) (-1113.258) * (-1111.703) [-1110.855] (-1111.903) (-1109.960) -- 0:00:46 303000 -- [-1112.312] (-1115.847) (-1111.327) (-1113.236) * (-1110.887) (-1112.333) [-1113.801] (-1113.209) -- 0:00:46 303500 -- (-1111.742) (-1114.649) [-1110.534] (-1112.305) * [-1114.604] (-1114.176) (-1111.267) (-1118.354) -- 0:00:45 304000 -- (-1112.382) [-1112.501] (-1112.320) (-1113.343) * [-1110.250] (-1110.600) (-1112.816) (-1110.684) -- 0:00:45 304500 -- (-1110.818) (-1110.403) [-1110.781] (-1111.601) * (-1113.506) [-1113.590] (-1111.214) (-1116.430) -- 0:00:45 305000 -- [-1113.835] (-1110.443) (-1112.309) (-1111.018) * (-1109.949) [-1111.228] (-1110.912) (-1113.068) -- 0:00:45 Average standard deviation of split frequencies: 0.015486 305500 -- (-1110.984) (-1112.219) (-1110.275) [-1110.075] * [-1111.800] (-1112.550) (-1110.116) (-1112.420) -- 0:00:45 306000 -- (-1112.973) (-1111.044) [-1109.989] (-1111.090) * (-1112.899) (-1112.667) (-1110.199) [-1113.642] -- 0:00:45 306500 -- (-1111.167) (-1110.408) [-1113.685] (-1112.247) * (-1113.368) [-1110.072] (-1110.370) (-1111.054) -- 0:00:45 307000 -- (-1110.225) (-1112.241) [-1111.359] (-1111.664) * (-1110.076) (-1111.514) (-1113.414) [-1114.894] -- 0:00:45 307500 -- (-1110.131) (-1111.510) (-1110.034) [-1110.894] * [-1109.691] (-1113.488) (-1111.687) (-1111.201) -- 0:00:45 308000 -- [-1109.737] (-1110.546) (-1112.050) (-1110.693) * (-1111.747) (-1112.159) [-1110.247] (-1114.910) -- 0:00:44 308500 -- [-1110.761] (-1113.884) (-1113.109) (-1110.965) * [-1110.732] (-1112.312) (-1110.205) (-1115.058) -- 0:00:44 309000 -- (-1111.145) [-1110.718] (-1111.246) (-1111.654) * [-1111.758] (-1111.430) (-1110.782) (-1111.205) -- 0:00:44 309500 -- (-1110.077) [-1110.345] (-1110.972) (-1110.142) * [-1112.054] (-1110.914) (-1112.737) (-1112.906) -- 0:00:44 310000 -- (-1112.233) (-1110.529) (-1110.667) [-1110.029] * (-1112.602) (-1110.091) [-1111.509] (-1112.566) -- 0:00:44 Average standard deviation of split frequencies: 0.014375 310500 -- (-1113.784) [-1109.858] (-1110.794) (-1112.020) * (-1111.281) [-1111.249] (-1111.311) (-1110.989) -- 0:00:44 311000 -- (-1115.364) [-1110.131] (-1113.546) (-1109.748) * (-1112.058) [-1111.688] (-1111.731) (-1111.481) -- 0:00:44 311500 -- [-1111.841] (-1110.250) (-1113.753) (-1111.479) * (-1111.836) (-1111.888) [-1112.136] (-1110.993) -- 0:00:44 312000 -- (-1110.357) (-1110.246) (-1114.770) [-1112.955] * (-1115.412) (-1113.210) [-1110.464] (-1114.003) -- 0:00:44 312500 -- [-1112.435] (-1110.801) (-1114.541) (-1113.186) * (-1112.401) [-1110.069] (-1110.543) (-1112.815) -- 0:00:44 313000 -- [-1112.376] (-1110.045) (-1111.957) (-1113.929) * (-1112.890) (-1111.641) (-1110.410) [-1112.325] -- 0:00:43 313500 -- (-1111.974) (-1114.159) [-1110.588] (-1113.431) * [-1113.003] (-1112.417) (-1111.213) (-1113.574) -- 0:00:43 314000 -- (-1115.514) [-1111.174] (-1112.597) (-1111.856) * [-1112.361] (-1110.779) (-1113.084) (-1110.640) -- 0:00:43 314500 -- (-1112.626) (-1112.838) [-1110.912] (-1115.295) * (-1112.190) (-1113.561) [-1113.440] (-1113.494) -- 0:00:43 315000 -- (-1114.078) (-1110.339) (-1111.106) [-1112.930] * (-1109.412) (-1110.996) [-1113.016] (-1112.525) -- 0:00:43 Average standard deviation of split frequencies: 0.015232 315500 -- (-1111.049) (-1110.623) (-1111.477) [-1111.691] * (-1111.188) [-1111.213] (-1115.875) (-1114.169) -- 0:00:43 316000 -- (-1110.198) [-1110.869] (-1111.088) (-1112.161) * (-1110.803) (-1110.998) (-1112.946) [-1116.922] -- 0:00:43 316500 -- (-1111.782) (-1112.174) [-1116.916] (-1110.792) * (-1110.554) (-1110.192) [-1109.693] (-1111.810) -- 0:00:45 317000 -- [-1111.048] (-1112.316) (-1116.899) (-1116.623) * (-1110.763) (-1111.447) (-1109.844) [-1112.397] -- 0:00:45 317500 -- (-1118.682) [-1112.211] (-1111.126) (-1110.913) * (-1110.289) (-1110.808) [-1110.436] (-1113.457) -- 0:00:45 318000 -- [-1110.066] (-1114.364) (-1114.419) (-1110.635) * [-1111.148] (-1110.952) (-1110.672) (-1110.554) -- 0:00:45 318500 -- [-1110.873] (-1113.445) (-1112.798) (-1110.054) * (-1111.108) (-1112.684) [-1110.426] (-1114.706) -- 0:00:44 319000 -- (-1112.363) [-1115.012] (-1111.196) (-1111.885) * (-1110.308) (-1111.021) (-1111.214) [-1112.032] -- 0:00:44 319500 -- [-1110.829] (-1116.252) (-1112.534) (-1109.885) * [-1111.075] (-1111.180) (-1110.727) (-1111.530) -- 0:00:44 320000 -- (-1115.329) (-1115.419) (-1112.589) [-1118.562] * (-1115.808) [-1111.475] (-1111.355) (-1112.265) -- 0:00:44 Average standard deviation of split frequencies: 0.014391 320500 -- (-1113.177) [-1111.139] (-1111.556) (-1116.536) * [-1112.092] (-1114.701) (-1114.775) (-1111.170) -- 0:00:44 321000 -- (-1112.703) [-1113.562] (-1110.963) (-1114.817) * (-1110.414) [-1111.930] (-1114.200) (-1110.770) -- 0:00:44 321500 -- (-1113.978) (-1115.062) [-1110.868] (-1113.727) * (-1110.743) [-1112.731] (-1113.565) (-1110.577) -- 0:00:44 322000 -- (-1115.166) [-1113.159] (-1110.479) (-1115.543) * [-1111.199] (-1116.373) (-1111.351) (-1112.934) -- 0:00:44 322500 -- [-1110.806] (-1111.311) (-1109.870) (-1109.588) * (-1113.238) (-1116.729) [-1112.494] (-1115.775) -- 0:00:44 323000 -- [-1110.696] (-1119.583) (-1110.232) (-1109.935) * (-1113.825) [-1111.971] (-1116.357) (-1114.051) -- 0:00:44 323500 -- (-1111.362) (-1113.620) [-1110.432] (-1112.639) * (-1114.876) [-1112.563] (-1110.454) (-1114.750) -- 0:00:43 324000 -- [-1112.489] (-1112.201) (-1112.480) (-1112.491) * (-1113.356) [-1111.773] (-1112.639) (-1112.947) -- 0:00:43 324500 -- [-1111.921] (-1111.152) (-1112.498) (-1112.157) * (-1113.709) [-1110.674] (-1113.680) (-1111.908) -- 0:00:43 325000 -- [-1111.425] (-1111.992) (-1112.515) (-1111.658) * (-1111.149) (-1113.758) [-1111.000] (-1110.668) -- 0:00:43 Average standard deviation of split frequencies: 0.014536 325500 -- [-1109.985] (-1110.450) (-1113.603) (-1113.479) * (-1115.035) (-1112.156) (-1111.126) [-1109.775] -- 0:00:43 326000 -- [-1112.192] (-1111.811) (-1113.164) (-1110.122) * (-1112.216) (-1113.365) [-1110.832] (-1111.338) -- 0:00:43 326500 -- (-1112.317) (-1112.431) [-1111.976] (-1111.646) * (-1111.431) (-1111.382) [-1110.171] (-1110.807) -- 0:00:43 327000 -- (-1110.459) (-1112.681) (-1111.115) [-1114.148] * (-1111.758) [-1112.761] (-1112.059) (-1112.211) -- 0:00:43 327500 -- [-1111.083] (-1115.948) (-1113.448) (-1115.022) * [-1110.590] (-1110.280) (-1111.157) (-1111.673) -- 0:00:43 328000 -- [-1111.558] (-1116.257) (-1111.883) (-1112.252) * (-1110.261) [-1110.819] (-1111.345) (-1109.453) -- 0:00:43 328500 -- (-1111.292) [-1111.598] (-1112.251) (-1112.450) * (-1112.404) (-1110.497) [-1110.858] (-1109.693) -- 0:00:42 329000 -- (-1115.616) (-1115.589) [-1110.388] (-1111.457) * (-1114.665) (-1110.618) [-1111.367] (-1109.734) -- 0:00:42 329500 -- (-1110.873) [-1109.790] (-1110.474) (-1111.666) * (-1113.150) [-1110.541] (-1109.754) (-1110.046) -- 0:00:42 330000 -- (-1111.973) (-1114.948) (-1110.334) [-1110.940] * (-1109.849) (-1110.462) [-1109.494] (-1111.364) -- 0:00:42 Average standard deviation of split frequencies: 0.013131 330500 -- (-1110.844) (-1113.735) (-1116.208) [-1112.994] * (-1110.180) (-1110.425) [-1111.341] (-1110.831) -- 0:00:44 331000 -- (-1115.327) [-1112.292] (-1116.975) (-1117.661) * (-1111.954) (-1111.581) (-1113.233) [-1112.329] -- 0:00:44 331500 -- (-1110.111) (-1113.605) [-1112.329] (-1111.601) * (-1109.716) (-1110.895) (-1114.401) [-1112.641] -- 0:00:44 332000 -- (-1112.432) [-1111.523] (-1113.325) (-1111.895) * (-1112.843) [-1112.076] (-1115.019) (-1111.973) -- 0:00:44 332500 -- (-1110.190) (-1111.420) (-1111.346) [-1109.539] * (-1110.326) (-1109.706) (-1115.812) [-1111.590] -- 0:00:44 333000 -- (-1110.068) (-1111.247) (-1112.751) [-1110.725] * (-1111.646) (-1111.423) (-1112.519) [-1112.138] -- 0:00:44 333500 -- [-1110.924] (-1110.004) (-1111.559) (-1116.385) * (-1111.476) [-1114.739] (-1111.317) (-1111.230) -- 0:00:43 334000 -- (-1111.551) (-1110.325) (-1113.783) [-1111.606] * [-1114.857] (-1113.224) (-1116.924) (-1113.284) -- 0:00:43 334500 -- [-1111.178] (-1110.607) (-1110.801) (-1112.097) * [-1115.177] (-1113.716) (-1114.491) (-1111.460) -- 0:00:43 335000 -- (-1111.284) (-1109.496) [-1111.266] (-1112.038) * (-1112.549) (-1111.998) [-1112.999] (-1113.615) -- 0:00:43 Average standard deviation of split frequencies: 0.013874 335500 -- [-1110.405] (-1111.914) (-1112.127) (-1110.259) * [-1113.760] (-1114.633) (-1112.390) (-1112.490) -- 0:00:43 336000 -- [-1110.413] (-1112.691) (-1111.695) (-1111.425) * (-1110.949) (-1115.638) [-1110.267] (-1112.518) -- 0:00:43 336500 -- (-1111.017) (-1110.932) (-1110.827) [-1111.946] * (-1110.335) (-1112.275) (-1111.338) [-1112.806] -- 0:00:43 337000 -- (-1110.286) [-1114.620] (-1114.036) (-1110.578) * [-1109.439] (-1110.845) (-1113.184) (-1117.238) -- 0:00:43 337500 -- (-1113.139) (-1109.974) [-1113.072] (-1110.172) * [-1110.270] (-1110.139) (-1110.437) (-1115.411) -- 0:00:43 338000 -- (-1111.403) [-1111.848] (-1111.716) (-1111.724) * (-1109.622) (-1110.680) (-1112.652) [-1110.028] -- 0:00:43 338500 -- (-1116.487) (-1112.960) [-1113.091] (-1110.105) * (-1110.403) (-1114.197) (-1112.516) [-1110.844] -- 0:00:42 339000 -- (-1110.696) [-1110.641] (-1114.323) (-1111.312) * [-1113.065] (-1112.875) (-1112.572) (-1110.638) -- 0:00:42 339500 -- [-1110.961] (-1109.884) (-1114.003) (-1110.526) * (-1112.215) [-1110.455] (-1112.244) (-1111.217) -- 0:00:42 340000 -- (-1113.619) [-1109.985] (-1111.425) (-1110.308) * (-1110.333) (-1115.314) [-1110.464] (-1110.895) -- 0:00:42 Average standard deviation of split frequencies: 0.013431 340500 -- (-1110.320) [-1110.089] (-1110.964) (-1112.047) * [-1110.396] (-1114.364) (-1110.469) (-1112.629) -- 0:00:42 341000 -- [-1112.151] (-1112.038) (-1111.577) (-1111.953) * (-1111.367) [-1110.869] (-1110.571) (-1113.060) -- 0:00:42 341500 -- (-1110.876) (-1111.216) [-1111.241] (-1109.872) * (-1110.017) (-1114.202) [-1110.238] (-1110.203) -- 0:00:42 342000 -- (-1111.053) [-1112.289] (-1112.288) (-1110.337) * (-1113.537) [-1111.592] (-1110.099) (-1109.556) -- 0:00:42 342500 -- (-1111.262) [-1110.256] (-1110.604) (-1110.797) * (-1112.600) [-1111.682] (-1110.454) (-1110.523) -- 0:00:42 343000 -- (-1112.051) (-1109.856) [-1111.195] (-1112.328) * [-1112.882] (-1111.803) (-1110.494) (-1112.742) -- 0:00:42 343500 -- (-1112.849) (-1110.633) (-1111.046) [-1110.642] * (-1114.134) (-1115.424) [-1111.372] (-1112.103) -- 0:00:42 344000 -- (-1112.427) (-1113.220) (-1112.949) [-1110.392] * (-1111.383) (-1110.775) (-1110.875) [-1113.626] -- 0:00:41 344500 -- (-1111.777) (-1110.678) [-1114.488] (-1110.491) * (-1111.386) [-1110.389] (-1110.871) (-1110.103) -- 0:00:41 345000 -- (-1110.280) (-1111.629) [-1111.873] (-1118.280) * (-1110.701) (-1111.185) [-1110.163] (-1111.222) -- 0:00:43 Average standard deviation of split frequencies: 0.013170 345500 -- (-1110.896) (-1110.393) [-1111.062] (-1115.150) * (-1112.331) (-1112.519) (-1113.653) [-1110.198] -- 0:00:43 346000 -- [-1110.645] (-1112.695) (-1113.003) (-1112.447) * (-1110.592) (-1112.059) (-1116.701) [-1110.440] -- 0:00:43 346500 -- [-1111.414] (-1112.886) (-1112.968) (-1110.842) * (-1112.014) [-1112.391] (-1112.712) (-1112.260) -- 0:00:43 347000 -- [-1111.876] (-1110.382) (-1110.663) (-1110.332) * (-1111.425) (-1111.519) [-1111.502] (-1111.247) -- 0:00:43 347500 -- (-1110.884) [-1110.536] (-1111.190) (-1114.480) * (-1111.641) (-1113.294) (-1114.351) [-1111.459] -- 0:00:43 348000 -- (-1114.752) (-1110.289) [-1113.119] (-1110.818) * (-1112.022) [-1110.632] (-1120.230) (-1114.454) -- 0:00:43 348500 -- (-1112.093) [-1112.152] (-1112.821) (-1111.413) * (-1113.463) (-1112.980) [-1114.522] (-1120.897) -- 0:00:42 349000 -- (-1111.060) (-1110.063) [-1110.910] (-1110.567) * [-1114.123] (-1112.567) (-1111.704) (-1113.310) -- 0:00:42 349500 -- (-1110.417) (-1111.084) (-1110.595) [-1109.808] * (-1112.897) [-1112.176] (-1112.710) (-1113.695) -- 0:00:42 350000 -- (-1112.066) (-1110.273) (-1111.565) [-1112.328] * (-1112.500) [-1110.779] (-1112.835) (-1113.480) -- 0:00:42 Average standard deviation of split frequencies: 0.013742 350500 -- [-1112.130] (-1111.618) (-1111.173) (-1112.339) * (-1111.040) [-1110.539] (-1110.872) (-1111.199) -- 0:00:42 351000 -- (-1113.183) [-1110.402] (-1112.031) (-1112.849) * [-1114.265] (-1111.935) (-1111.018) (-1109.894) -- 0:00:42 351500 -- (-1112.669) (-1112.325) [-1113.576] (-1115.960) * (-1112.303) (-1112.730) [-1110.142] (-1111.794) -- 0:00:42 352000 -- [-1109.728] (-1111.994) (-1113.249) (-1111.847) * (-1111.913) (-1112.154) [-1112.635] (-1109.903) -- 0:00:42 352500 -- [-1110.067] (-1113.341) (-1110.336) (-1111.321) * [-1114.522] (-1112.233) (-1110.274) (-1110.447) -- 0:00:42 353000 -- [-1109.955] (-1111.901) (-1109.875) (-1111.296) * (-1111.741) [-1114.023] (-1112.506) (-1110.721) -- 0:00:42 353500 -- [-1112.171] (-1109.982) (-1111.072) (-1110.111) * (-1111.288) (-1114.377) [-1113.549] (-1110.793) -- 0:00:42 354000 -- (-1112.309) (-1110.581) [-1111.948] (-1113.392) * (-1112.010) [-1111.068] (-1110.015) (-1111.805) -- 0:00:41 354500 -- [-1110.634] (-1110.975) (-1113.804) (-1110.213) * [-1110.189] (-1110.093) (-1110.851) (-1113.906) -- 0:00:41 355000 -- (-1110.350) [-1111.166] (-1113.776) (-1110.639) * [-1110.125] (-1111.478) (-1110.963) (-1115.958) -- 0:00:41 Average standard deviation of split frequencies: 0.012506 355500 -- (-1112.014) (-1114.707) [-1112.206] (-1111.222) * (-1109.641) (-1110.912) [-1113.310] (-1111.847) -- 0:00:41 356000 -- (-1113.415) [-1113.021] (-1114.364) (-1111.012) * (-1110.965) (-1114.984) (-1110.295) [-1111.347] -- 0:00:41 356500 -- (-1112.364) (-1111.788) [-1113.901] (-1111.290) * [-1112.587] (-1112.280) (-1109.843) (-1113.004) -- 0:00:41 357000 -- [-1112.551] (-1111.968) (-1116.194) (-1110.516) * [-1110.335] (-1111.952) (-1110.504) (-1113.098) -- 0:00:41 357500 -- (-1110.500) (-1110.527) (-1110.599) [-1110.712] * (-1111.876) (-1114.132) (-1111.264) [-1113.620] -- 0:00:41 358000 -- (-1114.590) (-1119.082) [-1110.264] (-1110.002) * (-1113.139) [-1111.989] (-1111.390) (-1114.717) -- 0:00:41 358500 -- (-1109.739) (-1109.858) [-1110.320] (-1111.885) * [-1113.406] (-1111.077) (-1115.700) (-1111.580) -- 0:00:41 359000 -- [-1112.501] (-1110.321) (-1109.809) (-1111.929) * (-1114.303) (-1111.256) (-1111.271) [-1112.487] -- 0:00:41 359500 -- [-1112.889] (-1110.590) (-1110.456) (-1112.199) * (-1115.986) (-1112.894) [-1111.796] (-1112.034) -- 0:00:42 360000 -- (-1111.355) (-1110.869) (-1113.362) [-1111.107] * (-1111.100) [-1113.863] (-1111.264) (-1113.102) -- 0:00:42 Average standard deviation of split frequencies: 0.013397 360500 -- [-1110.087] (-1113.062) (-1113.998) (-1113.215) * (-1112.705) (-1110.470) (-1111.067) [-1111.998] -- 0:00:42 361000 -- [-1112.055] (-1115.057) (-1111.064) (-1113.503) * (-1112.377) [-1109.908] (-1110.824) (-1110.738) -- 0:00:42 361500 -- [-1110.661] (-1112.287) (-1110.128) (-1112.468) * [-1109.865] (-1109.551) (-1111.914) (-1111.679) -- 0:00:42 362000 -- (-1114.780) (-1114.532) (-1111.553) [-1111.135] * (-1110.079) (-1109.746) [-1111.108] (-1112.831) -- 0:00:42 362500 -- (-1113.160) (-1112.271) (-1111.812) [-1110.687] * (-1116.102) (-1111.436) (-1111.800) [-1111.432] -- 0:00:42 363000 -- (-1113.124) (-1111.386) (-1111.168) [-1114.158] * (-1112.362) (-1110.023) (-1110.346) [-1110.267] -- 0:00:42 363500 -- [-1112.002] (-1110.517) (-1109.618) (-1110.769) * (-1113.428) [-1109.716] (-1110.408) (-1112.956) -- 0:00:42 364000 -- [-1111.849] (-1112.787) (-1114.421) (-1111.504) * (-1111.401) (-1113.405) (-1115.767) [-1112.270] -- 0:00:41 364500 -- (-1116.242) [-1111.160] (-1111.793) (-1111.270) * [-1113.777] (-1115.596) (-1111.626) (-1111.316) -- 0:00:41 365000 -- (-1115.933) (-1114.087) [-1112.029] (-1115.615) * [-1116.383] (-1112.467) (-1111.591) (-1112.780) -- 0:00:41 Average standard deviation of split frequencies: 0.012021 365500 -- (-1111.633) (-1112.997) [-1112.365] (-1109.732) * (-1112.513) (-1112.387) [-1114.880] (-1112.779) -- 0:00:41 366000 -- (-1112.296) (-1115.524) (-1112.447) [-1109.303] * (-1113.415) (-1112.682) [-1112.330] (-1112.873) -- 0:00:41 366500 -- (-1113.170) [-1117.157] (-1113.849) (-1110.244) * (-1112.501) [-1109.943] (-1112.349) (-1110.569) -- 0:00:41 367000 -- (-1113.339) [-1113.480] (-1110.213) (-1111.859) * (-1111.937) [-1111.012] (-1111.069) (-1113.449) -- 0:00:41 367500 -- (-1112.459) (-1117.234) [-1110.551] (-1116.519) * (-1112.745) [-1113.007] (-1111.010) (-1113.644) -- 0:00:41 368000 -- [-1112.645] (-1115.010) (-1111.370) (-1111.615) * (-1113.159) (-1110.514) (-1110.645) [-1113.386] -- 0:00:41 368500 -- [-1110.373] (-1110.017) (-1111.391) (-1110.140) * (-1110.725) (-1111.913) [-1111.093] (-1116.491) -- 0:00:41 369000 -- (-1112.258) (-1111.429) [-1110.914] (-1112.137) * (-1114.668) [-1114.380] (-1110.580) (-1116.702) -- 0:00:41 369500 -- (-1111.812) (-1109.537) [-1110.523] (-1113.232) * (-1113.301) (-1113.294) [-1111.377] (-1112.950) -- 0:00:40 370000 -- [-1109.752] (-1111.780) (-1113.087) (-1114.746) * (-1110.238) (-1114.071) (-1111.377) [-1112.174] -- 0:00:40 Average standard deviation of split frequencies: 0.011517 370500 -- (-1111.383) (-1111.645) (-1114.524) [-1111.030] * (-1109.381) (-1111.537) [-1112.132] (-1112.114) -- 0:00:40 371000 -- (-1111.446) (-1117.859) (-1111.969) [-1111.644] * (-1111.290) (-1112.244) [-1112.256] (-1111.862) -- 0:00:40 371500 -- [-1112.482] (-1113.539) (-1111.083) (-1110.639) * (-1112.343) (-1111.074) (-1112.155) [-1114.366] -- 0:00:40 372000 -- (-1111.847) (-1112.018) (-1112.899) [-1111.056] * (-1110.840) [-1109.894] (-1110.447) (-1114.616) -- 0:00:40 372500 -- (-1113.228) [-1112.957] (-1113.145) (-1116.541) * (-1111.408) [-1112.407] (-1113.911) (-1113.237) -- 0:00:40 373000 -- (-1111.173) (-1112.467) (-1115.729) [-1111.531] * (-1111.854) (-1112.661) (-1112.574) [-1111.549] -- 0:00:40 373500 -- (-1111.333) [-1110.445] (-1112.181) (-1116.246) * (-1114.718) (-1114.337) [-1110.526] (-1112.983) -- 0:00:40 374000 -- [-1112.158] (-1110.891) (-1112.661) (-1111.618) * [-1112.759] (-1116.318) (-1110.725) (-1110.553) -- 0:00:41 374500 -- (-1111.644) [-1113.039] (-1112.854) (-1112.140) * [-1113.888] (-1116.210) (-1110.389) (-1111.438) -- 0:00:41 375000 -- (-1110.237) [-1109.772] (-1110.434) (-1112.048) * (-1110.338) (-1112.857) [-1110.657] (-1116.369) -- 0:00:41 Average standard deviation of split frequencies: 0.012611 375500 -- (-1111.232) (-1111.355) (-1110.180) [-1113.518] * (-1109.879) [-1111.744] (-1111.271) (-1114.701) -- 0:00:41 376000 -- (-1110.693) [-1112.539] (-1111.104) (-1110.770) * [-1113.900] (-1110.126) (-1111.047) (-1112.544) -- 0:00:41 376500 -- (-1110.506) (-1109.830) [-1112.873] (-1110.898) * (-1110.729) (-1109.809) [-1112.936] (-1109.939) -- 0:00:41 377000 -- (-1113.686) (-1110.212) [-1114.786] (-1119.003) * (-1113.832) (-1116.116) (-1113.568) [-1110.968] -- 0:00:41 377500 -- (-1118.325) (-1111.410) (-1115.517) [-1112.072] * [-1113.293] (-1112.285) (-1112.264) (-1112.090) -- 0:00:41 378000 -- (-1111.103) (-1113.298) [-1111.230] (-1110.475) * (-1112.111) (-1110.848) [-1112.134] (-1113.618) -- 0:00:41 378500 -- (-1110.398) (-1111.652) (-1112.038) [-1110.046] * (-1112.805) (-1109.856) (-1113.891) [-1112.833] -- 0:00:41 379000 -- [-1111.598] (-1113.092) (-1110.744) (-1113.097) * [-1111.306] (-1111.936) (-1111.839) (-1111.617) -- 0:00:40 379500 -- (-1111.094) [-1109.703] (-1111.128) (-1112.557) * (-1111.499) [-1110.604] (-1113.085) (-1110.964) -- 0:00:40 380000 -- (-1110.676) (-1115.433) [-1113.181] (-1111.420) * [-1113.934] (-1111.008) (-1111.646) (-1112.548) -- 0:00:40 Average standard deviation of split frequencies: 0.011532 380500 -- [-1110.827] (-1114.349) (-1112.915) (-1110.789) * [-1110.859] (-1115.436) (-1110.964) (-1111.214) -- 0:00:40 381000 -- [-1111.234] (-1114.053) (-1111.074) (-1110.794) * (-1112.572) (-1114.421) [-1114.349] (-1110.402) -- 0:00:40 381500 -- (-1109.276) [-1111.909] (-1109.806) (-1111.614) * (-1114.376) [-1111.902] (-1117.599) (-1110.014) -- 0:00:40 382000 -- [-1109.434] (-1111.424) (-1114.491) (-1109.456) * (-1115.264) (-1111.609) (-1114.293) [-1110.451] -- 0:00:40 382500 -- (-1114.886) (-1110.211) (-1110.762) [-1109.404] * (-1111.396) (-1115.258) [-1110.929] (-1110.635) -- 0:00:40 383000 -- (-1112.964) (-1110.952) (-1111.339) [-1109.404] * (-1110.436) [-1110.002] (-1112.612) (-1110.248) -- 0:00:40 383500 -- (-1113.450) (-1111.816) [-1109.546] (-1109.579) * (-1110.487) (-1113.019) (-1112.363) [-1111.037] -- 0:00:40 384000 -- [-1111.313] (-1111.813) (-1115.598) (-1109.397) * (-1110.961) (-1114.112) [-1110.508] (-1112.809) -- 0:00:40 384500 -- (-1112.977) [-1111.032] (-1111.406) (-1112.837) * (-1112.518) (-1112.292) [-1110.807] (-1110.354) -- 0:00:40 385000 -- [-1111.464] (-1110.625) (-1115.126) (-1112.466) * (-1113.585) (-1109.905) (-1112.593) [-1111.045] -- 0:00:39 Average standard deviation of split frequencies: 0.011059 385500 -- [-1110.837] (-1109.475) (-1109.644) (-1111.500) * (-1110.496) (-1112.707) [-1110.730] (-1110.043) -- 0:00:39 386000 -- [-1111.175] (-1112.443) (-1113.319) (-1110.699) * (-1113.277) (-1111.509) (-1109.625) [-1110.397] -- 0:00:39 386500 -- (-1111.777) (-1112.388) (-1110.875) [-1112.592] * (-1110.626) (-1114.560) (-1111.423) [-1111.758] -- 0:00:39 387000 -- (-1111.254) (-1111.416) (-1111.035) [-1110.298] * (-1110.914) (-1111.078) (-1113.138) [-1112.244] -- 0:00:39 387500 -- (-1110.305) (-1111.758) (-1109.975) [-1110.180] * (-1111.086) (-1113.564) [-1111.555] (-1112.228) -- 0:00:39 388000 -- [-1114.510] (-1111.967) (-1111.002) (-1110.656) * (-1110.761) [-1115.253] (-1111.555) (-1111.277) -- 0:00:39 388500 -- (-1113.879) (-1110.455) (-1111.822) [-1110.655] * (-1110.549) (-1112.314) [-1111.596] (-1114.967) -- 0:00:39 389000 -- (-1114.760) (-1111.742) [-1111.861] (-1109.811) * [-1110.593] (-1111.486) (-1112.272) (-1111.721) -- 0:00:40 389500 -- (-1112.415) (-1110.860) [-1111.697] (-1113.421) * [-1111.059] (-1111.552) (-1110.169) (-1112.108) -- 0:00:40 390000 -- [-1110.553] (-1111.543) (-1110.224) (-1115.386) * (-1115.006) (-1111.657) [-1112.432] (-1111.383) -- 0:00:40 Average standard deviation of split frequencies: 0.010647 390500 -- [-1110.837] (-1110.027) (-1111.714) (-1112.519) * (-1111.731) (-1111.138) (-1109.580) [-1110.068] -- 0:00:40 391000 -- (-1112.458) [-1114.610] (-1109.766) (-1113.691) * [-1112.437] (-1111.266) (-1109.802) (-1109.736) -- 0:00:40 391500 -- [-1112.295] (-1110.584) (-1120.441) (-1111.117) * (-1112.758) (-1113.892) (-1112.713) [-1110.825] -- 0:00:40 392000 -- [-1113.688] (-1110.747) (-1113.490) (-1113.441) * [-1112.833] (-1110.595) (-1119.757) (-1111.413) -- 0:00:40 392500 -- (-1112.491) [-1112.569] (-1114.775) (-1110.849) * (-1110.678) (-1112.940) [-1112.350] (-1112.761) -- 0:00:40 393000 -- [-1112.633] (-1110.770) (-1111.248) (-1110.479) * [-1110.573] (-1110.856) (-1110.924) (-1113.949) -- 0:00:40 393500 -- [-1111.336] (-1113.593) (-1117.610) (-1116.294) * (-1113.352) (-1112.578) (-1113.375) [-1115.267] -- 0:00:40 394000 -- [-1110.131] (-1112.321) (-1111.588) (-1113.090) * [-1113.301] (-1113.678) (-1110.034) (-1110.508) -- 0:00:39 394500 -- [-1110.568] (-1111.593) (-1110.925) (-1111.140) * (-1114.204) (-1113.634) (-1112.160) [-1110.187] -- 0:00:39 395000 -- (-1114.324) (-1113.992) [-1111.847] (-1109.747) * (-1112.563) (-1109.910) [-1115.348] (-1111.093) -- 0:00:39 Average standard deviation of split frequencies: 0.010644 395500 -- (-1109.678) [-1113.821] (-1114.050) (-1110.321) * (-1110.044) (-1110.549) (-1116.176) [-1112.640] -- 0:00:39 396000 -- (-1115.608) (-1111.564) (-1112.161) [-1111.839] * [-1110.062] (-1111.320) (-1114.814) (-1114.410) -- 0:00:39 396500 -- (-1111.874) (-1114.057) [-1110.518] (-1112.600) * (-1110.191) (-1110.581) [-1112.219] (-1111.820) -- 0:00:39 397000 -- (-1112.069) (-1111.218) [-1110.281] (-1114.398) * (-1110.111) (-1114.610) [-1109.789] (-1115.365) -- 0:00:39 397500 -- (-1116.165) (-1112.417) [-1109.697] (-1112.005) * (-1111.503) (-1112.331) (-1111.172) [-1110.657] -- 0:00:39 398000 -- (-1112.857) (-1111.937) (-1111.389) [-1110.082] * (-1110.796) [-1112.780] (-1110.665) (-1110.505) -- 0:00:39 398500 -- [-1110.291] (-1111.872) (-1114.480) (-1109.881) * (-1112.357) (-1111.707) [-1114.647] (-1112.506) -- 0:00:39 399000 -- (-1114.277) (-1112.414) [-1111.832] (-1112.514) * (-1110.165) (-1111.265) (-1111.365) [-1113.267] -- 0:00:39 399500 -- (-1115.620) (-1111.095) (-1111.697) [-1113.984] * (-1111.934) [-1114.657] (-1111.516) (-1112.294) -- 0:00:39 400000 -- (-1110.720) (-1115.906) (-1118.053) [-1109.819] * [-1109.580] (-1112.256) (-1110.775) (-1110.103) -- 0:00:39 Average standard deviation of split frequencies: 0.011308 400500 -- (-1111.053) (-1115.284) (-1111.772) [-1110.158] * [-1110.064] (-1112.122) (-1111.919) (-1114.256) -- 0:00:38 401000 -- [-1110.076] (-1109.889) (-1111.459) (-1111.267) * [-1112.345] (-1117.137) (-1110.883) (-1110.621) -- 0:00:38 401500 -- [-1111.048] (-1112.638) (-1109.706) (-1110.558) * [-1115.456] (-1118.650) (-1112.479) (-1115.061) -- 0:00:38 402000 -- (-1109.921) (-1111.647) (-1110.967) [-1110.531] * (-1113.160) (-1114.409) [-1110.485] (-1110.687) -- 0:00:38 402500 -- [-1111.511] (-1112.108) (-1114.833) (-1110.926) * (-1113.312) (-1110.399) [-1112.096] (-1111.228) -- 0:00:38 403000 -- (-1110.062) (-1111.825) [-1116.002] (-1109.813) * (-1114.700) (-1112.821) (-1112.412) [-1113.967] -- 0:00:38 403500 -- [-1109.897] (-1110.727) (-1111.800) (-1110.268) * [-1112.086] (-1113.067) (-1111.414) (-1111.124) -- 0:00:38 404000 -- [-1112.341] (-1111.590) (-1112.474) (-1114.499) * (-1112.976) [-1111.988] (-1110.437) (-1114.693) -- 0:00:38 404500 -- (-1117.936) (-1112.459) [-1111.905] (-1115.928) * (-1110.971) (-1110.613) [-1111.248] (-1112.203) -- 0:00:39 405000 -- (-1110.259) (-1119.881) [-1111.653] (-1117.611) * (-1111.555) (-1114.274) (-1110.933) [-1111.340] -- 0:00:39 Average standard deviation of split frequencies: 0.010385 405500 -- [-1114.290] (-1110.267) (-1111.052) (-1113.840) * (-1111.631) [-1111.471] (-1109.840) (-1111.736) -- 0:00:39 406000 -- (-1111.934) (-1114.218) [-1110.507] (-1114.350) * (-1113.284) (-1110.818) (-1109.795) [-1109.958] -- 0:00:39 406500 -- (-1111.333) (-1112.696) [-1112.627] (-1109.841) * (-1115.987) (-1110.616) (-1113.366) [-1110.577] -- 0:00:39 407000 -- (-1112.609) (-1117.093) [-1110.594] (-1113.662) * (-1113.416) [-1110.582] (-1111.356) (-1110.160) -- 0:00:39 407500 -- (-1113.919) (-1112.218) (-1109.630) [-1109.682] * [-1113.218] (-1111.031) (-1114.863) (-1110.160) -- 0:00:39 408000 -- (-1111.024) (-1111.815) (-1113.316) [-1110.779] * (-1112.458) (-1110.382) (-1114.908) [-1109.917] -- 0:00:39 408500 -- (-1114.055) [-1111.794] (-1114.863) (-1111.046) * (-1110.318) (-1110.054) (-1115.796) [-1110.291] -- 0:00:39 409000 -- [-1113.818] (-1113.323) (-1110.734) (-1114.480) * (-1113.135) (-1113.899) (-1110.322) [-1110.323] -- 0:00:39 409500 -- (-1116.749) [-1117.045] (-1112.050) (-1110.523) * (-1111.612) [-1110.354] (-1110.762) (-1110.065) -- 0:00:38 410000 -- (-1110.991) [-1113.763] (-1111.168) (-1111.318) * (-1112.833) [-1110.544] (-1110.702) (-1112.495) -- 0:00:38 Average standard deviation of split frequencies: 0.009757 410500 -- (-1110.914) (-1114.514) [-1111.996] (-1111.786) * (-1114.611) (-1110.549) (-1110.116) [-1111.256] -- 0:00:38 411000 -- (-1111.995) [-1109.768] (-1110.822) (-1110.532) * (-1113.632) (-1111.731) (-1110.621) [-1111.074] -- 0:00:38 411500 -- (-1112.923) (-1112.494) (-1110.391) [-1112.347] * [-1110.481] (-1110.696) (-1112.046) (-1111.093) -- 0:00:38 412000 -- (-1111.952) [-1110.507] (-1111.723) (-1109.900) * (-1111.969) [-1111.089] (-1115.060) (-1113.277) -- 0:00:38 412500 -- (-1113.425) (-1110.700) (-1110.396) [-1111.864] * (-1114.961) [-1111.376] (-1110.303) (-1112.552) -- 0:00:38 413000 -- (-1114.306) (-1110.888) [-1109.886] (-1114.163) * (-1115.266) (-1110.722) [-1110.336] (-1112.306) -- 0:00:38 413500 -- (-1112.322) (-1115.897) [-1110.209] (-1112.587) * (-1110.573) (-1110.314) (-1116.250) [-1112.782] -- 0:00:38 414000 -- (-1112.198) (-1112.402) [-1110.009] (-1111.431) * (-1111.184) (-1110.242) [-1115.553] (-1110.769) -- 0:00:38 414500 -- (-1113.032) (-1111.220) (-1112.197) [-1112.638] * [-1113.574] (-1112.035) (-1121.392) (-1111.851) -- 0:00:38 415000 -- (-1114.878) (-1115.427) (-1109.816) [-1114.158] * (-1111.227) [-1111.078] (-1113.574) (-1111.743) -- 0:00:38 Average standard deviation of split frequencies: 0.010199 415500 -- (-1113.586) (-1113.671) (-1118.078) [-1109.818] * (-1112.221) (-1111.058) (-1110.270) [-1111.069] -- 0:00:37 416000 -- (-1114.318) (-1114.662) [-1118.835] (-1109.827) * (-1111.068) [-1110.973] (-1111.850) (-1111.521) -- 0:00:37 416500 -- (-1111.146) (-1110.581) [-1114.049] (-1112.751) * (-1113.280) (-1112.452) (-1110.073) [-1110.431] -- 0:00:37 417000 -- [-1110.394] (-1113.660) (-1112.032) (-1111.104) * (-1111.991) (-1111.828) [-1110.992] (-1111.963) -- 0:00:37 417500 -- (-1110.941) [-1114.387] (-1112.725) (-1112.712) * (-1110.607) (-1111.685) [-1112.606] (-1111.607) -- 0:00:37 418000 -- (-1111.868) (-1113.785) [-1112.289] (-1114.058) * [-1110.479] (-1111.370) (-1114.291) (-1111.348) -- 0:00:37 418500 -- (-1119.538) (-1112.072) (-1112.755) [-1110.533] * (-1110.242) (-1110.385) [-1113.408] (-1111.558) -- 0:00:37 419000 -- (-1114.292) [-1111.264] (-1112.995) (-1110.800) * [-1110.672] (-1110.064) (-1111.872) (-1109.971) -- 0:00:37 419500 -- (-1115.868) (-1112.596) [-1116.110] (-1114.436) * [-1112.149] (-1110.330) (-1111.455) (-1111.283) -- 0:00:38 420000 -- (-1112.557) (-1112.790) (-1110.769) [-1115.836] * (-1109.885) (-1112.296) [-1110.209] (-1111.672) -- 0:00:38 Average standard deviation of split frequencies: 0.011404 420500 -- (-1111.318) [-1110.801] (-1111.612) (-1115.101) * (-1110.788) (-1110.273) [-1110.738] (-1111.719) -- 0:00:38 421000 -- [-1110.808] (-1110.315) (-1112.094) (-1114.153) * (-1109.750) (-1111.388) [-1110.534] (-1113.082) -- 0:00:38 421500 -- (-1110.818) (-1111.537) (-1112.215) [-1111.182] * [-1109.887] (-1114.448) (-1110.444) (-1110.250) -- 0:00:38 422000 -- [-1110.844] (-1113.304) (-1112.961) (-1111.371) * (-1111.955) (-1112.881) (-1110.222) [-1110.663] -- 0:00:38 422500 -- (-1110.317) [-1110.855] (-1112.987) (-1113.157) * (-1110.649) (-1112.413) [-1112.794] (-1112.087) -- 0:00:38 423000 -- (-1112.435) (-1111.234) [-1112.200] (-1112.434) * (-1112.501) (-1114.981) [-1111.401] (-1116.891) -- 0:00:38 423500 -- (-1112.105) (-1111.876) [-1110.564] (-1110.875) * (-1110.729) (-1115.054) [-1111.738] (-1117.929) -- 0:00:38 424000 -- (-1110.610) [-1110.350] (-1111.582) (-1110.804) * (-1111.914) (-1111.242) (-1109.671) [-1110.364] -- 0:00:38 424500 -- [-1110.180] (-1110.960) (-1110.127) (-1112.726) * (-1110.314) (-1111.353) [-1109.697] (-1110.038) -- 0:00:37 425000 -- (-1110.043) (-1111.720) (-1110.437) [-1110.574] * (-1110.820) (-1111.283) (-1112.228) [-1110.335] -- 0:00:37 Average standard deviation of split frequencies: 0.010881 425500 -- (-1114.598) [-1113.749] (-1112.811) (-1110.759) * [-1113.580] (-1112.199) (-1112.587) (-1113.565) -- 0:00:37 426000 -- (-1109.705) (-1115.893) (-1112.549) [-1113.002] * [-1112.194] (-1112.913) (-1120.114) (-1110.796) -- 0:00:37 426500 -- (-1110.679) (-1113.985) (-1112.730) [-1111.677] * (-1110.434) (-1111.766) (-1113.046) [-1110.400] -- 0:00:37 427000 -- [-1110.196] (-1112.176) (-1114.588) (-1111.786) * (-1111.249) (-1111.533) [-1111.650] (-1112.231) -- 0:00:37 427500 -- (-1110.207) (-1116.848) [-1112.305] (-1112.805) * [-1113.487] (-1110.801) (-1113.833) (-1111.754) -- 0:00:37 428000 -- (-1113.344) [-1110.156] (-1110.728) (-1110.679) * (-1114.235) [-1109.831] (-1112.051) (-1111.296) -- 0:00:37 428500 -- [-1110.894] (-1110.549) (-1111.318) (-1110.833) * [-1111.510] (-1112.078) (-1113.030) (-1110.318) -- 0:00:37 429000 -- [-1110.583] (-1112.502) (-1111.800) (-1112.367) * [-1111.301] (-1113.433) (-1113.544) (-1111.493) -- 0:00:37 429500 -- (-1112.209) (-1111.538) (-1112.111) [-1109.766] * [-1109.766] (-1111.732) (-1113.809) (-1112.789) -- 0:00:37 430000 -- (-1117.141) [-1109.459] (-1112.264) (-1109.978) * (-1109.562) (-1113.679) (-1112.451) [-1111.990] -- 0:00:37 Average standard deviation of split frequencies: 0.010016 430500 -- (-1112.062) (-1110.722) [-1111.476] (-1112.773) * [-1113.665] (-1111.772) (-1111.406) (-1111.612) -- 0:00:37 431000 -- (-1112.019) (-1111.599) (-1109.813) [-1110.499] * (-1114.247) (-1112.107) [-1112.590] (-1114.391) -- 0:00:36 431500 -- (-1110.716) (-1111.784) (-1112.481) [-1113.067] * [-1115.176] (-1113.152) (-1110.911) (-1112.666) -- 0:00:36 432000 -- (-1112.884) (-1111.405) (-1111.669) [-1114.232] * (-1116.628) (-1111.407) [-1113.831] (-1116.689) -- 0:00:36 432500 -- (-1112.729) [-1112.142] (-1110.879) (-1111.698) * [-1112.744] (-1110.835) (-1112.826) (-1112.503) -- 0:00:36 433000 -- (-1112.618) (-1111.268) [-1110.806] (-1114.671) * (-1112.169) [-1112.878] (-1112.160) (-1111.386) -- 0:00:36 433500 -- (-1111.493) (-1112.676) [-1112.693] (-1120.769) * (-1111.987) [-1117.316] (-1111.497) (-1111.735) -- 0:00:36 434000 -- (-1110.277) [-1110.354] (-1111.811) (-1115.967) * (-1111.985) (-1113.608) (-1113.237) [-1112.275] -- 0:00:37 434500 -- (-1111.827) (-1110.725) (-1110.997) [-1113.054] * (-1115.784) (-1111.120) (-1112.235) [-1112.264] -- 0:00:37 435000 -- (-1110.015) (-1115.265) (-1112.068) [-1114.030] * (-1112.309) (-1112.328) [-1115.797] (-1113.593) -- 0:00:37 Average standard deviation of split frequencies: 0.009902 435500 -- [-1113.755] (-1110.449) (-1112.690) (-1111.735) * (-1109.559) [-1115.035] (-1110.532) (-1112.414) -- 0:00:37 436000 -- [-1109.954] (-1111.451) (-1113.118) (-1112.128) * (-1109.623) [-1114.451] (-1109.790) (-1113.173) -- 0:00:37 436500 -- (-1110.375) (-1111.448) [-1109.672] (-1112.442) * (-1109.847) (-1112.279) (-1110.765) [-1109.937] -- 0:00:37 437000 -- [-1111.901] (-1113.387) (-1111.836) (-1114.735) * [-1111.988] (-1112.801) (-1111.138) (-1117.817) -- 0:00:37 437500 -- [-1112.434] (-1114.038) (-1112.790) (-1115.406) * (-1111.823) [-1109.570] (-1110.861) (-1112.659) -- 0:00:37 438000 -- (-1111.286) [-1113.002] (-1111.596) (-1111.920) * [-1112.541] (-1111.865) (-1111.801) (-1113.510) -- 0:00:37 438500 -- (-1111.567) (-1113.686) (-1110.962) [-1111.586] * (-1113.441) [-1113.796] (-1111.599) (-1110.700) -- 0:00:37 439000 -- (-1110.352) [-1109.978] (-1111.108) (-1110.518) * (-1114.232) (-1112.554) (-1111.274) [-1109.898] -- 0:00:37 439500 -- [-1111.591] (-1112.129) (-1110.704) (-1110.484) * [-1115.131] (-1111.684) (-1115.203) (-1114.795) -- 0:00:36 440000 -- (-1111.884) (-1112.698) [-1109.581] (-1110.591) * (-1111.694) [-1111.598] (-1111.978) (-1120.166) -- 0:00:36 Average standard deviation of split frequencies: 0.009687 440500 -- (-1112.133) [-1110.854] (-1110.371) (-1115.176) * (-1112.144) [-1109.798] (-1113.018) (-1116.898) -- 0:00:36 441000 -- [-1111.041] (-1110.551) (-1109.754) (-1111.279) * (-1109.664) (-1111.896) [-1113.719] (-1117.893) -- 0:00:36 441500 -- (-1110.592) (-1113.517) [-1113.080] (-1110.052) * (-1112.162) (-1114.999) (-1110.502) [-1110.941] -- 0:00:36 442000 -- [-1112.508] (-1115.380) (-1114.835) (-1110.603) * (-1111.632) (-1115.189) (-1113.896) [-1110.364] -- 0:00:36 442500 -- (-1109.736) (-1111.870) [-1111.678] (-1113.405) * (-1109.870) [-1112.620] (-1114.630) (-1114.159) -- 0:00:36 443000 -- [-1109.944] (-1111.124) (-1110.099) (-1116.342) * (-1110.716) (-1112.106) [-1113.386] (-1114.522) -- 0:00:36 443500 -- [-1110.122] (-1111.479) (-1111.981) (-1110.026) * (-1110.514) (-1115.709) [-1111.856] (-1112.457) -- 0:00:36 444000 -- (-1109.742) (-1110.312) (-1112.242) [-1109.804] * [-1110.829] (-1110.437) (-1111.455) (-1116.667) -- 0:00:36 444500 -- (-1113.763) [-1109.601] (-1117.500) (-1111.869) * (-1111.532) (-1110.308) (-1111.650) [-1119.580] -- 0:00:36 445000 -- (-1113.965) (-1113.480) (-1110.835) [-1112.292] * (-1115.975) [-1112.934] (-1111.282) (-1121.343) -- 0:00:36 Average standard deviation of split frequencies: 0.009830 445500 -- (-1117.000) [-1113.806] (-1114.777) (-1121.677) * (-1119.055) [-1113.784] (-1111.301) (-1114.922) -- 0:00:36 446000 -- [-1111.236] (-1112.617) (-1113.098) (-1118.838) * (-1114.722) [-1111.883] (-1110.712) (-1112.241) -- 0:00:36 446500 -- (-1109.924) (-1113.813) (-1112.968) [-1111.828] * [-1109.835] (-1110.648) (-1110.306) (-1113.206) -- 0:00:35 447000 -- (-1111.490) [-1112.669] (-1111.481) (-1112.944) * [-1113.274] (-1110.037) (-1110.672) (-1110.332) -- 0:00:35 447500 -- [-1111.718] (-1114.216) (-1113.642) (-1112.037) * [-1111.335] (-1112.235) (-1111.583) (-1110.569) -- 0:00:35 448000 -- (-1112.119) (-1110.276) [-1110.592] (-1115.190) * [-1112.758] (-1113.385) (-1112.711) (-1114.647) -- 0:00:35 448500 -- (-1113.296) (-1110.423) [-1110.032] (-1116.574) * (-1110.508) (-1113.735) (-1110.553) [-1111.838] -- 0:00:35 449000 -- (-1111.640) (-1113.661) (-1111.229) [-1112.200] * [-1109.758] (-1111.459) (-1110.383) (-1111.099) -- 0:00:35 449500 -- (-1111.899) (-1112.790) [-1112.013] (-1112.037) * (-1112.487) [-1116.436] (-1111.471) (-1111.773) -- 0:00:36 450000 -- (-1112.906) (-1115.326) (-1112.205) [-1113.218] * (-1110.385) [-1110.646] (-1114.001) (-1112.177) -- 0:00:36 Average standard deviation of split frequencies: 0.009780 450500 -- [-1114.487] (-1110.340) (-1113.876) (-1110.913) * [-1110.194] (-1111.326) (-1113.498) (-1112.736) -- 0:00:36 451000 -- (-1113.871) (-1110.328) (-1112.901) [-1111.845] * (-1109.865) [-1110.323] (-1113.811) (-1110.155) -- 0:00:36 451500 -- (-1112.300) (-1115.487) (-1109.925) [-1111.242] * [-1110.151] (-1110.823) (-1110.501) (-1111.676) -- 0:00:36 452000 -- (-1112.823) (-1112.132) (-1110.110) [-1110.049] * (-1113.516) [-1111.217] (-1110.204) (-1110.163) -- 0:00:36 452500 -- (-1113.282) [-1110.906] (-1110.633) (-1110.323) * (-1110.503) (-1111.437) [-1109.840] (-1112.260) -- 0:00:36 453000 -- (-1112.110) (-1112.320) [-1110.010] (-1111.074) * (-1113.741) (-1112.414) [-1112.012] (-1113.277) -- 0:00:36 453500 -- (-1112.398) (-1112.940) (-1112.295) [-1110.184] * (-1110.163) (-1110.262) [-1111.319] (-1110.788) -- 0:00:36 454000 -- [-1113.647] (-1114.390) (-1111.974) (-1112.263) * (-1110.712) [-1113.796] (-1112.152) (-1110.696) -- 0:00:36 454500 -- (-1113.374) (-1110.758) [-1111.865] (-1113.529) * (-1112.759) (-1110.673) [-1110.290] (-1112.329) -- 0:00:36 455000 -- (-1111.128) (-1110.489) [-1111.971] (-1113.003) * (-1111.644) (-1110.458) (-1111.256) [-1110.885] -- 0:00:35 Average standard deviation of split frequencies: 0.009769 455500 -- [-1111.390] (-1111.258) (-1115.178) (-1110.125) * [-1114.283] (-1110.439) (-1109.588) (-1112.719) -- 0:00:35 456000 -- (-1110.697) (-1110.859) (-1112.608) [-1111.044] * (-1120.051) [-1110.859] (-1109.947) (-1111.027) -- 0:00:35 456500 -- (-1115.208) (-1113.243) [-1110.149] (-1111.176) * (-1110.119) [-1111.736] (-1109.940) (-1113.353) -- 0:00:35 457000 -- (-1113.835) (-1112.285) [-1110.602] (-1114.929) * (-1111.395) [-1110.425] (-1110.773) (-1113.827) -- 0:00:35 457500 -- (-1112.171) (-1112.493) [-1111.655] (-1112.426) * (-1111.437) (-1110.990) (-1109.937) [-1111.433] -- 0:00:35 458000 -- [-1110.253] (-1112.466) (-1111.224) (-1111.076) * (-1111.213) (-1113.173) [-1110.617] (-1111.243) -- 0:00:35 458500 -- (-1110.253) [-1111.373] (-1116.318) (-1110.397) * (-1114.503) [-1118.499] (-1111.128) (-1116.226) -- 0:00:35 459000 -- (-1110.574) (-1111.770) [-1113.110] (-1110.199) * (-1111.367) [-1114.577] (-1112.518) (-1117.606) -- 0:00:35 459500 -- (-1110.639) (-1114.630) (-1110.589) [-1111.627] * (-1113.691) (-1116.356) [-1111.324] (-1115.114) -- 0:00:35 460000 -- [-1110.240] (-1110.189) (-1111.278) (-1110.469) * (-1111.164) (-1111.769) [-1112.049] (-1111.122) -- 0:00:35 Average standard deviation of split frequencies: 0.010233 460500 -- [-1110.240] (-1115.051) (-1112.313) (-1112.162) * [-1110.483] (-1115.721) (-1111.101) (-1110.898) -- 0:00:35 461000 -- (-1110.104) (-1111.663) (-1112.594) [-1113.971] * (-1110.728) (-1114.755) [-1111.076] (-1112.759) -- 0:00:35 461500 -- (-1112.011) (-1110.520) (-1111.252) [-1112.266] * (-1113.084) (-1115.334) [-1114.689] (-1113.429) -- 0:00:35 462000 -- (-1111.774) (-1115.110) (-1113.772) [-1111.900] * [-1112.282] (-1112.217) (-1111.777) (-1111.882) -- 0:00:34 462500 -- [-1111.577] (-1109.697) (-1113.095) (-1111.522) * (-1111.316) (-1114.708) (-1115.358) [-1110.589] -- 0:00:34 463000 -- (-1111.906) [-1111.503] (-1112.655) (-1111.237) * [-1112.908] (-1114.570) (-1113.724) (-1110.055) -- 0:00:34 463500 -- [-1113.724] (-1111.019) (-1116.871) (-1112.968) * (-1110.800) (-1110.063) [-1111.822] (-1111.331) -- 0:00:34 464000 -- [-1112.472] (-1113.262) (-1111.897) (-1111.840) * [-1111.138] (-1115.646) (-1109.865) (-1110.553) -- 0:00:34 464500 -- (-1114.517) [-1109.469] (-1110.741) (-1112.284) * (-1112.191) (-1113.010) (-1111.640) [-1111.024] -- 0:00:34 465000 -- (-1110.713) [-1109.469] (-1109.937) (-1110.409) * (-1116.487) (-1110.626) (-1113.566) [-1113.376] -- 0:00:35 Average standard deviation of split frequencies: 0.010009 465500 -- (-1110.667) (-1110.026) [-1109.722] (-1113.243) * [-1114.753] (-1110.605) (-1110.087) (-1111.791) -- 0:00:35 466000 -- (-1110.902) [-1111.945] (-1110.511) (-1111.765) * (-1119.457) (-1111.971) [-1110.534] (-1111.953) -- 0:00:35 466500 -- [-1110.468] (-1112.897) (-1111.340) (-1112.717) * (-1115.365) (-1110.954) (-1114.101) [-1115.760] -- 0:00:35 467000 -- (-1110.452) (-1113.045) [-1112.589] (-1114.720) * (-1117.433) (-1113.426) [-1114.704] (-1110.102) -- 0:00:35 467500 -- (-1112.732) (-1109.563) [-1110.157] (-1112.471) * (-1112.525) (-1110.980) [-1111.375] (-1110.171) -- 0:00:35 468000 -- (-1110.753) [-1109.563] (-1109.941) (-1113.287) * [-1110.690] (-1111.775) (-1112.620) (-1111.788) -- 0:00:35 468500 -- [-1113.705] (-1110.763) (-1110.994) (-1113.029) * (-1114.191) (-1111.450) [-1110.602] (-1113.958) -- 0:00:35 469000 -- (-1110.932) (-1110.971) [-1112.407] (-1116.117) * [-1112.491] (-1110.645) (-1111.251) (-1110.119) -- 0:00:35 469500 -- [-1111.279] (-1111.107) (-1111.827) (-1111.048) * [-1112.138] (-1111.881) (-1112.670) (-1109.922) -- 0:00:35 470000 -- (-1112.252) (-1111.252) [-1112.097] (-1112.451) * (-1111.047) (-1111.605) (-1113.309) [-1109.843] -- 0:00:34 Average standard deviation of split frequencies: 0.010068 470500 -- (-1111.388) (-1110.787) (-1113.058) [-1114.284] * [-1112.419] (-1110.639) (-1113.230) (-1109.826) -- 0:00:34 471000 -- (-1113.099) [-1109.964] (-1111.089) (-1119.349) * [-1112.569] (-1110.877) (-1110.003) (-1112.570) -- 0:00:34 471500 -- [-1113.164] (-1110.197) (-1111.227) (-1110.075) * (-1111.847) (-1111.373) (-1110.087) [-1111.782] -- 0:00:34 472000 -- (-1114.242) (-1113.607) (-1111.814) [-1109.813] * (-1110.876) (-1111.546) (-1110.377) [-1112.786] -- 0:00:34 472500 -- [-1110.855] (-1109.742) (-1117.078) (-1109.552) * (-1111.413) (-1110.984) (-1113.898) [-1113.930] -- 0:00:34 473000 -- (-1114.916) (-1114.348) [-1113.356] (-1110.004) * (-1109.882) (-1111.897) (-1112.018) [-1113.077] -- 0:00:34 473500 -- (-1113.680) [-1111.867] (-1111.542) (-1113.722) * (-1109.891) (-1112.541) (-1112.920) [-1112.133] -- 0:00:34 474000 -- [-1110.167] (-1110.676) (-1111.525) (-1118.694) * [-1110.303] (-1110.901) (-1110.477) (-1111.226) -- 0:00:34 474500 -- (-1112.671) [-1114.014] (-1111.132) (-1111.994) * [-1110.533] (-1110.399) (-1112.339) (-1111.465) -- 0:00:34 475000 -- [-1112.968] (-1112.523) (-1109.847) (-1111.600) * (-1110.212) (-1110.417) [-1115.005] (-1115.548) -- 0:00:34 Average standard deviation of split frequencies: 0.010216 475500 -- (-1111.271) (-1112.900) (-1109.919) [-1110.835] * (-1110.467) (-1111.055) [-1109.535] (-1111.773) -- 0:00:34 476000 -- (-1111.364) [-1112.870] (-1110.515) (-1113.986) * (-1110.857) (-1112.776) [-1111.554] (-1115.678) -- 0:00:34 476500 -- (-1112.374) (-1110.575) [-1110.425] (-1115.440) * (-1109.996) (-1111.825) [-1111.222] (-1111.860) -- 0:00:34 477000 -- [-1110.994] (-1114.723) (-1110.597) (-1111.566) * [-1110.142] (-1110.349) (-1113.688) (-1111.776) -- 0:00:33 477500 -- (-1110.933) [-1110.625] (-1110.139) (-1112.325) * (-1110.060) (-1110.812) [-1113.316] (-1112.587) -- 0:00:33 478000 -- [-1110.460] (-1112.029) (-1110.915) (-1115.959) * (-1110.134) (-1111.460) (-1112.489) [-1111.673] -- 0:00:33 478500 -- (-1112.757) (-1111.839) (-1115.222) [-1111.577] * (-1113.048) (-1111.950) (-1111.065) [-1111.147] -- 0:00:33 479000 -- (-1109.652) [-1109.870] (-1112.452) (-1114.047) * (-1113.453) [-1110.145] (-1110.579) (-1115.582) -- 0:00:33 479500 -- [-1109.406] (-1110.571) (-1111.561) (-1111.182) * (-1112.565) (-1111.579) [-1112.992] (-1111.571) -- 0:00:33 480000 -- [-1109.341] (-1113.909) (-1113.730) (-1111.332) * (-1113.497) (-1112.294) (-1110.443) [-1110.765] -- 0:00:33 Average standard deviation of split frequencies: 0.010080 480500 -- [-1110.535] (-1114.271) (-1115.430) (-1111.273) * (-1113.327) [-1113.607] (-1114.859) (-1111.713) -- 0:00:33 481000 -- (-1111.658) (-1114.197) [-1112.171] (-1111.441) * [-1111.853] (-1113.199) (-1111.638) (-1115.785) -- 0:00:34 481500 -- (-1110.897) (-1111.670) (-1114.023) [-1113.978] * (-1111.393) (-1111.128) (-1113.396) [-1115.007] -- 0:00:34 482000 -- (-1110.248) (-1110.539) (-1110.497) [-1110.751] * [-1109.874] (-1113.535) (-1111.240) (-1110.765) -- 0:00:34 482500 -- [-1111.109] (-1112.799) (-1110.368) (-1113.400) * (-1112.734) [-1113.180] (-1113.401) (-1110.764) -- 0:00:34 483000 -- (-1113.457) (-1109.613) [-1109.639] (-1113.309) * (-1111.937) (-1114.902) [-1110.442] (-1117.036) -- 0:00:34 483500 -- (-1110.939) (-1110.892) (-1110.971) [-1110.538] * [-1111.530] (-1115.077) (-1111.664) (-1114.901) -- 0:00:34 484000 -- [-1114.060] (-1112.178) (-1113.796) (-1111.113) * (-1112.953) (-1111.996) (-1117.787) [-1112.193] -- 0:00:34 484500 -- (-1114.074) [-1112.028] (-1111.760) (-1110.354) * (-1111.763) (-1113.381) [-1109.928] (-1110.751) -- 0:00:34 485000 -- [-1113.594] (-1111.601) (-1110.998) (-1111.858) * (-1114.947) [-1112.542] (-1115.131) (-1110.388) -- 0:00:33 Average standard deviation of split frequencies: 0.010108 485500 -- [-1111.944] (-1111.352) (-1110.580) (-1115.445) * (-1118.227) (-1112.690) (-1114.401) [-1111.571] -- 0:00:33 486000 -- (-1112.984) (-1110.620) (-1112.109) [-1115.796] * (-1113.161) (-1113.909) [-1113.253] (-1111.325) -- 0:00:33 486500 -- (-1110.988) (-1112.323) [-1110.531] (-1114.669) * [-1110.097] (-1111.352) (-1109.872) (-1111.595) -- 0:00:33 487000 -- [-1109.657] (-1110.695) (-1110.818) (-1113.826) * (-1110.284) (-1118.164) [-1109.655] (-1111.263) -- 0:00:33 487500 -- [-1111.152] (-1111.168) (-1110.465) (-1112.018) * [-1112.426] (-1109.814) (-1111.311) (-1111.303) -- 0:00:33 488000 -- (-1112.646) (-1111.864) (-1110.525) [-1113.295] * (-1113.325) (-1113.182) [-1110.370] (-1111.326) -- 0:00:33 488500 -- [-1110.677] (-1110.696) (-1109.915) (-1111.273) * [-1114.371] (-1116.886) (-1110.044) (-1111.541) -- 0:00:33 489000 -- [-1115.636] (-1112.020) (-1110.189) (-1113.320) * (-1109.322) (-1112.748) (-1110.525) [-1110.346] -- 0:00:33 489500 -- (-1111.511) (-1113.383) [-1111.624] (-1113.513) * [-1110.470] (-1112.634) (-1110.811) (-1110.141) -- 0:00:33 490000 -- (-1110.760) (-1111.056) [-1110.329] (-1115.858) * [-1111.112] (-1113.686) (-1114.043) (-1110.616) -- 0:00:33 Average standard deviation of split frequencies: 0.009928 490500 -- (-1112.293) (-1112.650) [-1116.706] (-1110.650) * [-1111.282] (-1117.959) (-1114.226) (-1113.188) -- 0:00:33 491000 -- (-1115.386) (-1112.424) [-1114.856] (-1110.221) * (-1111.609) [-1110.605] (-1111.425) (-1113.884) -- 0:00:33 491500 -- [-1110.951] (-1112.425) (-1114.509) (-1110.545) * (-1113.157) [-1110.039] (-1115.108) (-1110.500) -- 0:00:33 492000 -- (-1113.791) (-1115.083) [-1110.036] (-1113.035) * [-1111.305] (-1111.250) (-1110.017) (-1111.266) -- 0:00:33 492500 -- (-1111.461) [-1113.434] (-1110.482) (-1110.385) * (-1110.064) (-1112.099) (-1113.107) [-1110.954] -- 0:00:32 493000 -- [-1110.590] (-1111.583) (-1109.843) (-1109.973) * (-1112.279) (-1111.790) (-1113.196) [-1109.726] -- 0:00:32 493500 -- (-1110.668) [-1110.605] (-1111.564) (-1113.796) * (-1115.266) (-1111.013) (-1110.001) [-1110.815] -- 0:00:32 494000 -- [-1111.180] (-1112.511) (-1110.119) (-1111.265) * [-1114.229] (-1110.719) (-1112.272) (-1112.332) -- 0:00:32 494500 -- (-1114.786) (-1112.405) [-1110.545] (-1112.760) * [-1111.837] (-1113.307) (-1114.195) (-1111.293) -- 0:00:32 495000 -- [-1112.026] (-1111.223) (-1111.071) (-1110.246) * [-1110.735] (-1110.141) (-1110.820) (-1111.198) -- 0:00:32 Average standard deviation of split frequencies: 0.009240 495500 -- (-1111.439) (-1114.078) [-1112.051] (-1111.576) * (-1111.910) [-1110.141] (-1111.626) (-1111.364) -- 0:00:32 496000 -- (-1111.507) (-1112.621) (-1118.528) [-1110.183] * (-1112.902) [-1109.666] (-1111.766) (-1114.643) -- 0:00:32 496500 -- (-1109.533) (-1111.891) [-1110.341] (-1112.237) * [-1110.421] (-1110.039) (-1112.248) (-1110.462) -- 0:00:32 497000 -- (-1112.880) [-1111.471] (-1111.453) (-1112.042) * [-1110.589] (-1109.517) (-1110.479) (-1113.160) -- 0:00:33 497500 -- (-1111.924) (-1112.272) (-1109.336) [-1111.820] * [-1110.403] (-1109.517) (-1113.007) (-1112.324) -- 0:00:33 498000 -- (-1109.413) (-1112.688) (-1111.417) [-1110.072] * (-1110.095) (-1111.786) (-1112.501) [-1110.823] -- 0:00:33 498500 -- [-1109.453] (-1113.411) (-1113.358) (-1109.787) * (-1110.877) (-1114.684) (-1113.927) [-1110.711] -- 0:00:33 499000 -- (-1110.854) [-1112.602] (-1112.975) (-1114.539) * (-1110.104) (-1112.420) (-1112.244) [-1111.035] -- 0:00:33 499500 -- (-1112.741) (-1112.962) (-1117.223) [-1111.192] * (-1111.541) (-1115.759) [-1111.403] (-1112.808) -- 0:00:33 500000 -- (-1111.248) (-1112.077) (-1117.645) [-1113.557] * (-1111.865) (-1112.257) [-1112.027] (-1114.631) -- 0:00:33 Average standard deviation of split frequencies: 0.009154 500500 -- (-1113.061) (-1111.080) (-1113.276) [-1111.390] * (-1113.209) (-1112.171) (-1114.086) [-1112.275] -- 0:00:32 501000 -- (-1111.554) [-1109.679] (-1111.385) (-1110.586) * [-1112.174] (-1114.275) (-1117.147) (-1111.436) -- 0:00:32 501500 -- [-1110.891] (-1110.241) (-1111.560) (-1110.639) * [-1111.437] (-1113.819) (-1116.379) (-1114.012) -- 0:00:32 502000 -- (-1111.704) (-1112.638) (-1110.350) [-1110.413] * (-1113.243) [-1109.986] (-1114.159) (-1114.279) -- 0:00:32 502500 -- [-1110.517] (-1109.725) (-1110.828) (-1110.931) * [-1111.856] (-1113.623) (-1111.087) (-1111.452) -- 0:00:32 503000 -- (-1109.699) (-1111.461) (-1110.563) [-1111.694] * (-1112.335) (-1118.255) (-1117.469) [-1111.159] -- 0:00:32 503500 -- (-1114.013) (-1113.949) [-1109.804] (-1112.452) * (-1112.762) (-1115.067) [-1112.827] (-1112.554) -- 0:00:32 504000 -- (-1113.897) (-1112.280) [-1110.114] (-1111.395) * [-1115.203] (-1112.667) (-1112.178) (-1111.883) -- 0:00:32 504500 -- [-1109.722] (-1113.300) (-1109.696) (-1110.920) * (-1113.965) (-1117.673) (-1113.974) [-1111.685] -- 0:00:32 505000 -- (-1111.877) [-1114.552] (-1110.845) (-1112.602) * (-1113.895) (-1115.042) [-1113.471] (-1111.215) -- 0:00:32 Average standard deviation of split frequencies: 0.009109 505500 -- [-1113.317] (-1113.062) (-1111.552) (-1113.005) * (-1114.398) (-1110.363) [-1111.394] (-1111.340) -- 0:00:32 506000 -- (-1110.890) (-1112.895) (-1110.182) [-1112.161] * (-1116.190) [-1112.292] (-1110.853) (-1110.666) -- 0:00:32 506500 -- [-1111.964] (-1111.021) (-1110.151) (-1110.077) * (-1116.229) [-1112.339] (-1118.897) (-1113.287) -- 0:00:32 507000 -- (-1111.004) [-1112.263] (-1111.102) (-1110.492) * [-1112.663] (-1113.761) (-1111.149) (-1113.072) -- 0:00:32 507500 -- (-1113.262) (-1111.370) (-1114.131) [-1111.791] * (-1112.575) (-1113.895) (-1112.369) [-1112.628] -- 0:00:32 508000 -- (-1118.341) (-1112.934) [-1112.243] (-1110.829) * (-1112.344) [-1110.873] (-1112.333) (-1113.188) -- 0:00:31 508500 -- (-1110.858) (-1113.161) [-1112.484] (-1111.624) * (-1113.105) [-1111.562] (-1118.007) (-1111.876) -- 0:00:31 509000 -- (-1111.032) [-1113.674] (-1110.889) (-1110.986) * [-1112.028] (-1113.185) (-1112.486) (-1114.559) -- 0:00:31 509500 -- [-1110.926] (-1110.536) (-1114.158) (-1114.454) * [-1112.601] (-1110.210) (-1112.783) (-1111.125) -- 0:00:31 510000 -- [-1112.200] (-1109.991) (-1112.104) (-1112.976) * (-1111.012) (-1110.591) [-1112.864] (-1111.365) -- 0:00:31 Average standard deviation of split frequencies: 0.009231 510500 -- (-1112.402) (-1110.391) [-1110.632] (-1114.778) * (-1111.285) [-1110.382] (-1116.959) (-1111.033) -- 0:00:31 511000 -- [-1110.534] (-1110.302) (-1112.647) (-1112.090) * (-1110.256) (-1109.967) (-1111.672) [-1110.924] -- 0:00:31 511500 -- [-1112.999] (-1112.348) (-1112.957) (-1110.931) * (-1110.031) (-1111.591) [-1114.298] (-1110.228) -- 0:00:32 512000 -- (-1113.091) (-1112.599) [-1113.156] (-1117.961) * (-1110.621) (-1110.893) [-1116.256] (-1114.001) -- 0:00:32 512500 -- (-1110.492) (-1110.398) (-1112.100) [-1110.667] * (-1111.051) (-1110.153) (-1110.411) [-1113.236] -- 0:00:32 513000 -- (-1110.978) (-1110.861) (-1111.531) [-1110.917] * [-1112.096] (-1111.534) (-1111.130) (-1114.264) -- 0:00:32 513500 -- (-1112.455) (-1110.221) [-1110.354] (-1109.526) * (-1113.316) (-1110.607) [-1110.240] (-1110.793) -- 0:00:32 514000 -- (-1111.688) (-1117.132) [-1110.423] (-1109.663) * (-1117.090) (-1110.983) (-1113.484) [-1110.311] -- 0:00:32 514500 -- [-1109.462] (-1119.028) (-1111.104) (-1112.043) * (-1114.431) (-1114.552) [-1113.076] (-1112.737) -- 0:00:32 515000 -- (-1111.727) (-1112.418) (-1110.363) [-1110.368] * (-1112.432) [-1112.658] (-1112.353) (-1114.114) -- 0:00:32 Average standard deviation of split frequencies: 0.009187 515500 -- (-1115.174) [-1111.626] (-1112.307) (-1109.861) * (-1114.133) (-1112.636) [-1113.093] (-1114.341) -- 0:00:31 516000 -- [-1113.140] (-1110.833) (-1111.900) (-1110.473) * (-1110.469) (-1111.558) [-1114.190] (-1112.256) -- 0:00:31 516500 -- (-1111.923) [-1111.515] (-1114.195) (-1110.590) * [-1114.100] (-1113.774) (-1111.064) (-1115.856) -- 0:00:31 517000 -- [-1113.852] (-1111.060) (-1114.101) (-1110.582) * (-1113.442) [-1114.801] (-1114.758) (-1114.745) -- 0:00:31 517500 -- (-1114.098) (-1111.411) (-1112.125) [-1110.739] * (-1113.126) (-1112.001) (-1112.373) [-1110.178] -- 0:00:31 518000 -- [-1112.182] (-1109.840) (-1116.571) (-1114.422) * (-1112.328) (-1112.170) [-1110.065] (-1113.770) -- 0:00:31 518500 -- (-1111.829) (-1110.241) (-1113.585) [-1111.155] * (-1110.808) (-1112.225) (-1113.475) [-1113.117] -- 0:00:31 519000 -- (-1111.530) (-1113.549) (-1111.921) [-1111.457] * [-1116.376] (-1110.859) (-1110.632) (-1111.512) -- 0:00:31 519500 -- (-1110.897) (-1111.588) [-1111.421] (-1111.673) * [-1111.214] (-1110.609) (-1111.730) (-1111.802) -- 0:00:31 520000 -- (-1110.121) [-1111.683] (-1111.443) (-1112.098) * (-1113.305) (-1110.485) [-1114.151] (-1114.288) -- 0:00:31 Average standard deviation of split frequencies: 0.009305 520500 -- (-1111.042) (-1112.397) (-1114.603) [-1111.809] * (-1110.561) (-1113.529) [-1113.881] (-1111.508) -- 0:00:31 521000 -- (-1111.854) [-1111.401] (-1112.515) (-1111.501) * [-1112.762] (-1110.865) (-1112.143) (-1115.160) -- 0:00:31 521500 -- [-1110.416] (-1109.957) (-1113.117) (-1110.387) * [-1112.635] (-1111.835) (-1110.330) (-1110.416) -- 0:00:31 522000 -- (-1110.924) (-1112.189) (-1115.120) [-1110.511] * (-1114.448) [-1114.565] (-1111.151) (-1110.792) -- 0:00:31 522500 -- (-1113.130) (-1111.368) [-1109.785] (-1109.534) * (-1113.503) (-1112.008) (-1111.790) [-1112.464] -- 0:00:31 523000 -- [-1111.568] (-1112.019) (-1110.108) (-1109.805) * (-1110.779) (-1110.941) (-1113.210) [-1112.915] -- 0:00:31 523500 -- (-1110.731) (-1109.977) (-1111.744) [-1110.303] * (-1114.305) (-1110.406) [-1109.851] (-1113.634) -- 0:00:30 524000 -- [-1110.970] (-1111.200) (-1110.952) (-1116.224) * [-1111.517] (-1110.537) (-1115.558) (-1120.693) -- 0:00:30 524500 -- (-1109.930) (-1110.512) (-1110.438) [-1112.104] * [-1114.987] (-1111.960) (-1113.926) (-1110.450) -- 0:00:30 525000 -- (-1111.846) (-1115.021) (-1110.701) [-1118.643] * (-1113.795) (-1112.030) (-1113.070) [-1110.408] -- 0:00:30 Average standard deviation of split frequencies: 0.009908 525500 -- (-1111.845) (-1116.230) [-1110.693] (-1110.884) * [-1110.148] (-1113.136) (-1110.287) (-1110.202) -- 0:00:31 526000 -- [-1110.853] (-1111.814) (-1109.548) (-1111.826) * (-1109.528) (-1111.761) [-1111.254] (-1111.338) -- 0:00:31 526500 -- (-1111.781) [-1111.705] (-1111.935) (-1109.519) * (-1110.459) (-1114.355) [-1110.221] (-1111.917) -- 0:00:31 527000 -- (-1110.905) (-1112.709) [-1111.116] (-1113.079) * (-1113.540) [-1109.658] (-1110.697) (-1111.569) -- 0:00:31 527500 -- (-1111.211) [-1111.769] (-1111.409) (-1112.230) * [-1110.148] (-1110.837) (-1111.734) (-1110.174) -- 0:00:31 528000 -- [-1114.679] (-1114.340) (-1110.282) (-1112.213) * (-1110.934) (-1111.208) (-1110.669) [-1111.389] -- 0:00:31 528500 -- [-1110.523] (-1112.845) (-1111.755) (-1111.938) * (-1112.212) (-1117.755) (-1114.493) [-1110.524] -- 0:00:31 529000 -- [-1112.183] (-1110.134) (-1112.591) (-1117.364) * [-1110.772] (-1113.193) (-1111.050) (-1115.489) -- 0:00:31 529500 -- (-1110.557) (-1111.441) (-1118.512) [-1114.617] * (-1110.683) (-1111.537) [-1109.916] (-1110.500) -- 0:00:31 530000 -- (-1110.820) [-1111.129] (-1110.123) (-1110.690) * (-1111.126) [-1113.195] (-1109.600) (-1110.385) -- 0:00:31 Average standard deviation of split frequencies: 0.010117 530500 -- (-1111.970) (-1110.818) [-1111.359] (-1112.779) * (-1111.271) (-1113.806) (-1110.492) [-1110.815] -- 0:00:30 531000 -- (-1111.002) (-1109.784) [-1111.047] (-1114.612) * [-1111.579] (-1112.048) (-1112.542) (-1111.329) -- 0:00:30 531500 -- (-1114.403) [-1109.621] (-1111.462) (-1115.901) * (-1111.050) [-1110.764] (-1114.113) (-1110.322) -- 0:00:30 532000 -- (-1113.140) (-1110.998) [-1111.554] (-1110.994) * [-1111.050] (-1110.569) (-1112.413) (-1110.168) -- 0:00:30 532500 -- (-1109.373) [-1111.462] (-1114.476) (-1113.314) * [-1111.216] (-1112.195) (-1111.732) (-1110.169) -- 0:00:30 533000 -- (-1109.932) (-1112.012) [-1110.666] (-1113.020) * (-1111.128) [-1111.927] (-1111.539) (-1117.543) -- 0:00:30 533500 -- (-1109.347) (-1115.202) (-1110.868) [-1111.562] * (-1110.438) (-1112.127) (-1110.574) [-1114.950] -- 0:00:30 534000 -- [-1109.932] (-1114.540) (-1111.052) (-1111.928) * [-1110.798] (-1113.209) (-1118.002) (-1111.791) -- 0:00:30 534500 -- (-1109.350) [-1113.666] (-1112.610) (-1111.057) * [-1111.131] (-1110.598) (-1114.025) (-1111.334) -- 0:00:30 535000 -- [-1110.981] (-1110.375) (-1110.394) (-1111.034) * (-1112.161) [-1111.562] (-1111.609) (-1110.453) -- 0:00:30 Average standard deviation of split frequencies: 0.009582 535500 -- (-1111.271) (-1110.349) (-1113.543) [-1110.521] * (-1114.673) [-1111.772] (-1116.389) (-1112.806) -- 0:00:30 536000 -- (-1110.384) [-1110.419] (-1113.271) (-1111.178) * (-1113.241) [-1113.705] (-1115.315) (-1111.382) -- 0:00:30 536500 -- (-1110.991) (-1110.578) [-1112.507] (-1113.681) * (-1115.920) [-1110.585] (-1119.050) (-1111.322) -- 0:00:30 537000 -- (-1110.301) (-1110.740) [-1114.382] (-1117.161) * [-1112.495] (-1111.877) (-1113.373) (-1111.078) -- 0:00:30 537500 -- (-1111.052) [-1111.955] (-1112.589) (-1115.060) * (-1116.474) [-1110.444] (-1111.321) (-1109.710) -- 0:00:30 538000 -- (-1112.026) [-1111.742] (-1112.589) (-1111.973) * (-1111.755) [-1114.828] (-1113.545) (-1111.653) -- 0:00:30 538500 -- [-1112.361] (-1113.519) (-1112.827) (-1109.821) * (-1111.707) [-1110.806] (-1111.447) (-1110.277) -- 0:00:29 539000 -- [-1110.493] (-1110.804) (-1112.561) (-1109.769) * [-1110.293] (-1109.841) (-1114.560) (-1110.784) -- 0:00:29 539500 -- (-1110.979) (-1113.777) (-1109.858) [-1110.709] * (-1109.815) (-1109.976) (-1111.282) [-1111.109] -- 0:00:29 540000 -- (-1110.027) (-1111.105) [-1109.966] (-1110.306) * (-1113.572) (-1111.050) (-1113.551) [-1111.586] -- 0:00:30 Average standard deviation of split frequencies: 0.009930 540500 -- (-1112.807) (-1112.013) [-1110.846] (-1109.645) * (-1110.335) (-1112.239) [-1110.440] (-1112.256) -- 0:00:30 541000 -- (-1112.819) (-1111.081) (-1114.151) [-1110.093] * [-1113.392] (-1112.242) (-1110.766) (-1112.834) -- 0:00:30 541500 -- (-1112.644) (-1110.699) [-1111.664] (-1111.541) * (-1112.507) (-1113.546) [-1114.168] (-1110.894) -- 0:00:30 542000 -- [-1111.478] (-1110.666) (-1112.484) (-1114.285) * (-1111.106) [-1112.203] (-1116.038) (-1113.180) -- 0:00:30 542500 -- (-1111.270) [-1115.385] (-1112.390) (-1112.427) * [-1110.854] (-1112.771) (-1116.772) (-1113.686) -- 0:00:30 543000 -- (-1113.386) [-1112.005] (-1113.912) (-1114.744) * (-1111.259) (-1114.508) [-1115.612] (-1110.436) -- 0:00:30 543500 -- (-1111.376) (-1111.529) (-1112.284) [-1111.148] * (-1114.615) (-1113.100) (-1113.513) [-1110.182] -- 0:00:30 544000 -- (-1110.766) (-1110.784) (-1111.431) [-1111.937] * (-1114.586) (-1111.742) [-1109.423] (-1109.721) -- 0:00:30 544500 -- [-1112.934] (-1114.736) (-1112.136) (-1114.542) * (-1115.380) (-1111.669) (-1110.602) [-1111.835] -- 0:00:30 545000 -- (-1111.962) (-1110.537) [-1114.662] (-1114.359) * [-1115.726] (-1114.292) (-1116.299) (-1110.182) -- 0:00:30 Average standard deviation of split frequencies: 0.009833 545500 -- (-1110.487) [-1111.979] (-1112.396) (-1114.111) * [-1110.195] (-1112.857) (-1113.328) (-1112.875) -- 0:00:29 546000 -- [-1111.911] (-1110.140) (-1111.838) (-1109.811) * (-1115.770) (-1113.672) (-1112.314) [-1110.412] -- 0:00:29 546500 -- (-1111.251) [-1114.288] (-1111.011) (-1112.967) * (-1115.115) (-1112.165) (-1116.084) [-1111.887] -- 0:00:29 547000 -- (-1113.168) [-1112.226] (-1113.290) (-1112.149) * (-1111.491) (-1112.471) (-1112.607) [-1112.381] -- 0:00:29 547500 -- [-1111.716] (-1111.282) (-1114.827) (-1114.070) * [-1112.061] (-1113.673) (-1113.530) (-1110.329) -- 0:00:29 548000 -- (-1111.748) [-1110.633] (-1111.574) (-1113.162) * (-1112.630) [-1113.090] (-1113.831) (-1113.057) -- 0:00:29 548500 -- (-1111.891) (-1112.328) [-1112.831] (-1112.026) * [-1110.873] (-1109.657) (-1111.814) (-1113.863) -- 0:00:29 549000 -- (-1110.786) (-1113.056) (-1113.461) [-1113.201] * (-1110.282) [-1111.411] (-1111.938) (-1117.230) -- 0:00:29 549500 -- [-1110.332] (-1111.993) (-1112.910) (-1112.686) * (-1110.563) (-1111.987) (-1114.593) [-1114.177] -- 0:00:29 550000 -- (-1111.935) (-1109.933) (-1113.582) [-1110.986] * (-1110.802) (-1109.714) [-1111.376] (-1113.033) -- 0:00:29 Average standard deviation of split frequencies: 0.009797 550500 -- (-1112.234) [-1110.898] (-1114.250) (-1113.212) * (-1110.019) [-1110.578] (-1114.543) (-1110.377) -- 0:00:29 551000 -- [-1111.509] (-1109.981) (-1118.476) (-1111.046) * (-1111.510) (-1109.663) [-1111.565] (-1115.858) -- 0:00:29 551500 -- [-1111.161] (-1109.707) (-1110.785) (-1115.627) * (-1113.118) [-1109.539] (-1113.524) (-1111.463) -- 0:00:29 552000 -- (-1113.283) (-1110.651) [-1112.203] (-1110.434) * [-1113.855] (-1110.332) (-1110.970) (-1111.498) -- 0:00:29 552500 -- [-1114.332] (-1111.956) (-1110.578) (-1113.862) * (-1113.657) (-1112.985) (-1112.100) [-1109.731] -- 0:00:29 553000 -- (-1109.838) (-1112.658) (-1114.769) [-1111.832] * (-1110.349) (-1111.221) (-1111.343) [-1110.498] -- 0:00:29 553500 -- [-1109.949] (-1113.509) (-1113.305) (-1113.502) * (-1110.973) (-1110.367) (-1111.563) [-1110.263] -- 0:00:29 554000 -- (-1110.384) (-1111.375) (-1120.210) [-1111.649] * (-1114.338) [-1110.019] (-1111.278) (-1118.116) -- 0:00:28 554500 -- (-1110.260) (-1112.467) (-1111.644) [-1109.743] * (-1117.578) (-1110.367) (-1110.731) [-1113.514] -- 0:00:29 555000 -- (-1109.673) [-1110.874] (-1111.194) (-1111.859) * (-1112.266) [-1111.436] (-1110.630) (-1113.270) -- 0:00:29 Average standard deviation of split frequencies: 0.010025 555500 -- [-1110.444] (-1111.657) (-1113.399) (-1110.513) * (-1115.178) (-1110.184) [-1110.893] (-1113.040) -- 0:00:29 556000 -- [-1110.526] (-1115.051) (-1110.698) (-1110.691) * (-1113.904) [-1110.191] (-1114.500) (-1114.084) -- 0:00:29 556500 -- [-1110.881] (-1111.400) (-1112.968) (-1110.471) * [-1110.657] (-1112.892) (-1112.392) (-1114.255) -- 0:00:29 557000 -- (-1112.222) (-1110.758) (-1109.982) [-1109.825] * [-1110.184] (-1112.431) (-1110.194) (-1111.275) -- 0:00:29 557500 -- (-1112.696) (-1111.874) [-1111.864] (-1112.328) * (-1113.307) (-1111.842) [-1111.206] (-1114.037) -- 0:00:29 558000 -- (-1111.071) (-1109.496) (-1111.402) [-1113.535] * [-1109.623] (-1110.670) (-1110.719) (-1114.437) -- 0:00:29 558500 -- (-1114.253) (-1110.469) (-1111.372) [-1110.140] * [-1110.751] (-1111.347) (-1111.492) (-1114.598) -- 0:00:29 559000 -- (-1112.545) (-1111.045) (-1117.060) [-1109.960] * (-1110.835) (-1110.848) (-1112.960) [-1112.964] -- 0:00:29 559500 -- (-1112.944) [-1109.732] (-1109.835) (-1111.969) * (-1111.987) (-1118.102) (-1111.789) [-1112.666] -- 0:00:29 560000 -- (-1111.264) (-1109.452) [-1110.575] (-1113.942) * [-1114.532] (-1112.840) (-1110.548) (-1113.047) -- 0:00:29 Average standard deviation of split frequencies: 0.010337 560500 -- (-1112.626) [-1111.133] (-1112.638) (-1114.279) * (-1112.750) (-1112.564) [-1114.114] (-1111.144) -- 0:00:29 561000 -- (-1112.193) (-1110.117) (-1110.962) [-1110.153] * (-1112.290) [-1110.428] (-1115.147) (-1112.271) -- 0:00:28 561500 -- [-1111.364] (-1110.527) (-1111.901) (-1110.013) * (-1113.863) (-1111.144) [-1111.708] (-1110.039) -- 0:00:28 562000 -- (-1114.239) [-1112.835] (-1113.965) (-1110.313) * (-1113.057) [-1110.566] (-1113.743) (-1115.845) -- 0:00:28 562500 -- (-1111.947) (-1116.894) [-1109.670] (-1110.917) * (-1110.443) [-1110.515] (-1111.002) (-1113.255) -- 0:00:28 563000 -- (-1110.598) (-1110.139) (-1109.443) [-1112.156] * [-1110.410] (-1111.242) (-1110.954) (-1112.874) -- 0:00:28 563500 -- (-1113.036) (-1112.506) (-1109.728) [-1112.529] * [-1110.826] (-1113.299) (-1111.928) (-1115.841) -- 0:00:28 564000 -- (-1117.181) (-1110.718) [-1109.359] (-1112.348) * (-1112.818) [-1110.248] (-1112.779) (-1112.788) -- 0:00:28 564500 -- (-1115.600) [-1111.363] (-1114.706) (-1111.271) * (-1114.218) [-1109.435] (-1111.253) (-1112.687) -- 0:00:28 565000 -- (-1112.557) (-1111.175) (-1110.805) [-1111.152] * [-1112.424] (-1112.152) (-1113.042) (-1117.972) -- 0:00:28 Average standard deviation of split frequencies: 0.009902 565500 -- (-1110.480) [-1111.064] (-1112.550) (-1111.728) * (-1112.736) (-1111.806) [-1112.751] (-1111.226) -- 0:00:28 566000 -- (-1111.545) [-1110.440] (-1112.089) (-1111.240) * (-1118.507) (-1109.538) [-1110.802] (-1109.969) -- 0:00:28 566500 -- (-1115.550) [-1111.536] (-1109.696) (-1112.901) * (-1110.870) [-1112.425] (-1113.627) (-1112.364) -- 0:00:28 567000 -- (-1116.725) (-1111.406) [-1109.600] (-1109.958) * (-1109.906) [-1111.426] (-1111.668) (-1111.652) -- 0:00:28 567500 -- (-1110.527) (-1111.020) [-1110.657] (-1111.423) * (-1109.790) [-1109.953] (-1112.096) (-1111.259) -- 0:00:28 568000 -- [-1110.366] (-1112.760) (-1113.213) (-1111.345) * (-1115.508) (-1110.239) [-1113.350] (-1115.220) -- 0:00:28 568500 -- [-1111.343] (-1111.498) (-1113.065) (-1111.162) * (-1114.526) [-1110.879] (-1112.294) (-1111.135) -- 0:00:28 569000 -- (-1114.439) (-1112.285) [-1112.896] (-1113.848) * (-1114.144) [-1111.166] (-1112.722) (-1111.869) -- 0:00:28 569500 -- (-1113.170) (-1112.236) (-1111.546) [-1113.878] * (-1113.182) (-1113.006) (-1110.321) [-1112.134] -- 0:00:28 570000 -- (-1110.644) [-1113.656] (-1112.414) (-1112.816) * (-1113.492) (-1112.462) (-1112.026) [-1112.133] -- 0:00:28 Average standard deviation of split frequencies: 0.009729 570500 -- [-1111.035] (-1115.806) (-1113.221) (-1115.412) * (-1113.602) (-1114.056) (-1112.002) [-1111.108] -- 0:00:28 571000 -- (-1110.398) (-1111.774) (-1111.123) [-1111.938] * (-1113.168) (-1111.089) [-1110.675] (-1112.317) -- 0:00:28 571500 -- (-1112.939) (-1112.435) [-1111.870] (-1110.790) * (-1112.656) (-1111.572) (-1110.527) [-1109.825] -- 0:00:28 572000 -- (-1111.197) [-1112.973] (-1110.047) (-1112.534) * (-1112.318) [-1110.947] (-1109.519) (-1111.397) -- 0:00:28 572500 -- (-1110.432) [-1110.865] (-1110.908) (-1112.960) * (-1118.750) [-1111.285] (-1110.877) (-1111.982) -- 0:00:28 573000 -- [-1111.670] (-1111.476) (-1112.608) (-1115.634) * (-1109.845) [-1112.503] (-1110.604) (-1112.387) -- 0:00:28 573500 -- (-1110.759) [-1111.246] (-1110.443) (-1114.225) * (-1113.797) (-1112.820) [-1109.393] (-1115.071) -- 0:00:28 574000 -- (-1112.583) (-1112.651) [-1111.519] (-1113.004) * (-1114.775) (-1111.025) (-1114.372) [-1111.237] -- 0:00:28 574500 -- [-1111.152] (-1114.160) (-1109.939) (-1113.112) * (-1111.557) (-1111.186) (-1112.216) [-1112.045] -- 0:00:28 575000 -- (-1110.505) (-1112.427) (-1110.109) [-1111.640] * (-1114.012) (-1109.904) (-1112.572) [-1112.573] -- 0:00:28 Average standard deviation of split frequencies: 0.010399 575500 -- (-1110.828) (-1113.778) [-1112.214] (-1110.998) * (-1112.622) (-1110.313) [-1111.783] (-1111.283) -- 0:00:28 576000 -- (-1111.371) (-1111.714) (-1110.159) [-1110.436] * (-1113.635) (-1110.478) (-1114.758) [-1109.711] -- 0:00:27 576500 -- (-1114.950) (-1114.110) [-1112.699] (-1112.087) * (-1112.907) (-1113.067) (-1112.565) [-1111.505] -- 0:00:27 577000 -- [-1112.857] (-1113.428) (-1113.115) (-1115.368) * (-1112.581) (-1113.813) [-1113.788] (-1110.902) -- 0:00:27 577500 -- (-1114.058) (-1110.240) [-1116.341] (-1111.492) * (-1117.070) [-1113.266] (-1114.111) (-1111.179) -- 0:00:27 578000 -- (-1113.473) [-1113.703] (-1111.945) (-1114.597) * [-1113.222] (-1112.557) (-1116.906) (-1111.928) -- 0:00:27 578500 -- (-1111.266) [-1112.481] (-1112.906) (-1112.079) * (-1116.533) (-1111.165) (-1116.715) [-1114.364] -- 0:00:27 579000 -- (-1112.744) (-1116.483) [-1113.515] (-1111.512) * [-1117.493] (-1110.700) (-1112.471) (-1114.843) -- 0:00:27 579500 -- (-1113.590) (-1112.587) (-1110.778) [-1115.584] * (-1111.344) (-1112.318) [-1110.107] (-1113.925) -- 0:00:27 580000 -- (-1110.830) (-1111.186) [-1114.039] (-1111.075) * [-1113.285] (-1111.775) (-1111.360) (-1109.770) -- 0:00:27 Average standard deviation of split frequencies: 0.010984 580500 -- [-1110.881] (-1110.694) (-1114.494) (-1112.822) * [-1113.509] (-1111.356) (-1112.996) (-1111.000) -- 0:00:27 581000 -- (-1112.505) [-1113.201] (-1110.349) (-1112.919) * (-1113.511) [-1111.107] (-1111.350) (-1113.396) -- 0:00:27 581500 -- [-1109.625] (-1111.591) (-1110.568) (-1110.438) * [-1115.673] (-1110.973) (-1114.045) (-1110.771) -- 0:00:27 582000 -- (-1111.942) [-1114.997] (-1110.247) (-1114.832) * (-1118.065) (-1111.258) [-1113.074] (-1111.935) -- 0:00:27 582500 -- [-1113.808] (-1114.228) (-1111.064) (-1114.244) * (-1119.276) [-1111.285] (-1113.223) (-1114.466) -- 0:00:27 583000 -- (-1113.698) (-1113.124) [-1112.301] (-1116.771) * (-1116.745) [-1112.670] (-1114.399) (-1112.467) -- 0:00:27 583500 -- [-1110.700] (-1111.939) (-1118.241) (-1114.174) * (-1112.657) [-1111.603] (-1109.523) (-1111.124) -- 0:00:27 584000 -- (-1110.590) [-1111.173] (-1112.082) (-1112.935) * (-1111.140) (-1112.794) (-1110.828) [-1110.822] -- 0:00:27 584500 -- (-1113.107) [-1109.855] (-1113.879) (-1109.685) * (-1110.156) (-1111.900) [-1110.263] (-1112.910) -- 0:00:27 585000 -- (-1110.445) (-1111.978) (-1111.576) [-1109.966] * (-1111.568) (-1110.331) [-1111.175] (-1110.163) -- 0:00:27 Average standard deviation of split frequencies: 0.010458 585500 -- (-1112.684) [-1110.688] (-1112.717) (-1111.371) * [-1110.380] (-1110.115) (-1111.070) (-1109.889) -- 0:00:27 586000 -- [-1115.905] (-1111.811) (-1111.191) (-1112.304) * (-1113.599) [-1110.381] (-1111.740) (-1109.965) -- 0:00:27 586500 -- [-1111.754] (-1112.173) (-1112.936) (-1112.507) * [-1111.596] (-1110.619) (-1110.584) (-1111.061) -- 0:00:27 587000 -- (-1113.409) [-1112.405] (-1114.215) (-1112.868) * [-1114.694] (-1111.982) (-1109.810) (-1111.160) -- 0:00:27 587500 -- (-1114.402) (-1114.278) (-1112.456) [-1109.914] * [-1113.162] (-1114.799) (-1110.486) (-1112.829) -- 0:00:27 588000 -- [-1110.991] (-1111.408) (-1112.212) (-1110.795) * (-1112.497) (-1109.779) (-1111.254) [-1112.607] -- 0:00:27 588500 -- (-1111.184) (-1111.174) (-1115.997) [-1113.161] * (-1112.310) (-1115.051) [-1112.472] (-1111.832) -- 0:00:27 589000 -- (-1111.612) (-1112.048) (-1112.110) [-1111.537] * [-1111.151] (-1112.538) (-1113.299) (-1111.820) -- 0:00:27 589500 -- (-1110.146) (-1111.350) (-1118.296) [-1111.643] * [-1111.162] (-1111.940) (-1113.078) (-1113.454) -- 0:00:27 590000 -- (-1111.356) (-1112.926) [-1112.206] (-1111.118) * [-1110.186] (-1111.296) (-1110.876) (-1115.765) -- 0:00:27 Average standard deviation of split frequencies: 0.010419 590500 -- (-1110.034) (-1112.295) [-1118.016] (-1110.745) * (-1109.579) [-1111.154] (-1111.611) (-1117.006) -- 0:00:27 591000 -- (-1111.145) (-1117.197) [-1113.696] (-1111.772) * [-1111.248] (-1111.077) (-1112.547) (-1116.702) -- 0:00:26 591500 -- (-1110.274) (-1112.057) [-1110.061] (-1109.864) * (-1112.662) (-1116.479) [-1111.130] (-1115.220) -- 0:00:26 592000 -- [-1110.650] (-1114.478) (-1110.232) (-1110.121) * [-1112.985] (-1113.280) (-1112.423) (-1114.547) -- 0:00:26 592500 -- (-1112.988) (-1112.783) [-1111.368] (-1109.771) * (-1111.422) [-1111.474] (-1111.688) (-1112.663) -- 0:00:26 593000 -- [-1114.344] (-1111.054) (-1110.239) (-1110.603) * (-1110.988) (-1110.826) [-1111.476] (-1111.348) -- 0:00:26 593500 -- (-1111.441) [-1112.365] (-1110.350) (-1109.582) * (-1114.723) (-1112.817) [-1109.945] (-1114.105) -- 0:00:26 594000 -- (-1112.479) [-1112.576] (-1111.393) (-1111.044) * (-1115.552) [-1110.437] (-1111.951) (-1112.527) -- 0:00:26 594500 -- [-1110.454] (-1112.768) (-1113.242) (-1110.300) * (-1115.448) (-1110.916) (-1117.389) [-1111.244] -- 0:00:26 595000 -- (-1112.326) [-1110.831] (-1112.515) (-1109.446) * (-1112.827) [-1111.007] (-1112.798) (-1111.986) -- 0:00:26 Average standard deviation of split frequencies: 0.010458 595500 -- (-1111.638) (-1110.061) [-1111.312] (-1110.526) * (-1112.395) (-1110.714) (-1112.860) [-1113.081] -- 0:00:26 596000 -- (-1110.885) (-1109.839) [-1115.346] (-1110.944) * (-1111.718) (-1114.717) (-1112.897) [-1109.878] -- 0:00:27 596500 -- (-1112.800) (-1112.079) (-1118.176) [-1110.912] * [-1110.489] (-1118.698) (-1112.432) (-1111.567) -- 0:00:27 597000 -- (-1114.935) (-1112.065) (-1111.896) [-1112.644] * (-1112.141) [-1114.254] (-1111.780) (-1112.240) -- 0:00:27 597500 -- (-1113.990) (-1111.376) [-1112.328] (-1114.496) * [-1109.939] (-1112.629) (-1110.574) (-1110.114) -- 0:00:26 598000 -- [-1111.057] (-1112.948) (-1110.888) (-1113.779) * (-1111.225) (-1111.380) [-1113.498] (-1112.482) -- 0:00:26 598500 -- [-1112.396] (-1111.000) (-1111.544) (-1111.899) * (-1110.480) (-1110.249) [-1111.839] (-1111.530) -- 0:00:26 599000 -- (-1110.585) (-1114.152) (-1112.938) [-1111.185] * (-1109.769) (-1109.837) [-1110.438] (-1112.692) -- 0:00:26 599500 -- (-1111.873) [-1110.352] (-1110.605) (-1114.399) * (-1110.189) (-1110.346) [-1112.241] (-1110.079) -- 0:00:26 600000 -- (-1115.821) (-1111.340) [-1110.064] (-1113.011) * (-1111.543) (-1109.675) (-1112.607) [-1116.312] -- 0:00:26 Average standard deviation of split frequencies: 0.010551 600500 -- (-1116.864) (-1111.156) [-1110.063] (-1110.787) * (-1112.599) (-1111.566) [-1110.810] (-1111.092) -- 0:00:26 601000 -- (-1115.599) (-1113.174) [-1110.085] (-1109.718) * (-1113.110) (-1110.292) (-1111.470) [-1112.375] -- 0:00:26 601500 -- (-1114.369) (-1115.670) (-1109.638) [-1109.614] * (-1112.954) [-1111.749] (-1110.428) (-1110.899) -- 0:00:26 602000 -- (-1113.245) (-1113.515) [-1109.476] (-1111.973) * (-1114.178) (-1113.495) [-1111.487] (-1112.180) -- 0:00:26 602500 -- (-1112.846) (-1112.035) (-1112.467) [-1111.607] * [-1110.347] (-1111.975) (-1110.843) (-1111.210) -- 0:00:26 603000 -- (-1110.838) (-1110.027) [-1111.709] (-1112.588) * [-1111.901] (-1111.380) (-1111.185) (-1110.210) -- 0:00:26 603500 -- (-1112.704) (-1111.983) (-1111.247) [-1113.757] * (-1110.807) (-1110.020) (-1113.402) [-1110.692] -- 0:00:26 604000 -- [-1113.709] (-1111.464) (-1111.452) (-1110.597) * (-1110.515) (-1109.982) (-1111.123) [-1110.561] -- 0:00:26 604500 -- (-1110.420) (-1111.787) (-1111.331) [-1112.527] * (-1112.251) [-1110.158] (-1113.946) (-1114.642) -- 0:00:26 605000 -- [-1110.132] (-1111.282) (-1114.967) (-1111.186) * (-1110.604) (-1109.332) (-1112.435) [-1111.983] -- 0:00:26 Average standard deviation of split frequencies: 0.010761 605500 -- [-1111.083] (-1110.321) (-1110.327) (-1113.628) * (-1110.044) (-1111.141) [-1109.675] (-1110.500) -- 0:00:26 606000 -- (-1115.693) (-1110.295) [-1110.783] (-1110.655) * (-1110.929) [-1111.787] (-1111.323) (-1110.517) -- 0:00:26 606500 -- (-1111.026) [-1110.778] (-1110.933) (-1113.521) * [-1111.491] (-1110.358) (-1113.421) (-1110.548) -- 0:00:25 607000 -- (-1111.080) (-1110.824) [-1110.735] (-1110.803) * (-1109.923) [-1113.608] (-1111.177) (-1110.872) -- 0:00:25 607500 -- (-1113.672) (-1115.631) [-1110.934] (-1111.778) * [-1115.525] (-1110.352) (-1112.572) (-1110.117) -- 0:00:25 608000 -- (-1112.943) (-1111.064) [-1110.886] (-1120.861) * [-1110.170] (-1111.606) (-1112.014) (-1110.346) -- 0:00:25 608500 -- (-1111.691) (-1110.481) [-1114.480] (-1113.496) * (-1110.185) (-1114.616) (-1110.852) [-1110.377] -- 0:00:25 609000 -- (-1118.344) [-1112.035] (-1113.585) (-1113.591) * (-1113.099) [-1112.806] (-1114.103) (-1111.175) -- 0:00:26 609500 -- [-1115.116] (-1110.812) (-1111.390) (-1112.700) * (-1110.573) [-1114.198] (-1113.722) (-1110.456) -- 0:00:26 610000 -- (-1111.924) [-1110.886] (-1112.639) (-1111.229) * (-1110.433) [-1111.594] (-1114.109) (-1112.485) -- 0:00:26 Average standard deviation of split frequencies: 0.011065 610500 -- (-1110.848) (-1110.513) (-1113.971) [-1111.545] * [-1110.365] (-1112.049) (-1110.291) (-1110.359) -- 0:00:26 611000 -- (-1111.836) (-1112.222) (-1110.917) [-1111.289] * (-1110.680) (-1109.740) [-1111.849] (-1110.744) -- 0:00:26 611500 -- [-1113.068] (-1110.563) (-1111.588) (-1113.301) * [-1112.082] (-1109.658) (-1110.945) (-1110.939) -- 0:00:26 612000 -- (-1112.851) [-1109.598] (-1112.703) (-1113.527) * (-1111.837) (-1110.731) [-1111.091] (-1118.549) -- 0:00:25 612500 -- [-1113.151] (-1112.464) (-1111.754) (-1111.311) * (-1111.476) (-1113.124) [-1113.470] (-1112.618) -- 0:00:25 613000 -- (-1115.030) (-1112.743) (-1110.323) [-1114.143] * (-1113.311) (-1111.129) (-1111.995) [-1112.962] -- 0:00:25 613500 -- (-1112.203) (-1111.904) [-1112.519] (-1111.161) * (-1110.635) [-1111.044] (-1110.417) (-1113.947) -- 0:00:25 614000 -- [-1112.055] (-1112.187) (-1112.463) (-1111.555) * (-1113.722) [-1112.150] (-1113.884) (-1112.182) -- 0:00:25 614500 -- (-1111.067) (-1113.012) (-1113.016) [-1110.034] * [-1113.577] (-1113.981) (-1111.707) (-1111.987) -- 0:00:25 615000 -- [-1112.276] (-1110.492) (-1112.634) (-1112.561) * (-1111.806) [-1110.067] (-1112.407) (-1111.486) -- 0:00:25 Average standard deviation of split frequencies: 0.010969 615500 -- (-1110.858) [-1110.702] (-1115.110) (-1111.331) * (-1111.224) (-1110.836) [-1111.628] (-1112.011) -- 0:00:25 616000 -- (-1111.632) (-1111.507) (-1117.099) [-1110.416] * [-1111.958] (-1111.394) (-1109.739) (-1112.353) -- 0:00:25 616500 -- (-1110.981) (-1113.803) (-1110.044) [-1110.624] * (-1110.977) (-1110.754) [-1112.944] (-1110.561) -- 0:00:25 617000 -- [-1110.350] (-1112.131) (-1111.446) (-1114.930) * [-1114.089] (-1110.757) (-1111.034) (-1111.174) -- 0:00:25 617500 -- (-1111.339) [-1110.155] (-1112.457) (-1113.135) * (-1110.825) [-1110.721] (-1110.112) (-1110.295) -- 0:00:25 618000 -- (-1111.042) [-1110.407] (-1110.688) (-1116.892) * (-1110.274) (-1112.380) (-1110.628) [-1112.345] -- 0:00:25 618500 -- (-1109.826) (-1111.592) [-1110.671] (-1112.990) * [-1110.344] (-1111.140) (-1112.035) (-1112.109) -- 0:00:25 619000 -- (-1110.262) (-1109.799) [-1118.287] (-1110.452) * (-1109.987) (-1111.247) (-1111.955) [-1111.539] -- 0:00:25 619500 -- (-1112.326) [-1110.276] (-1115.798) (-1111.196) * (-1111.950) [-1110.962] (-1115.997) (-1112.412) -- 0:00:25 620000 -- (-1111.127) (-1112.807) [-1110.323] (-1111.818) * (-1113.433) (-1112.778) [-1111.045] (-1110.662) -- 0:00:25 Average standard deviation of split frequencies: 0.011561 620500 -- (-1110.646) [-1111.309] (-1113.415) (-1112.450) * [-1110.105] (-1110.435) (-1112.209) (-1112.650) -- 0:00:25 621000 -- (-1110.619) (-1110.933) [-1112.724] (-1113.009) * [-1114.357] (-1112.572) (-1113.367) (-1110.133) -- 0:00:25 621500 -- (-1110.504) (-1111.225) (-1110.737) [-1112.327] * (-1110.167) (-1115.057) (-1119.293) [-1111.829] -- 0:00:25 622000 -- [-1111.855] (-1111.519) (-1109.502) (-1110.675) * (-1110.908) (-1114.136) (-1111.928) [-1113.499] -- 0:00:25 622500 -- [-1112.023] (-1111.278) (-1109.727) (-1111.240) * (-1111.575) (-1110.732) [-1111.279] (-1110.093) -- 0:00:25 623000 -- (-1112.176) (-1112.416) [-1109.605] (-1110.239) * (-1112.777) [-1111.513] (-1115.011) (-1110.342) -- 0:00:25 623500 -- (-1110.801) (-1110.088) [-1111.860] (-1114.285) * (-1112.113) (-1112.489) [-1113.635] (-1111.823) -- 0:00:25 624000 -- [-1111.044] (-1110.755) (-1114.881) (-1111.154) * (-1111.469) [-1111.857] (-1114.163) (-1113.226) -- 0:00:25 624500 -- (-1111.894) (-1110.465) (-1114.643) [-1110.205] * [-1111.675] (-1112.605) (-1112.719) (-1112.038) -- 0:00:25 625000 -- (-1111.940) (-1111.273) (-1121.146) [-1110.387] * (-1112.577) (-1111.402) [-1111.363] (-1112.892) -- 0:00:25 Average standard deviation of split frequencies: 0.011588 625500 -- (-1112.906) [-1109.887] (-1113.170) (-1109.896) * (-1109.659) [-1111.364] (-1112.344) (-1112.310) -- 0:00:25 626000 -- (-1112.332) [-1111.248] (-1113.565) (-1110.932) * [-1114.277] (-1113.401) (-1110.411) (-1110.943) -- 0:00:25 626500 -- (-1110.716) (-1111.151) [-1112.687] (-1113.979) * [-1114.511] (-1112.216) (-1111.302) (-1112.324) -- 0:00:25 627000 -- (-1112.012) (-1114.990) [-1112.026] (-1116.429) * (-1110.919) [-1111.295] (-1111.852) (-1112.229) -- 0:00:24 627500 -- (-1113.095) [-1111.602] (-1112.627) (-1110.543) * (-1110.725) (-1111.430) [-1112.238] (-1112.940) -- 0:00:24 628000 -- (-1110.283) (-1110.838) [-1116.513] (-1111.618) * [-1113.876] (-1113.700) (-1112.110) (-1115.949) -- 0:00:24 628500 -- (-1113.126) [-1112.872] (-1112.518) (-1112.417) * [-1111.080] (-1110.530) (-1112.444) (-1117.608) -- 0:00:24 629000 -- (-1113.893) (-1113.224) [-1112.812] (-1114.658) * (-1114.107) (-1111.986) [-1112.128] (-1116.817) -- 0:00:24 629500 -- (-1109.743) (-1110.214) [-1111.954] (-1112.790) * [-1114.117] (-1112.478) (-1111.694) (-1115.373) -- 0:00:24 630000 -- [-1111.061] (-1111.047) (-1111.165) (-1110.972) * (-1113.020) [-1112.229] (-1111.512) (-1112.093) -- 0:00:24 Average standard deviation of split frequencies: 0.011503 630500 -- [-1111.151] (-1112.435) (-1111.417) (-1111.930) * (-1112.668) (-1110.209) (-1112.676) [-1115.137] -- 0:00:24 631000 -- [-1111.944] (-1112.837) (-1110.078) (-1113.515) * (-1111.469) [-1109.991] (-1111.816) (-1112.125) -- 0:00:24 631500 -- (-1113.198) (-1110.337) (-1111.516) [-1109.866] * (-1111.610) (-1109.737) (-1110.949) [-1110.184] -- 0:00:24 632000 -- [-1110.886] (-1114.954) (-1109.855) (-1113.948) * [-1112.240] (-1112.120) (-1111.754) (-1115.404) -- 0:00:24 632500 -- (-1114.148) (-1110.539) (-1113.178) [-1114.481] * (-1117.647) (-1111.805) (-1111.817) [-1109.824] -- 0:00:24 633000 -- (-1112.715) (-1112.117) [-1111.450] (-1111.200) * (-1112.993) (-1115.585) (-1113.754) [-1110.645] -- 0:00:24 633500 -- (-1110.755) (-1112.820) [-1111.399] (-1112.231) * [-1109.940] (-1109.756) (-1117.810) (-1111.171) -- 0:00:24 634000 -- (-1112.683) (-1112.091) (-1111.305) [-1111.468] * (-1109.993) (-1113.879) (-1114.183) [-1111.169] -- 0:00:24 634500 -- (-1113.383) [-1110.162] (-1112.267) (-1111.332) * (-1110.006) (-1112.270) (-1111.152) [-1110.732] -- 0:00:24 635000 -- (-1111.993) [-1109.668] (-1116.138) (-1111.843) * (-1112.040) (-1109.809) [-1110.942] (-1110.531) -- 0:00:24 Average standard deviation of split frequencies: 0.011695 635500 -- (-1109.807) (-1110.211) [-1110.154] (-1115.485) * [-1111.653] (-1110.963) (-1111.155) (-1110.808) -- 0:00:24 636000 -- [-1116.980] (-1110.843) (-1112.988) (-1115.658) * (-1113.543) (-1110.526) [-1111.822] (-1112.672) -- 0:00:24 636500 -- (-1112.693) [-1110.949] (-1118.796) (-1110.970) * (-1112.897) [-1110.405] (-1111.033) (-1115.163) -- 0:00:24 637000 -- (-1111.333) [-1111.685] (-1113.518) (-1111.089) * (-1113.978) [-1110.396] (-1114.745) (-1114.410) -- 0:00:24 637500 -- (-1113.433) (-1113.782) [-1111.103] (-1113.416) * (-1111.245) (-1112.595) (-1114.362) [-1113.584] -- 0:00:24 638000 -- [-1111.514] (-1112.610) (-1109.550) (-1112.920) * (-1111.265) [-1110.162] (-1111.118) (-1114.790) -- 0:00:24 638500 -- (-1111.412) [-1111.166] (-1115.025) (-1112.624) * [-1112.157] (-1109.692) (-1113.151) (-1112.138) -- 0:00:24 639000 -- (-1111.730) [-1110.769] (-1111.077) (-1113.432) * [-1111.713] (-1109.859) (-1110.018) (-1114.963) -- 0:00:24 639500 -- (-1116.240) (-1110.274) (-1110.125) [-1113.836] * (-1113.409) (-1110.707) (-1112.659) [-1114.163] -- 0:00:24 640000 -- (-1112.123) [-1111.171] (-1111.730) (-1111.687) * (-1110.186) [-1109.776] (-1111.367) (-1113.098) -- 0:00:24 Average standard deviation of split frequencies: 0.011650 640500 -- [-1111.659] (-1110.132) (-1111.380) (-1112.412) * (-1110.522) [-1109.614] (-1113.746) (-1111.024) -- 0:00:24 641000 -- (-1110.708) [-1110.160] (-1111.021) (-1112.856) * (-1112.073) (-1113.145) [-1110.529] (-1111.208) -- 0:00:24 641500 -- (-1110.308) (-1113.163) [-1112.151] (-1109.777) * (-1113.659) (-1111.814) [-1110.481] (-1114.038) -- 0:00:24 642000 -- [-1110.933] (-1111.022) (-1111.938) (-1111.749) * (-1113.002) (-1111.477) (-1113.693) [-1110.237] -- 0:00:23 642500 -- (-1110.810) [-1112.838] (-1117.156) (-1112.660) * (-1116.636) (-1109.904) (-1115.331) [-1110.018] -- 0:00:23 643000 -- (-1109.962) (-1111.482) [-1112.389] (-1111.985) * [-1114.035] (-1109.949) (-1115.340) (-1109.918) -- 0:00:23 643500 -- [-1109.509] (-1109.917) (-1111.020) (-1115.842) * (-1111.913) [-1110.305] (-1111.516) (-1109.886) -- 0:00:23 644000 -- (-1109.510) (-1109.908) (-1111.128) [-1111.785] * [-1112.077] (-1111.433) (-1112.858) (-1110.348) -- 0:00:23 644500 -- (-1110.664) (-1109.930) [-1110.132] (-1111.437) * (-1113.236) (-1111.125) [-1110.003] (-1110.114) -- 0:00:23 645000 -- [-1111.265] (-1110.695) (-1111.929) (-1109.860) * (-1112.077) (-1111.551) (-1115.957) [-1110.626] -- 0:00:23 Average standard deviation of split frequencies: 0.011757 645500 -- (-1113.681) (-1116.715) (-1112.909) [-1109.810] * (-1111.855) [-1111.714] (-1110.591) (-1109.592) -- 0:00:23 646000 -- [-1111.419] (-1111.829) (-1115.959) (-1109.812) * (-1112.545) (-1112.753) [-1114.880] (-1120.556) -- 0:00:23 646500 -- (-1112.864) [-1110.883] (-1112.668) (-1112.418) * (-1112.335) [-1113.506] (-1111.247) (-1115.081) -- 0:00:23 647000 -- [-1110.470] (-1113.147) (-1113.164) (-1112.125) * (-1113.158) [-1110.347] (-1110.737) (-1109.989) -- 0:00:23 647500 -- (-1111.444) [-1112.491] (-1110.759) (-1112.765) * (-1113.050) (-1111.890) [-1111.253] (-1109.685) -- 0:00:23 648000 -- (-1110.847) (-1114.491) (-1109.747) [-1111.869] * (-1112.075) (-1111.133) [-1112.212] (-1110.260) -- 0:00:23 648500 -- (-1111.576) [-1113.138] (-1109.766) (-1113.322) * (-1113.727) (-1114.826) (-1110.881) [-1109.826] -- 0:00:23 649000 -- (-1111.430) (-1112.026) (-1111.467) [-1110.466] * [-1110.061] (-1111.832) (-1111.674) (-1111.329) -- 0:00:23 649500 -- (-1111.250) [-1111.649] (-1118.165) (-1110.851) * (-1110.191) [-1109.379] (-1109.910) (-1112.797) -- 0:00:23 650000 -- (-1112.932) [-1117.709] (-1112.269) (-1112.497) * [-1111.938] (-1112.061) (-1110.453) (-1111.727) -- 0:00:23 Average standard deviation of split frequencies: 0.011350 650500 -- (-1112.801) (-1111.880) (-1112.304) [-1110.044] * [-1110.703] (-1112.510) (-1111.810) (-1111.924) -- 0:00:23 651000 -- (-1113.031) (-1110.953) (-1112.613) [-1110.040] * (-1113.682) (-1111.551) [-1112.204] (-1109.785) -- 0:00:23 651500 -- (-1112.733) [-1109.943] (-1114.839) (-1113.692) * (-1111.466) [-1112.181] (-1112.558) (-1114.836) -- 0:00:23 652000 -- (-1114.931) [-1110.014] (-1111.691) (-1112.942) * (-1112.579) (-1111.158) [-1111.522] (-1111.017) -- 0:00:23 652500 -- [-1109.584] (-1112.290) (-1112.651) (-1111.925) * (-1110.222) (-1111.446) [-1111.464] (-1120.743) -- 0:00:23 653000 -- [-1111.708] (-1116.135) (-1112.694) (-1111.071) * [-1111.741] (-1112.021) (-1112.402) (-1114.525) -- 0:00:23 653500 -- [-1111.216] (-1111.632) (-1112.851) (-1112.094) * [-1111.295] (-1111.505) (-1111.125) (-1115.503) -- 0:00:23 654000 -- (-1111.286) [-1111.020] (-1114.153) (-1112.647) * [-1115.599] (-1110.123) (-1112.171) (-1114.263) -- 0:00:23 654500 -- (-1110.571) [-1110.635] (-1112.336) (-1112.168) * (-1122.233) (-1114.852) [-1111.162] (-1115.636) -- 0:00:23 655000 -- (-1112.759) [-1111.522] (-1112.746) (-1115.458) * (-1116.525) [-1110.912] (-1122.022) (-1114.770) -- 0:00:23 Average standard deviation of split frequencies: 0.011138 655500 -- (-1118.441) (-1111.037) [-1110.946] (-1116.235) * (-1111.867) [-1110.405] (-1112.571) (-1113.567) -- 0:00:23 656000 -- (-1110.680) (-1109.932) (-1110.676) [-1110.651] * [-1111.673] (-1111.790) (-1110.839) (-1113.521) -- 0:00:23 656500 -- [-1110.223] (-1113.800) (-1115.870) (-1110.700) * (-1111.608) [-1111.790] (-1110.247) (-1113.803) -- 0:00:23 657000 -- (-1110.394) (-1112.108) (-1110.390) [-1110.727] * (-1113.935) [-1110.663] (-1114.369) (-1112.453) -- 0:00:22 657500 -- (-1117.622) (-1111.506) [-1112.500] (-1112.987) * (-1112.716) (-1113.136) (-1112.986) [-1114.885] -- 0:00:22 658000 -- (-1111.431) [-1111.506] (-1112.228) (-1113.099) * (-1111.517) [-1116.172] (-1115.851) (-1112.042) -- 0:00:22 658500 -- (-1114.217) [-1109.421] (-1110.138) (-1111.280) * (-1115.520) (-1118.901) [-1112.216] (-1111.146) -- 0:00:22 659000 -- (-1113.398) (-1111.057) [-1109.783] (-1112.192) * (-1115.185) [-1111.659] (-1112.798) (-1112.177) -- 0:00:22 659500 -- (-1112.031) (-1113.387) [-1109.767] (-1111.046) * (-1111.877) (-1111.374) (-1117.483) [-1114.881] -- 0:00:22 660000 -- [-1113.837] (-1111.951) (-1110.812) (-1110.409) * (-1112.089) (-1111.571) (-1109.774) [-1111.899] -- 0:00:22 Average standard deviation of split frequencies: 0.011099 660500 -- (-1110.849) (-1115.060) (-1111.488) [-1109.821] * [-1112.265] (-1114.448) (-1110.054) (-1112.825) -- 0:00:22 661000 -- (-1110.537) (-1112.509) [-1110.686] (-1110.356) * (-1114.391) (-1113.641) [-1110.359] (-1110.693) -- 0:00:22 661500 -- (-1116.785) (-1111.984) [-1111.494] (-1110.508) * (-1115.552) [-1111.209] (-1109.677) (-1113.826) -- 0:00:22 662000 -- [-1123.395] (-1110.071) (-1111.964) (-1111.079) * (-1112.056) (-1110.268) [-1112.745] (-1112.265) -- 0:00:22 662500 -- (-1121.689) (-1111.556) [-1110.538] (-1110.771) * (-1114.178) (-1109.999) (-1114.093) [-1114.343] -- 0:00:22 663000 -- (-1118.817) (-1115.816) (-1111.120) [-1112.137] * (-1110.137) (-1111.020) (-1112.027) [-1112.067] -- 0:00:22 663500 -- (-1118.626) (-1110.873) (-1109.660) [-1112.687] * (-1113.254) [-1112.433] (-1112.204) (-1110.047) -- 0:00:22 664000 -- [-1111.529] (-1111.887) (-1110.384) (-1113.508) * (-1111.443) (-1112.082) (-1113.281) [-1112.764] -- 0:00:22 664500 -- (-1110.520) (-1110.487) [-1110.299] (-1112.420) * [-1111.619] (-1114.434) (-1110.367) (-1112.018) -- 0:00:22 665000 -- (-1111.836) (-1115.585) [-1112.885] (-1111.111) * [-1112.208] (-1112.842) (-1112.283) (-1111.609) -- 0:00:22 Average standard deviation of split frequencies: 0.010735 665500 -- (-1112.946) (-1112.576) [-1116.071] (-1115.229) * (-1112.082) (-1111.679) [-1111.697] (-1111.259) -- 0:00:22 666000 -- (-1109.449) [-1110.319] (-1114.180) (-1113.654) * (-1110.331) [-1112.398] (-1111.652) (-1114.427) -- 0:00:22 666500 -- [-1110.327] (-1111.009) (-1111.393) (-1113.219) * (-1110.051) (-1110.626) [-1111.135] (-1112.367) -- 0:00:22 667000 -- [-1109.511] (-1110.905) (-1110.252) (-1111.018) * (-1111.304) (-1113.220) (-1111.934) [-1110.309] -- 0:00:22 667500 -- [-1112.432] (-1110.601) (-1111.166) (-1110.515) * (-1110.312) (-1110.899) [-1114.355] (-1110.587) -- 0:00:22 668000 -- (-1111.924) [-1110.118] (-1111.522) (-1111.079) * [-1110.713] (-1115.381) (-1114.796) (-1111.862) -- 0:00:22 668500 -- (-1111.146) [-1111.888] (-1112.376) (-1115.058) * [-1109.717] (-1114.932) (-1113.399) (-1113.625) -- 0:00:22 669000 -- (-1110.686) (-1112.491) [-1112.466] (-1112.945) * [-1112.661] (-1111.550) (-1112.970) (-1114.058) -- 0:00:22 669500 -- (-1113.140) (-1112.965) [-1111.616] (-1111.327) * [-1114.556] (-1110.348) (-1110.634) (-1112.633) -- 0:00:22 670000 -- [-1110.259] (-1113.881) (-1113.179) (-1112.625) * (-1111.237) [-1111.079] (-1110.351) (-1112.886) -- 0:00:22 Average standard deviation of split frequencies: 0.011129 670500 -- (-1110.280) [-1111.521] (-1110.237) (-1112.366) * (-1112.627) (-1111.047) [-1114.652] (-1115.619) -- 0:00:22 671000 -- [-1113.549] (-1111.544) (-1111.138) (-1115.014) * (-1110.106) (-1111.593) [-1110.502] (-1110.963) -- 0:00:22 671500 -- (-1111.811) (-1112.702) [-1111.977] (-1116.522) * [-1111.140] (-1111.503) (-1110.513) (-1112.962) -- 0:00:22 672000 -- [-1112.560] (-1115.348) (-1114.182) (-1113.792) * (-1111.884) (-1110.725) [-1111.090] (-1111.318) -- 0:00:21 672500 -- (-1114.680) [-1112.527] (-1111.502) (-1114.329) * (-1117.707) (-1110.832) (-1113.371) [-1111.259] -- 0:00:21 673000 -- [-1113.065] (-1111.496) (-1109.933) (-1110.980) * (-1113.284) (-1113.932) (-1113.226) [-1110.062] -- 0:00:21 673500 -- (-1112.850) (-1112.616) (-1109.981) [-1109.802] * [-1114.992] (-1115.506) (-1111.733) (-1113.439) -- 0:00:21 674000 -- (-1113.570) (-1111.563) (-1110.837) [-1110.454] * (-1116.684) (-1111.980) (-1110.650) [-1110.007] -- 0:00:21 674500 -- [-1113.904] (-1112.634) (-1109.412) (-1112.152) * (-1116.385) [-1110.546] (-1112.852) (-1115.049) -- 0:00:21 675000 -- (-1111.815) (-1114.800) (-1109.858) [-1114.484] * (-1112.683) [-1113.693] (-1111.349) (-1114.481) -- 0:00:21 Average standard deviation of split frequencies: 0.011467 675500 -- (-1113.805) (-1110.083) (-1110.188) [-1110.291] * (-1109.809) (-1114.132) [-1112.570] (-1111.018) -- 0:00:21 676000 -- [-1110.466] (-1110.397) (-1110.612) (-1112.360) * (-1113.604) (-1111.745) [-1110.021] (-1114.330) -- 0:00:21 676500 -- (-1111.691) [-1109.669] (-1110.570) (-1112.209) * (-1109.965) (-1113.439) [-1111.221] (-1110.741) -- 0:00:21 677000 -- (-1114.576) (-1113.280) [-1110.238] (-1111.626) * (-1111.147) (-1110.224) (-1114.676) [-1111.349] -- 0:00:21 677500 -- (-1111.087) (-1109.783) [-1110.519] (-1111.069) * (-1111.325) (-1110.407) (-1110.983) [-1110.259] -- 0:00:21 678000 -- (-1111.876) (-1110.722) (-1111.779) [-1111.043] * [-1110.136] (-1110.037) (-1113.907) (-1112.661) -- 0:00:21 678500 -- (-1109.488) (-1109.958) (-1111.611) [-1110.943] * (-1112.417) [-1110.973] (-1112.439) (-1109.494) -- 0:00:21 679000 -- [-1111.485] (-1113.137) (-1110.578) (-1110.228) * (-1111.742) [-1111.312] (-1110.889) (-1109.609) -- 0:00:21 679500 -- (-1112.439) [-1109.657] (-1110.435) (-1110.259) * (-1110.387) (-1110.006) [-1111.501] (-1110.197) -- 0:00:21 680000 -- (-1119.997) (-1109.777) [-1112.296] (-1119.065) * (-1114.036) (-1112.013) [-1110.988] (-1110.327) -- 0:00:21 Average standard deviation of split frequencies: 0.011733 680500 -- (-1112.205) (-1111.298) (-1112.115) [-1114.201] * [-1110.797] (-1116.114) (-1115.875) (-1111.099) -- 0:00:21 681000 -- (-1117.647) (-1111.450) [-1111.828] (-1112.348) * (-1111.765) [-1111.732] (-1112.030) (-1109.806) -- 0:00:21 681500 -- (-1122.991) (-1111.204) [-1110.919] (-1111.075) * (-1113.114) (-1111.585) [-1111.883] (-1110.053) -- 0:00:21 682000 -- (-1112.062) (-1111.503) [-1116.403] (-1110.156) * (-1112.247) (-1112.123) (-1110.671) [-1110.336] -- 0:00:21 682500 -- (-1112.076) (-1118.762) (-1113.155) [-1114.903] * (-1113.349) (-1111.565) (-1117.705) [-1113.589] -- 0:00:21 683000 -- (-1110.451) (-1112.620) [-1109.948] (-1113.631) * (-1112.774) (-1114.239) (-1111.922) [-1113.672] -- 0:00:21 683500 -- (-1110.940) (-1116.637) (-1110.251) [-1110.734] * [-1111.272] (-1117.804) (-1111.280) (-1112.775) -- 0:00:21 684000 -- (-1110.419) [-1112.338] (-1112.324) (-1111.108) * [-1110.200] (-1111.637) (-1110.277) (-1114.835) -- 0:00:21 684500 -- (-1113.422) (-1118.981) [-1111.130] (-1110.339) * (-1112.074) (-1113.863) [-1110.353] (-1111.363) -- 0:00:21 685000 -- (-1110.533) [-1115.099] (-1111.002) (-1112.548) * (-1110.425) (-1114.258) [-1111.220] (-1110.878) -- 0:00:21 Average standard deviation of split frequencies: 0.011682 685500 -- [-1111.576] (-1111.837) (-1111.628) (-1112.942) * (-1109.996) [-1111.994] (-1112.278) (-1111.051) -- 0:00:21 686000 -- (-1115.760) (-1111.830) [-1110.377] (-1115.360) * (-1110.717) (-1112.166) (-1110.919) [-1110.705] -- 0:00:21 686500 -- [-1111.212] (-1111.124) (-1116.472) (-1114.002) * (-1112.226) (-1113.523) [-1110.123] (-1112.118) -- 0:00:21 687000 -- (-1113.021) (-1111.147) (-1116.370) [-1113.502] * (-1113.814) [-1111.201] (-1113.003) (-1111.675) -- 0:00:20 687500 -- [-1110.998] (-1110.527) (-1115.767) (-1111.292) * (-1110.740) (-1110.238) (-1114.626) [-1113.706] -- 0:00:20 688000 -- (-1109.409) [-1113.796] (-1114.864) (-1111.624) * (-1113.501) [-1110.291] (-1110.660) (-1113.693) -- 0:00:20 688500 -- (-1114.657) (-1112.347) [-1109.693] (-1111.102) * (-1110.787) [-1114.386] (-1115.171) (-1114.430) -- 0:00:20 689000 -- (-1111.139) [-1110.747] (-1111.006) (-1111.653) * [-1111.917] (-1114.098) (-1116.902) (-1113.086) -- 0:00:20 689500 -- (-1112.451) (-1112.429) [-1111.178] (-1111.591) * (-1115.728) (-1113.936) [-1111.371] (-1117.276) -- 0:00:20 690000 -- (-1112.849) (-1110.884) [-1110.168] (-1116.905) * (-1109.843) (-1112.237) (-1111.102) [-1112.358] -- 0:00:20 Average standard deviation of split frequencies: 0.011483 690500 -- (-1110.778) (-1109.832) [-1110.562] (-1113.040) * [-1111.246] (-1112.532) (-1112.090) (-1111.659) -- 0:00:20 691000 -- (-1111.331) (-1109.958) [-1112.438] (-1111.174) * (-1112.070) [-1111.252] (-1112.790) (-1111.128) -- 0:00:20 691500 -- (-1112.954) (-1114.881) (-1114.684) [-1110.261] * (-1113.746) [-1111.256] (-1112.668) (-1112.317) -- 0:00:20 692000 -- (-1112.300) (-1110.229) (-1110.885) [-1111.547] * (-1110.350) [-1112.475] (-1111.996) (-1111.889) -- 0:00:20 692500 -- (-1112.126) (-1112.270) [-1112.053] (-1110.243) * (-1110.170) (-1110.539) [-1116.039] (-1114.293) -- 0:00:20 693000 -- (-1112.255) (-1111.386) (-1115.072) [-1110.628] * (-1110.051) [-1111.045] (-1113.087) (-1113.797) -- 0:00:20 693500 -- [-1110.690] (-1110.384) (-1112.898) (-1112.385) * (-1112.349) [-1109.909] (-1112.475) (-1112.248) -- 0:00:20 694000 -- [-1111.981] (-1111.020) (-1110.642) (-1111.395) * (-1112.255) (-1113.379) [-1111.198] (-1116.004) -- 0:00:20 694500 -- (-1114.950) (-1110.908) [-1110.252] (-1110.031) * (-1110.848) (-1111.315) [-1110.733] (-1113.434) -- 0:00:20 695000 -- (-1115.130) (-1109.843) (-1110.135) [-1110.355] * (-1110.478) [-1110.973] (-1114.097) (-1114.678) -- 0:00:20 Average standard deviation of split frequencies: 0.011355 695500 -- (-1112.420) [-1111.962] (-1110.736) (-1112.590) * (-1110.636) (-1113.936) (-1117.329) [-1111.140] -- 0:00:20 696000 -- [-1110.444] (-1112.030) (-1114.221) (-1109.769) * (-1110.634) (-1110.158) [-1113.376] (-1111.786) -- 0:00:20 696500 -- (-1110.868) (-1112.765) (-1115.106) [-1111.163] * (-1113.122) (-1110.720) [-1111.584] (-1111.153) -- 0:00:20 697000 -- (-1110.430) [-1111.525] (-1113.885) (-1112.112) * (-1111.450) (-1117.001) [-1112.766] (-1113.686) -- 0:00:20 697500 -- [-1110.502] (-1112.381) (-1111.566) (-1111.026) * (-1111.221) (-1113.429) [-1111.347] (-1111.165) -- 0:00:20 698000 -- (-1110.214) (-1110.148) [-1109.895] (-1109.702) * (-1112.771) (-1109.561) [-1112.418] (-1110.373) -- 0:00:20 698500 -- [-1111.014] (-1110.339) (-1110.914) (-1114.112) * (-1117.442) (-1110.343) (-1109.670) [-1110.198] -- 0:00:20 699000 -- (-1110.609) [-1110.792] (-1113.401) (-1110.983) * (-1112.664) [-1112.625] (-1110.205) (-1113.680) -- 0:00:20 699500 -- (-1112.137) [-1110.345] (-1109.837) (-1110.290) * (-1113.214) (-1114.087) [-1111.038] (-1109.793) -- 0:00:20 700000 -- (-1112.116) (-1112.597) [-1110.351] (-1109.805) * (-1115.254) (-1112.239) [-1112.461] (-1111.811) -- 0:00:20 Average standard deviation of split frequencies: 0.011240 700500 -- [-1112.303] (-1111.773) (-1109.681) (-1109.668) * (-1112.504) (-1116.118) [-1111.759] (-1117.642) -- 0:00:20 701000 -- [-1110.824] (-1111.737) (-1110.608) (-1112.032) * (-1111.110) (-1113.521) (-1115.460) [-1113.408] -- 0:00:20 701500 -- [-1112.158] (-1111.196) (-1110.089) (-1110.524) * (-1110.823) (-1110.672) [-1112.565] (-1116.486) -- 0:00:19 702000 -- (-1112.371) (-1112.186) [-1110.675] (-1112.058) * [-1111.069] (-1111.951) (-1113.352) (-1114.107) -- 0:00:19 702500 -- (-1112.181) (-1110.615) [-1109.859] (-1112.305) * (-1111.190) [-1110.629] (-1112.697) (-1113.455) -- 0:00:19 703000 -- (-1112.416) (-1110.375) [-1110.686] (-1111.640) * (-1109.738) [-1111.230] (-1112.697) (-1110.699) -- 0:00:19 703500 -- (-1113.048) (-1112.257) (-1112.342) [-1109.812] * (-1111.502) (-1110.725) (-1123.126) [-1112.899] -- 0:00:19 704000 -- [-1111.302] (-1110.308) (-1113.060) (-1113.493) * (-1109.641) (-1109.828) [-1110.670] (-1110.076) -- 0:00:19 704500 -- [-1111.879] (-1111.516) (-1112.911) (-1111.253) * [-1111.951] (-1111.123) (-1114.091) (-1109.545) -- 0:00:19 705000 -- (-1111.840) [-1110.181] (-1113.387) (-1112.057) * (-1112.582) (-1111.704) [-1110.871] (-1111.770) -- 0:00:19 Average standard deviation of split frequencies: 0.010880 705500 -- (-1112.231) (-1111.329) (-1115.554) [-1112.893] * (-1111.916) (-1111.071) (-1112.427) [-1109.714] -- 0:00:19 706000 -- (-1113.214) (-1117.891) (-1111.704) [-1112.340] * (-1111.004) [-1111.195] (-1112.219) (-1111.205) -- 0:00:19 706500 -- (-1110.976) (-1110.258) [-1112.078] (-1112.448) * (-1112.555) [-1111.209] (-1110.953) (-1112.924) -- 0:00:19 707000 -- (-1112.941) [-1112.281] (-1114.845) (-1110.777) * (-1112.878) (-1111.463) (-1109.549) [-1110.841] -- 0:00:19 707500 -- [-1112.398] (-1113.389) (-1110.985) (-1111.065) * (-1110.192) (-1112.459) (-1113.153) [-1111.145] -- 0:00:19 708000 -- (-1113.224) (-1117.727) (-1109.763) [-1110.795] * (-1110.483) (-1111.084) [-1111.690] (-1110.481) -- 0:00:19 708500 -- (-1113.070) [-1113.714] (-1109.950) (-1112.182) * (-1111.644) (-1110.724) (-1111.224) [-1112.399] -- 0:00:19 709000 -- [-1114.972] (-1115.775) (-1109.669) (-1112.925) * (-1110.761) [-1111.370] (-1111.199) (-1110.345) -- 0:00:19 709500 -- (-1115.175) (-1112.381) (-1109.552) [-1110.739] * (-1113.551) (-1110.819) [-1114.310] (-1109.355) -- 0:00:19 710000 -- (-1114.040) [-1110.433] (-1113.262) (-1110.848) * [-1110.607] (-1110.648) (-1112.420) (-1113.554) -- 0:00:19 Average standard deviation of split frequencies: 0.011003 710500 -- (-1113.578) [-1110.948] (-1114.842) (-1112.136) * (-1109.964) (-1109.795) (-1113.265) [-1112.717] -- 0:00:19 711000 -- (-1112.403) (-1110.179) (-1112.735) [-1110.698] * (-1110.425) (-1109.711) (-1112.587) [-1114.764] -- 0:00:19 711500 -- (-1113.385) (-1110.275) [-1111.410] (-1109.901) * (-1110.838) (-1111.364) (-1109.908) [-1111.505] -- 0:00:19 712000 -- (-1111.318) (-1110.947) [-1110.928] (-1111.480) * (-1112.094) [-1113.927] (-1110.075) (-1110.044) -- 0:00:19 712500 -- (-1112.359) (-1112.637) [-1111.598] (-1110.829) * (-1110.030) [-1109.689] (-1113.022) (-1120.139) -- 0:00:19 713000 -- (-1113.279) (-1113.280) [-1111.799] (-1111.430) * [-1110.650] (-1112.053) (-1114.310) (-1125.143) -- 0:00:19 713500 -- (-1110.454) [-1112.596] (-1112.272) (-1112.406) * (-1110.152) (-1113.617) (-1116.961) [-1111.947] -- 0:00:19 714000 -- (-1113.605) (-1113.515) (-1115.418) [-1110.876] * [-1111.794] (-1111.398) (-1112.048) (-1116.945) -- 0:00:19 714500 -- (-1116.298) (-1113.489) (-1115.102) [-1112.169] * (-1111.702) [-1111.310] (-1110.826) (-1112.638) -- 0:00:19 715000 -- (-1110.910) (-1118.677) (-1113.539) [-1112.016] * [-1111.842] (-1110.528) (-1115.374) (-1112.771) -- 0:00:19 Average standard deviation of split frequencies: 0.011231 715500 -- (-1110.821) (-1116.264) [-1112.594] (-1111.207) * (-1113.858) (-1111.378) (-1111.421) [-1111.795] -- 0:00:19 716000 -- (-1113.244) (-1113.901) (-1112.334) [-1113.111] * (-1110.859) [-1110.078] (-1112.748) (-1114.521) -- 0:00:19 716500 -- (-1114.023) (-1111.736) [-1110.446] (-1114.483) * (-1110.437) (-1111.664) [-1111.980] (-1112.822) -- 0:00:18 717000 -- (-1119.199) (-1111.523) [-1114.240] (-1119.485) * (-1112.509) (-1113.169) [-1111.598] (-1112.044) -- 0:00:18 717500 -- (-1111.420) (-1110.084) [-1110.085] (-1116.220) * (-1109.998) (-1110.504) (-1111.548) [-1114.293] -- 0:00:18 718000 -- [-1109.580] (-1113.691) (-1110.063) (-1115.512) * [-1109.650] (-1113.484) (-1111.338) (-1111.921) -- 0:00:18 718500 -- (-1111.042) [-1111.953] (-1110.874) (-1114.162) * (-1109.765) (-1113.097) [-1114.123] (-1111.577) -- 0:00:18 719000 -- [-1110.414] (-1113.523) (-1110.614) (-1110.297) * (-1109.742) (-1110.125) (-1109.899) [-1110.121] -- 0:00:18 719500 -- (-1111.464) (-1111.063) (-1112.839) [-1111.415] * (-1112.805) (-1109.682) (-1112.739) [-1110.893] -- 0:00:18 720000 -- (-1111.282) [-1111.767] (-1111.496) (-1110.520) * (-1113.137) [-1110.093] (-1111.631) (-1112.983) -- 0:00:18 Average standard deviation of split frequencies: 0.011005 720500 -- [-1110.836] (-1115.163) (-1113.200) (-1111.786) * (-1111.786) (-1111.547) [-1111.886] (-1114.017) -- 0:00:18 721000 -- [-1110.370] (-1113.504) (-1111.566) (-1111.572) * (-1110.623) [-1111.640] (-1109.997) (-1112.303) -- 0:00:18 721500 -- [-1112.061] (-1111.192) (-1113.685) (-1113.064) * (-1110.763) (-1111.409) [-1111.757] (-1110.391) -- 0:00:18 722000 -- (-1115.607) (-1110.793) [-1115.468] (-1116.772) * (-1112.094) (-1110.159) [-1111.436] (-1112.016) -- 0:00:18 722500 -- (-1110.777) (-1111.356) [-1111.608] (-1112.526) * (-1115.358) (-1112.540) (-1118.044) [-1113.150] -- 0:00:18 723000 -- [-1114.502] (-1114.138) (-1112.970) (-1111.538) * [-1115.783] (-1111.047) (-1114.886) (-1110.784) -- 0:00:18 723500 -- [-1114.540] (-1110.525) (-1111.824) (-1111.344) * [-1112.474] (-1110.706) (-1112.375) (-1116.717) -- 0:00:18 724000 -- (-1112.154) [-1112.533] (-1113.597) (-1112.488) * (-1112.260) [-1110.459] (-1111.169) (-1114.687) -- 0:00:18 724500 -- (-1111.752) (-1113.393) [-1110.923] (-1113.241) * (-1112.227) (-1112.414) (-1110.948) [-1113.003] -- 0:00:18 725000 -- (-1111.260) (-1113.341) (-1110.279) [-1110.263] * (-1118.926) [-1112.561] (-1113.088) (-1112.251) -- 0:00:18 Average standard deviation of split frequencies: 0.010886 725500 -- (-1111.642) [-1110.458] (-1114.941) (-1110.852) * [-1112.606] (-1112.321) (-1111.807) (-1112.819) -- 0:00:18 726000 -- [-1109.610] (-1111.681) (-1111.481) (-1110.945) * [-1113.576] (-1111.896) (-1110.342) (-1114.061) -- 0:00:18 726500 -- (-1110.046) (-1112.465) [-1110.810] (-1110.761) * [-1112.768] (-1110.163) (-1111.220) (-1112.654) -- 0:00:18 727000 -- [-1110.512] (-1113.716) (-1115.629) (-1112.715) * (-1110.141) (-1110.478) [-1110.864] (-1113.221) -- 0:00:18 727500 -- (-1112.733) (-1111.542) (-1113.481) [-1111.004] * (-1112.083) (-1113.259) [-1110.780] (-1111.682) -- 0:00:18 728000 -- (-1111.701) (-1112.884) (-1111.633) [-1114.073] * [-1113.912] (-1110.186) (-1110.128) (-1111.767) -- 0:00:18 728500 -- (-1112.685) [-1113.900] (-1115.984) (-1114.018) * (-1112.997) [-1109.404] (-1110.124) (-1111.987) -- 0:00:18 729000 -- [-1112.821] (-1111.791) (-1113.333) (-1111.587) * (-1112.152) (-1109.882) [-1110.817] (-1110.353) -- 0:00:18 729500 -- (-1111.783) (-1110.280) (-1113.232) [-1112.548] * [-1111.154] (-1111.072) (-1110.196) (-1110.665) -- 0:00:18 730000 -- [-1111.272] (-1110.489) (-1111.535) (-1114.411) * [-1111.508] (-1109.943) (-1110.942) (-1109.883) -- 0:00:18 Average standard deviation of split frequencies: 0.010444 730500 -- [-1112.425] (-1119.369) (-1111.665) (-1111.585) * (-1110.713) (-1110.649) (-1112.016) [-1110.330] -- 0:00:18 731000 -- [-1110.049] (-1109.501) (-1110.065) (-1115.668) * [-1109.991] (-1113.196) (-1112.185) (-1112.318) -- 0:00:18 731500 -- (-1110.917) (-1112.764) (-1114.332) [-1111.755] * (-1111.364) (-1112.156) [-1111.906] (-1112.885) -- 0:00:17 732000 -- (-1115.307) (-1110.201) (-1110.252) [-1114.445] * (-1111.425) (-1111.247) [-1111.825] (-1111.513) -- 0:00:17 732500 -- [-1111.486] (-1113.583) (-1113.313) (-1112.356) * (-1111.062) (-1112.401) [-1112.400] (-1110.571) -- 0:00:17 733000 -- [-1112.881] (-1111.188) (-1115.280) (-1111.633) * [-1113.492] (-1113.102) (-1112.867) (-1112.067) -- 0:00:17 733500 -- (-1110.603) [-1110.668] (-1113.222) (-1118.772) * [-1111.971] (-1113.070) (-1112.182) (-1112.346) -- 0:00:17 734000 -- [-1110.172] (-1113.086) (-1109.608) (-1111.451) * [-1111.456] (-1111.483) (-1113.722) (-1111.532) -- 0:00:17 734500 -- (-1114.035) (-1112.526) [-1110.594] (-1115.830) * (-1109.740) (-1113.489) (-1110.405) [-1114.782] -- 0:00:17 735000 -- (-1115.403) [-1110.973] (-1110.289) (-1112.678) * (-1112.976) (-1113.976) [-1110.082] (-1112.422) -- 0:00:17 Average standard deviation of split frequencies: 0.009821 735500 -- (-1111.558) (-1109.880) (-1112.800) [-1111.698] * (-1111.537) (-1111.024) (-1110.123) [-1112.570] -- 0:00:17 736000 -- (-1114.729) (-1110.997) (-1113.288) [-1111.052] * [-1112.332] (-1112.358) (-1109.930) (-1111.382) -- 0:00:17 736500 -- (-1115.205) (-1113.948) [-1110.657] (-1111.967) * (-1112.416) [-1110.147] (-1109.904) (-1113.576) -- 0:00:17 737000 -- (-1113.670) [-1111.321] (-1112.813) (-1110.612) * (-1113.056) (-1111.399) [-1109.817] (-1112.632) -- 0:00:17 737500 -- [-1112.833] (-1112.224) (-1111.431) (-1113.417) * (-1114.837) (-1112.516) (-1109.816) [-1112.880] -- 0:00:17 738000 -- (-1111.745) (-1114.019) [-1116.203] (-1110.878) * (-1111.739) (-1113.437) [-1110.168] (-1109.950) -- 0:00:17 738500 -- (-1111.020) (-1110.288) (-1111.823) [-1110.515] * (-1111.765) (-1110.297) [-1111.578] (-1110.166) -- 0:00:17 739000 -- (-1112.599) (-1111.838) (-1113.302) [-1111.307] * (-1113.707) (-1109.834) (-1112.025) [-1115.326] -- 0:00:17 739500 -- (-1111.143) (-1111.711) [-1111.192] (-1112.963) * (-1111.339) (-1111.405) [-1110.591] (-1115.933) -- 0:00:17 740000 -- (-1110.241) (-1111.682) [-1112.210] (-1116.512) * (-1113.202) (-1109.744) (-1110.376) [-1111.629] -- 0:00:17 Average standard deviation of split frequencies: 0.010325 740500 -- (-1110.037) (-1111.637) [-1111.301] (-1116.672) * (-1110.913) (-1110.777) (-1112.891) [-1111.436] -- 0:00:17 741000 -- [-1111.050] (-1111.462) (-1113.128) (-1112.944) * [-1111.883] (-1110.281) (-1113.215) (-1114.237) -- 0:00:17 741500 -- (-1112.152) (-1113.019) [-1112.196] (-1116.560) * [-1110.758] (-1112.496) (-1111.930) (-1116.206) -- 0:00:17 742000 -- (-1111.464) (-1116.238) [-1109.598] (-1111.686) * (-1110.559) (-1113.334) (-1111.420) [-1117.305] -- 0:00:17 742500 -- (-1110.806) (-1125.936) [-1110.240] (-1111.053) * (-1113.921) (-1113.843) (-1113.090) [-1111.305] -- 0:00:17 743000 -- (-1111.615) (-1113.363) [-1112.694] (-1112.502) * (-1113.707) [-1112.508] (-1111.242) (-1112.595) -- 0:00:17 743500 -- (-1111.815) (-1112.162) [-1111.095] (-1112.221) * (-1111.592) (-1110.579) (-1112.240) [-1110.187] -- 0:00:17 744000 -- (-1111.692) (-1118.085) [-1110.264] (-1110.426) * (-1111.102) (-1110.758) (-1110.230) [-1112.784] -- 0:00:17 744500 -- (-1112.286) (-1111.947) [-1110.236] (-1111.811) * (-1109.995) (-1110.669) [-1112.935] (-1111.939) -- 0:00:17 745000 -- [-1111.275] (-1110.200) (-1113.513) (-1111.856) * [-1110.933] (-1112.865) (-1111.252) (-1110.637) -- 0:00:17 Average standard deviation of split frequencies: 0.009865 745500 -- (-1110.160) (-1111.571) (-1110.687) [-1110.185] * (-1112.578) (-1113.213) [-1114.613] (-1110.669) -- 0:00:17 746000 -- [-1113.078] (-1112.101) (-1110.550) (-1109.629) * (-1109.981) (-1114.610) (-1113.150) [-1117.087] -- 0:00:17 746500 -- (-1112.229) (-1109.950) (-1114.230) [-1110.489] * [-1112.733] (-1117.255) (-1112.518) (-1113.521) -- 0:00:16 747000 -- (-1111.276) (-1109.554) (-1111.813) [-1110.867] * [-1112.289] (-1115.738) (-1110.413) (-1112.409) -- 0:00:16 747500 -- (-1111.976) (-1110.794) [-1113.182] (-1112.922) * [-1113.036] (-1111.402) (-1112.318) (-1109.909) -- 0:00:16 748000 -- (-1112.521) (-1110.723) [-1114.185] (-1111.832) * (-1110.339) [-1110.879] (-1110.087) (-1113.027) -- 0:00:16 748500 -- (-1112.781) (-1110.835) [-1110.507] (-1116.050) * [-1112.564] (-1113.618) (-1115.786) (-1117.276) -- 0:00:16 749000 -- [-1114.923] (-1110.711) (-1109.967) (-1111.591) * (-1111.084) (-1111.869) [-1112.942] (-1111.668) -- 0:00:16 749500 -- (-1112.389) [-1113.917] (-1110.328) (-1110.017) * (-1117.960) (-1110.334) [-1112.510] (-1110.393) -- 0:00:16 750000 -- [-1114.570] (-1111.160) (-1112.583) (-1112.946) * [-1117.618] (-1110.400) (-1113.880) (-1113.276) -- 0:00:16 Average standard deviation of split frequencies: 0.009769 750500 -- (-1115.588) (-1112.896) (-1112.293) [-1113.148] * [-1111.436] (-1112.279) (-1112.118) (-1112.612) -- 0:00:16 751000 -- (-1116.001) (-1120.483) [-1110.054] (-1111.251) * (-1114.580) [-1113.600] (-1113.220) (-1111.135) -- 0:00:16 751500 -- [-1114.957] (-1117.291) (-1109.702) (-1115.030) * (-1112.415) (-1111.155) [-1111.818] (-1111.471) -- 0:00:16 752000 -- (-1112.464) [-1112.293] (-1109.859) (-1113.044) * (-1111.465) (-1111.411) (-1113.740) [-1111.009] -- 0:00:16 752500 -- (-1110.445) (-1112.930) (-1111.696) [-1111.496] * [-1113.596] (-1114.519) (-1113.498) (-1111.681) -- 0:00:16 753000 -- (-1112.680) [-1111.052] (-1111.534) (-1112.479) * [-1116.104] (-1113.404) (-1116.170) (-1116.741) -- 0:00:16 753500 -- [-1112.692] (-1110.060) (-1111.311) (-1112.711) * (-1114.864) [-1111.945] (-1111.893) (-1118.286) -- 0:00:16 754000 -- (-1111.745) [-1110.467] (-1111.159) (-1114.432) * (-1112.873) (-1114.078) (-1111.068) [-1111.392] -- 0:00:16 754500 -- (-1111.381) (-1113.135) [-1114.651] (-1114.354) * (-1116.857) [-1111.541] (-1109.996) (-1110.636) -- 0:00:16 755000 -- [-1113.729] (-1111.841) (-1113.100) (-1114.861) * (-1112.187) (-1113.212) (-1109.908) [-1112.112] -- 0:00:16 Average standard deviation of split frequencies: 0.009804 755500 -- (-1113.475) (-1113.379) (-1111.136) [-1110.745] * (-1112.702) (-1111.604) [-1111.492] (-1113.830) -- 0:00:16 756000 -- (-1116.544) (-1116.363) [-1110.596] (-1111.444) * (-1111.742) [-1113.045] (-1113.107) (-1112.191) -- 0:00:16 756500 -- [-1115.428] (-1111.775) (-1111.886) (-1115.616) * (-1111.701) (-1112.103) (-1111.656) [-1111.610] -- 0:00:16 757000 -- [-1111.921] (-1110.701) (-1109.868) (-1112.058) * (-1110.482) (-1114.595) [-1113.542] (-1112.348) -- 0:00:16 757500 -- (-1117.253) (-1111.247) (-1112.274) [-1111.974] * (-1112.077) (-1111.709) (-1112.214) [-1109.981] -- 0:00:16 758000 -- [-1113.696] (-1113.030) (-1112.359) (-1111.553) * [-1112.534] (-1111.396) (-1111.200) (-1110.316) -- 0:00:16 758500 -- (-1116.526) (-1111.542) (-1110.951) [-1110.966] * (-1109.928) (-1125.248) (-1116.479) [-1111.197] -- 0:00:16 759000 -- [-1112.857] (-1113.565) (-1112.770) (-1110.981) * (-1111.521) [-1117.738] (-1115.294) (-1110.640) -- 0:00:16 759500 -- (-1111.450) [-1111.882] (-1111.519) (-1115.049) * (-1113.745) (-1112.075) [-1111.776] (-1110.664) -- 0:00:16 760000 -- (-1112.379) (-1110.878) (-1111.952) [-1115.067] * (-1110.306) [-1112.541] (-1115.121) (-1111.192) -- 0:00:16 Average standard deviation of split frequencies: 0.009843 760500 -- (-1114.516) (-1113.889) [-1110.006] (-1112.828) * (-1114.640) (-1113.049) (-1112.081) [-1112.354] -- 0:00:16 761000 -- (-1111.226) (-1110.674) [-1111.619] (-1113.078) * (-1112.059) (-1114.054) [-1111.161] (-1112.061) -- 0:00:16 761500 -- (-1110.808) (-1111.788) (-1111.508) [-1112.359] * (-1114.988) [-1111.970] (-1113.371) (-1111.277) -- 0:00:15 762000 -- (-1112.550) [-1113.475] (-1110.005) (-1110.679) * (-1113.150) (-1112.629) (-1111.307) [-1109.627] -- 0:00:15 762500 -- [-1109.606] (-1111.375) (-1114.556) (-1113.178) * (-1111.879) [-1112.576] (-1109.632) (-1111.869) -- 0:00:15 763000 -- (-1111.330) [-1112.506] (-1110.969) (-1112.480) * [-1110.703] (-1112.734) (-1110.850) (-1112.678) -- 0:00:15 763500 -- (-1111.638) (-1111.703) (-1110.087) [-1110.859] * [-1110.268] (-1110.004) (-1117.568) (-1111.831) -- 0:00:15 764000 -- [-1109.977] (-1111.494) (-1110.723) (-1114.638) * [-1110.353] (-1115.247) (-1110.786) (-1113.515) -- 0:00:15 764500 -- (-1112.426) (-1118.468) [-1112.288] (-1110.777) * (-1112.452) [-1111.159] (-1111.315) (-1112.622) -- 0:00:15 765000 -- (-1123.690) (-1110.761) (-1111.461) [-1114.279] * (-1112.631) (-1110.679) (-1114.174) [-1112.700] -- 0:00:15 Average standard deviation of split frequencies: 0.009300 765500 -- [-1117.044] (-1111.399) (-1112.306) (-1110.178) * (-1111.902) (-1113.048) (-1109.941) [-1110.157] -- 0:00:15 766000 -- (-1112.157) (-1111.712) (-1113.349) [-1111.090] * (-1111.979) (-1111.730) (-1110.496) [-1110.997] -- 0:00:15 766500 -- [-1112.462] (-1112.036) (-1115.274) (-1112.066) * (-1112.108) (-1111.051) [-1111.851] (-1114.014) -- 0:00:15 767000 -- [-1110.315] (-1113.746) (-1112.974) (-1110.769) * (-1111.399) (-1112.540) (-1112.459) [-1112.733] -- 0:00:15 767500 -- (-1109.319) (-1113.082) [-1113.145] (-1112.955) * (-1111.282) [-1111.382] (-1109.772) (-1110.484) -- 0:00:15 768000 -- (-1113.621) (-1111.596) [-1112.133] (-1112.589) * (-1115.226) (-1110.312) [-1113.012] (-1110.759) -- 0:00:15 768500 -- (-1110.340) (-1112.396) [-1109.957] (-1112.648) * (-1114.554) (-1113.629) [-1115.222] (-1110.704) -- 0:00:15 769000 -- (-1112.298) (-1114.339) (-1109.906) [-1113.793] * (-1112.079) (-1114.376) [-1111.976] (-1113.965) -- 0:00:15 769500 -- (-1110.201) [-1111.680] (-1111.531) (-1111.414) * (-1110.453) (-1111.574) [-1114.235] (-1110.502) -- 0:00:15 770000 -- (-1113.286) (-1119.245) (-1110.834) [-1111.235] * (-1112.008) (-1112.599) [-1112.110] (-1110.411) -- 0:00:15 Average standard deviation of split frequencies: 0.008801 770500 -- (-1112.349) (-1111.812) [-1110.672] (-1114.618) * (-1113.042) (-1112.278) [-1110.970] (-1112.802) -- 0:00:15 771000 -- [-1112.512] (-1111.165) (-1113.511) (-1117.359) * [-1112.112] (-1110.697) (-1112.071) (-1112.075) -- 0:00:15 771500 -- (-1111.812) (-1112.871) [-1113.002] (-1110.253) * (-1113.767) (-1110.662) [-1113.200] (-1110.173) -- 0:00:15 772000 -- (-1110.962) [-1112.421] (-1115.788) (-1109.797) * (-1113.338) (-1110.935) [-1110.674] (-1114.199) -- 0:00:15 772500 -- (-1110.699) (-1111.358) (-1113.359) [-1110.150] * [-1111.249] (-1111.272) (-1112.622) (-1109.813) -- 0:00:15 773000 -- (-1109.843) (-1113.296) (-1111.871) [-1111.624] * (-1110.690) [-1111.468] (-1114.581) (-1110.403) -- 0:00:15 773500 -- (-1109.714) (-1112.794) (-1113.448) [-1115.763] * (-1110.492) (-1110.498) [-1111.930] (-1110.714) -- 0:00:15 774000 -- (-1111.308) (-1111.033) [-1110.113] (-1115.635) * (-1112.788) (-1110.342) [-1110.745] (-1115.538) -- 0:00:15 774500 -- (-1114.955) (-1118.149) (-1111.099) [-1110.553] * (-1112.441) (-1117.331) [-1111.220] (-1110.730) -- 0:00:15 775000 -- (-1112.930) (-1113.839) (-1111.805) [-1109.978] * (-1114.838) (-1114.184) (-1111.077) [-1111.263] -- 0:00:15 Average standard deviation of split frequencies: 0.009348 775500 -- (-1113.279) (-1109.625) (-1110.958) [-1110.873] * (-1110.497) (-1114.612) [-1112.283] (-1110.121) -- 0:00:15 776000 -- (-1114.596) [-1109.471] (-1112.884) (-1111.819) * (-1111.958) (-1116.061) (-1111.073) [-1110.061] -- 0:00:15 776500 -- (-1115.906) (-1110.154) (-1111.299) [-1113.815] * (-1112.023) (-1114.375) [-1114.274] (-1114.029) -- 0:00:14 777000 -- (-1114.188) (-1114.376) (-1112.580) [-1112.938] * [-1110.214] (-1113.567) (-1111.501) (-1109.653) -- 0:00:14 777500 -- (-1111.028) (-1109.935) [-1114.766] (-1111.531) * (-1111.428) (-1114.722) [-1111.910] (-1111.476) -- 0:00:14 778000 -- (-1116.082) (-1109.893) [-1109.733] (-1113.114) * [-1113.142] (-1111.717) (-1115.300) (-1111.630) -- 0:00:14 778500 -- [-1111.536] (-1112.867) (-1110.719) (-1113.438) * (-1112.418) (-1111.542) [-1109.467] (-1110.301) -- 0:00:14 779000 -- (-1112.822) [-1113.302] (-1109.705) (-1112.668) * (-1109.712) (-1112.708) [-1111.736] (-1119.030) -- 0:00:14 779500 -- (-1113.010) (-1111.964) [-1112.400] (-1111.292) * [-1119.721] (-1113.046) (-1110.938) (-1114.639) -- 0:00:14 780000 -- (-1112.994) (-1110.943) [-1110.782] (-1114.935) * [-1113.245] (-1113.396) (-1115.336) (-1112.529) -- 0:00:14 Average standard deviation of split frequencies: 0.009125 780500 -- [-1111.249] (-1111.402) (-1112.963) (-1112.210) * (-1119.735) (-1116.258) [-1113.637] (-1115.261) -- 0:00:14 781000 -- (-1111.135) (-1109.576) (-1111.922) [-1112.915] * (-1115.148) (-1111.645) (-1110.725) [-1114.377] -- 0:00:14 781500 -- (-1112.948) [-1111.780] (-1115.058) (-1111.639) * (-1111.893) (-1112.060) [-1110.730] (-1111.199) -- 0:00:14 782000 -- (-1114.754) (-1115.314) (-1117.499) [-1110.913] * (-1113.419) [-1110.671] (-1112.726) (-1112.094) -- 0:00:14 782500 -- (-1114.692) (-1115.483) (-1115.353) [-1111.084] * (-1110.017) (-1116.382) [-1111.749] (-1111.368) -- 0:00:14 783000 -- (-1113.237) [-1109.950] (-1113.672) (-1111.541) * (-1112.184) [-1110.374] (-1110.953) (-1111.469) -- 0:00:14 783500 -- (-1110.265) (-1113.612) [-1110.926] (-1110.012) * (-1111.043) (-1110.644) [-1110.003] (-1110.755) -- 0:00:14 784000 -- (-1112.096) (-1110.626) (-1110.647) [-1111.124] * [-1110.681] (-1110.537) (-1113.745) (-1115.298) -- 0:00:14 784500 -- (-1112.212) [-1110.967] (-1116.990) (-1109.654) * (-1112.767) (-1112.304) [-1113.662] (-1111.370) -- 0:00:14 785000 -- [-1113.608] (-1109.545) (-1112.133) (-1113.233) * (-1114.301) (-1112.150) [-1112.565] (-1110.323) -- 0:00:14 Average standard deviation of split frequencies: 0.008663 785500 -- (-1113.166) (-1112.671) [-1110.309] (-1113.390) * (-1114.918) [-1112.207] (-1111.013) (-1113.834) -- 0:00:14 786000 -- (-1111.845) [-1112.887] (-1111.211) (-1110.638) * (-1110.774) (-1112.672) (-1109.886) [-1111.675] -- 0:00:14 786500 -- [-1110.780] (-1111.867) (-1113.975) (-1112.551) * (-1110.481) [-1111.851] (-1111.885) (-1111.600) -- 0:00:14 787000 -- (-1112.257) (-1112.259) (-1114.127) [-1109.904] * (-1114.580) (-1110.585) (-1110.621) [-1111.446] -- 0:00:14 787500 -- [-1111.021] (-1113.340) (-1111.438) (-1109.670) * (-1110.311) (-1110.995) (-1110.600) [-1111.135] -- 0:00:14 788000 -- [-1111.366] (-1112.150) (-1109.967) (-1114.082) * [-1109.476] (-1110.173) (-1112.914) (-1112.165) -- 0:00:14 788500 -- (-1111.959) (-1110.853) [-1111.428] (-1110.733) * [-1109.547] (-1111.068) (-1111.611) (-1111.265) -- 0:00:14 789000 -- (-1113.238) (-1110.607) [-1112.561] (-1110.191) * [-1110.695] (-1111.810) (-1112.369) (-1111.791) -- 0:00:14 789500 -- (-1111.993) (-1110.589) [-1113.263] (-1111.462) * (-1111.921) (-1110.892) [-1109.936] (-1114.278) -- 0:00:14 790000 -- (-1112.640) (-1114.258) (-1115.299) [-1110.901] * (-1110.329) (-1114.925) (-1110.782) [-1111.235] -- 0:00:14 Average standard deviation of split frequencies: 0.008628 790500 -- (-1109.906) [-1110.854] (-1115.304) (-1112.519) * [-1111.553] (-1112.698) (-1113.518) (-1110.375) -- 0:00:14 791000 -- (-1110.143) (-1109.745) [-1113.247] (-1112.043) * (-1111.544) (-1112.376) (-1112.080) [-1110.906] -- 0:00:14 791500 -- (-1111.090) [-1112.141] (-1116.429) (-1111.076) * (-1111.178) (-1116.109) [-1110.381] (-1110.432) -- 0:00:13 792000 -- (-1111.636) [-1113.929] (-1111.562) (-1112.357) * (-1112.088) (-1111.776) (-1110.778) [-1110.986] -- 0:00:13 792500 -- (-1113.086) [-1113.718] (-1112.733) (-1111.568) * [-1110.602] (-1111.869) (-1112.233) (-1114.619) -- 0:00:13 793000 -- (-1112.415) [-1113.066] (-1114.471) (-1110.967) * (-1111.752) (-1111.146) (-1112.279) [-1110.359] -- 0:00:13 793500 -- [-1110.570] (-1114.181) (-1112.302) (-1110.721) * (-1114.471) (-1113.088) (-1110.776) [-1112.684] -- 0:00:13 794000 -- (-1113.414) [-1110.939] (-1112.158) (-1112.870) * (-1111.051) (-1112.028) (-1111.724) [-1111.634] -- 0:00:13 794500 -- (-1111.483) [-1110.282] (-1111.367) (-1112.062) * (-1111.087) [-1111.136] (-1112.575) (-1113.271) -- 0:00:13 795000 -- [-1110.811] (-1109.644) (-1113.560) (-1111.746) * [-1114.663] (-1110.734) (-1121.612) (-1112.313) -- 0:00:13 Average standard deviation of split frequencies: 0.008709 795500 -- (-1110.341) (-1113.134) [-1111.675] (-1111.114) * (-1110.578) [-1110.187] (-1118.560) (-1111.853) -- 0:00:13 796000 -- (-1111.975) (-1113.307) (-1111.830) [-1113.554] * (-1111.626) (-1111.774) [-1110.990] (-1112.499) -- 0:00:13 796500 -- (-1113.844) (-1112.609) [-1111.470] (-1114.109) * (-1110.907) [-1111.439] (-1110.725) (-1119.313) -- 0:00:13 797000 -- [-1109.537] (-1110.110) (-1111.898) (-1113.037) * (-1112.885) [-1115.522] (-1112.195) (-1110.966) -- 0:00:13 797500 -- (-1110.853) (-1111.460) [-1111.036] (-1112.071) * [-1112.214] (-1112.582) (-1112.708) (-1109.911) -- 0:00:13 798000 -- (-1110.322) (-1111.389) [-1111.716] (-1113.911) * [-1111.404] (-1112.343) (-1110.918) (-1111.752) -- 0:00:13 798500 -- (-1109.849) (-1110.977) [-1110.129] (-1110.414) * (-1111.573) [-1110.119] (-1113.344) (-1109.598) -- 0:00:13 799000 -- [-1110.385] (-1111.059) (-1110.536) (-1113.854) * (-1111.211) (-1111.487) (-1113.866) [-1112.884] -- 0:00:13 799500 -- (-1113.135) [-1110.764] (-1111.263) (-1111.154) * (-1111.821) (-1115.009) (-1114.627) [-1110.283] -- 0:00:13 800000 -- (-1110.077) (-1112.128) [-1112.242] (-1111.442) * (-1110.445) (-1111.551) (-1114.085) [-1113.975] -- 0:00:13 Average standard deviation of split frequencies: 0.008658 800500 -- (-1113.724) [-1111.984] (-1111.965) (-1110.244) * (-1110.929) (-1114.100) [-1111.654] (-1112.972) -- 0:00:13 801000 -- [-1114.264] (-1111.363) (-1112.057) (-1112.395) * (-1110.480) [-1112.344] (-1112.207) (-1114.833) -- 0:00:13 801500 -- (-1111.081) (-1112.198) [-1115.817] (-1111.087) * (-1113.362) (-1110.487) [-1111.602] (-1113.175) -- 0:00:13 802000 -- (-1109.982) (-1113.078) [-1111.887] (-1112.592) * [-1111.266] (-1111.578) (-1113.482) (-1114.803) -- 0:00:13 802500 -- [-1110.110] (-1112.657) (-1113.222) (-1111.537) * [-1111.289] (-1113.504) (-1113.046) (-1113.608) -- 0:00:13 803000 -- (-1117.093) [-1112.264] (-1113.920) (-1114.341) * (-1111.065) (-1114.838) (-1115.694) [-1111.102] -- 0:00:13 803500 -- (-1113.677) (-1111.505) (-1110.541) [-1110.525] * [-1110.635] (-1113.516) (-1113.494) (-1110.390) -- 0:00:13 804000 -- (-1113.867) (-1111.701) (-1112.169) [-1110.588] * (-1111.482) [-1111.182] (-1109.952) (-1112.152) -- 0:00:13 804500 -- (-1111.537) (-1112.766) (-1110.455) [-1112.822] * (-1112.278) (-1111.543) (-1111.619) [-1109.544] -- 0:00:13 805000 -- [-1114.045] (-1111.200) (-1113.340) (-1113.690) * (-1111.454) [-1109.954] (-1110.435) (-1113.607) -- 0:00:13 Average standard deviation of split frequencies: 0.008911 805500 -- [-1114.505] (-1109.658) (-1111.870) (-1113.879) * (-1111.426) (-1109.954) [-1111.202] (-1112.311) -- 0:00:13 806000 -- [-1110.505] (-1114.867) (-1115.903) (-1109.503) * [-1111.566] (-1114.116) (-1110.455) (-1111.440) -- 0:00:12 806500 -- (-1111.549) (-1111.295) [-1113.600] (-1109.670) * (-1112.418) (-1113.434) [-1110.112] (-1114.431) -- 0:00:12 807000 -- (-1112.207) [-1110.511] (-1112.561) (-1109.778) * (-1112.584) (-1117.877) [-1111.064] (-1114.014) -- 0:00:12 807500 -- (-1115.382) [-1111.248] (-1112.620) (-1110.729) * (-1112.248) [-1110.146] (-1111.138) (-1112.307) -- 0:00:12 808000 -- (-1116.310) (-1110.550) [-1112.788] (-1110.878) * [-1111.863] (-1111.656) (-1112.527) (-1116.575) -- 0:00:12 808500 -- (-1111.690) (-1112.895) [-1111.450] (-1112.622) * [-1111.035] (-1114.445) (-1115.402) (-1111.227) -- 0:00:12 809000 -- [-1110.395] (-1116.497) (-1113.892) (-1112.986) * [-1111.126] (-1110.679) (-1115.583) (-1110.186) -- 0:00:12 809500 -- (-1112.970) (-1111.870) (-1113.665) [-1111.466] * (-1111.492) (-1111.195) (-1111.060) [-1110.562] -- 0:00:12 810000 -- (-1111.035) [-1113.293] (-1112.154) (-1111.428) * [-1110.911] (-1113.697) (-1113.033) (-1111.386) -- 0:00:12 Average standard deviation of split frequencies: 0.008688 810500 -- (-1112.337) (-1109.881) [-1109.927] (-1115.337) * (-1110.840) (-1111.425) [-1112.850] (-1110.637) -- 0:00:12 811000 -- (-1111.855) [-1110.716] (-1111.718) (-1112.240) * (-1112.644) (-1112.385) [-1111.625] (-1110.010) -- 0:00:12 811500 -- [-1111.638] (-1113.702) (-1110.599) (-1122.454) * (-1110.099) (-1111.037) [-1110.523] (-1111.055) -- 0:00:12 812000 -- (-1111.955) (-1115.258) (-1110.696) [-1114.558] * (-1112.056) (-1116.051) [-1111.202] (-1110.888) -- 0:00:12 812500 -- [-1110.290] (-1110.208) (-1110.184) (-1112.689) * (-1113.943) (-1113.159) [-1111.815] (-1110.006) -- 0:00:12 813000 -- [-1111.936] (-1109.883) (-1113.199) (-1113.977) * [-1112.013] (-1112.215) (-1112.982) (-1109.896) -- 0:00:12 813500 -- (-1111.599) (-1110.729) [-1112.301] (-1110.695) * [-1111.340] (-1112.328) (-1113.442) (-1112.183) -- 0:00:12 814000 -- [-1111.635] (-1112.043) (-1112.467) (-1113.084) * [-1109.601] (-1109.742) (-1112.595) (-1113.081) -- 0:00:12 814500 -- [-1111.150] (-1110.977) (-1111.364) (-1117.161) * (-1109.885) (-1110.075) (-1111.420) [-1110.620] -- 0:00:12 815000 -- [-1109.805] (-1113.123) (-1112.189) (-1114.272) * [-1111.659] (-1109.950) (-1114.361) (-1112.973) -- 0:00:12 Average standard deviation of split frequencies: 0.008767 815500 -- [-1112.044] (-1111.645) (-1114.131) (-1114.273) * (-1112.319) [-1111.462] (-1113.761) (-1116.653) -- 0:00:12 816000 -- (-1114.769) [-1112.222] (-1113.325) (-1112.123) * (-1110.394) [-1112.432] (-1110.968) (-1110.356) -- 0:00:12 816500 -- [-1113.407] (-1112.078) (-1110.017) (-1111.272) * (-1110.983) [-1110.454] (-1112.479) (-1111.465) -- 0:00:12 817000 -- [-1112.373] (-1110.149) (-1111.161) (-1111.983) * (-1110.326) [-1111.510] (-1115.255) (-1112.459) -- 0:00:12 817500 -- (-1109.537) (-1110.664) [-1110.813] (-1112.820) * (-1110.611) [-1109.561] (-1110.447) (-1113.648) -- 0:00:12 818000 -- [-1109.821] (-1110.590) (-1113.138) (-1113.531) * (-1109.752) (-1109.350) [-1111.401] (-1114.883) -- 0:00:12 818500 -- (-1112.867) (-1111.041) [-1109.543] (-1114.261) * (-1110.779) (-1115.067) (-1110.379) [-1113.284] -- 0:00:12 819000 -- [-1110.353] (-1111.979) (-1111.381) (-1110.341) * [-1110.205] (-1115.960) (-1109.727) (-1109.439) -- 0:00:12 819500 -- (-1109.775) [-1111.094] (-1113.727) (-1112.799) * (-1111.555) [-1112.826] (-1110.656) (-1112.883) -- 0:00:12 820000 -- [-1110.327] (-1112.824) (-1113.228) (-1110.703) * (-1111.106) (-1114.048) [-1110.971] (-1111.652) -- 0:00:12 Average standard deviation of split frequencies: 0.008616 820500 -- [-1110.487] (-1110.451) (-1112.667) (-1110.029) * (-1119.977) (-1112.502) (-1111.126) [-1110.832] -- 0:00:12 821000 -- (-1111.131) (-1110.014) (-1110.953) [-1111.128] * (-1111.703) [-1112.479] (-1112.164) (-1110.094) -- 0:00:11 821500 -- [-1109.685] (-1111.868) (-1110.829) (-1111.487) * (-1112.509) [-1111.758] (-1113.100) (-1111.038) -- 0:00:11 822000 -- [-1109.879] (-1111.608) (-1111.848) (-1109.810) * (-1115.153) [-1112.511] (-1114.083) (-1111.383) -- 0:00:11 822500 -- [-1115.261] (-1113.501) (-1110.953) (-1110.009) * (-1110.923) (-1113.670) (-1113.897) [-1111.980] -- 0:00:11 823000 -- (-1120.424) [-1112.961] (-1112.074) (-1112.800) * [-1114.126] (-1112.849) (-1110.783) (-1111.397) -- 0:00:11 823500 -- (-1110.389) [-1114.638] (-1110.973) (-1112.760) * (-1112.642) (-1110.849) (-1111.758) [-1110.612] -- 0:00:11 824000 -- (-1110.446) [-1109.944] (-1113.561) (-1116.326) * (-1112.630) (-1111.440) (-1116.467) [-1110.929] -- 0:00:11 824500 -- (-1110.599) (-1114.741) [-1113.672] (-1114.324) * [-1113.101] (-1114.465) (-1116.319) (-1112.435) -- 0:00:11 825000 -- (-1112.782) (-1112.065) [-1109.940] (-1115.331) * [-1111.904] (-1110.467) (-1111.804) (-1113.956) -- 0:00:11 Average standard deviation of split frequencies: 0.008728 825500 -- [-1111.958] (-1112.505) (-1110.012) (-1116.029) * (-1111.539) (-1110.012) (-1109.890) [-1111.553] -- 0:00:11 826000 -- (-1109.810) [-1116.970] (-1109.747) (-1112.320) * [-1109.905] (-1113.249) (-1111.589) (-1110.856) -- 0:00:11 826500 -- (-1111.501) (-1115.763) (-1109.429) [-1111.943] * (-1111.503) [-1112.984] (-1110.543) (-1111.641) -- 0:00:11 827000 -- [-1109.987] (-1112.195) (-1113.484) (-1112.445) * [-1110.393] (-1110.564) (-1110.410) (-1109.654) -- 0:00:11 827500 -- (-1110.613) (-1113.092) (-1111.332) [-1111.118] * (-1110.106) (-1113.177) (-1110.411) [-1109.743] -- 0:00:11 828000 -- [-1110.705] (-1113.261) (-1113.679) (-1111.411) * (-1110.228) [-1114.064] (-1110.368) (-1111.075) -- 0:00:11 828500 -- (-1111.042) [-1112.479] (-1111.633) (-1112.163) * [-1111.041] (-1111.940) (-1109.857) (-1113.027) -- 0:00:11 829000 -- [-1111.693] (-1111.538) (-1109.880) (-1114.762) * (-1112.224) (-1112.513) (-1110.420) [-1112.859] -- 0:00:11 829500 -- (-1114.196) (-1111.249) [-1110.829] (-1110.535) * (-1111.934) (-1115.418) [-1113.067] (-1110.852) -- 0:00:11 830000 -- (-1111.859) (-1112.324) [-1110.377] (-1110.920) * (-1110.141) (-1110.954) [-1111.342] (-1112.390) -- 0:00:11 Average standard deviation of split frequencies: 0.008579 830500 -- (-1109.648) (-1113.447) (-1110.765) [-1111.705] * (-1111.216) [-1112.845] (-1113.899) (-1112.161) -- 0:00:11 831000 -- [-1112.003] (-1114.605) (-1110.558) (-1111.869) * (-1110.523) (-1112.343) (-1110.402) [-1109.681] -- 0:00:11 831500 -- (-1111.105) [-1113.768] (-1110.982) (-1112.624) * [-1110.329] (-1113.768) (-1110.621) (-1110.083) -- 0:00:11 832000 -- (-1110.687) (-1111.884) (-1110.482) [-1111.924] * (-1110.631) (-1113.144) [-1112.551] (-1111.186) -- 0:00:11 832500 -- [-1111.815] (-1114.384) (-1112.545) (-1110.865) * (-1110.681) (-1110.908) [-1112.922] (-1110.600) -- 0:00:11 833000 -- (-1109.368) (-1109.682) [-1111.082] (-1112.478) * (-1111.182) (-1111.010) [-1113.430] (-1110.116) -- 0:00:11 833500 -- (-1111.036) (-1109.875) [-1110.693] (-1110.996) * (-1112.970) [-1110.024] (-1110.367) (-1111.611) -- 0:00:11 834000 -- [-1110.966] (-1111.661) (-1110.878) (-1113.459) * (-1111.943) (-1110.359) [-1112.402] (-1113.133) -- 0:00:11 834500 -- (-1111.186) [-1111.499] (-1114.197) (-1111.021) * (-1114.054) [-1110.469] (-1110.892) (-1112.902) -- 0:00:11 835000 -- [-1111.874] (-1113.784) (-1116.045) (-1109.967) * [-1111.204] (-1114.405) (-1111.227) (-1113.280) -- 0:00:11 Average standard deviation of split frequencies: 0.008491 835500 -- (-1112.818) [-1118.462] (-1112.776) (-1110.601) * (-1112.572) (-1110.679) [-1110.934] (-1111.682) -- 0:00:11 836000 -- [-1111.508] (-1111.881) (-1116.040) (-1111.946) * (-1114.527) [-1112.545] (-1111.054) (-1112.523) -- 0:00:10 836500 -- (-1110.625) [-1113.764] (-1111.018) (-1113.171) * (-1110.376) (-1111.708) [-1110.673] (-1113.211) -- 0:00:10 837000 -- [-1109.820] (-1112.560) (-1112.177) (-1112.502) * (-1109.520) (-1114.673) [-1111.193] (-1110.980) -- 0:00:10 837500 -- [-1109.693] (-1113.356) (-1114.353) (-1109.997) * (-1113.434) [-1117.174] (-1112.203) (-1113.606) -- 0:00:10 838000 -- (-1110.689) (-1115.527) (-1110.594) [-1109.577] * (-1117.997) [-1112.292] (-1113.067) (-1112.766) -- 0:00:10 838500 -- (-1112.820) [-1112.725] (-1110.346) (-1111.499) * (-1114.256) (-1110.272) (-1117.233) [-1116.349] -- 0:00:10 839000 -- (-1112.258) (-1111.247) [-1110.915] (-1111.498) * (-1109.751) (-1110.367) [-1112.181] (-1111.052) -- 0:00:10 839500 -- [-1112.884] (-1109.905) (-1112.237) (-1110.057) * [-1110.523] (-1114.374) (-1112.140) (-1110.091) -- 0:00:10 840000 -- (-1113.994) (-1110.374) [-1110.099] (-1112.965) * (-1112.759) [-1110.061] (-1113.631) (-1112.973) -- 0:00:10 Average standard deviation of split frequencies: 0.008312 840500 -- (-1115.248) (-1112.003) (-1110.571) [-1111.281] * (-1113.647) (-1113.032) (-1113.820) [-1111.020] -- 0:00:10 841000 -- (-1116.445) (-1111.205) [-1114.009] (-1110.330) * (-1112.206) (-1111.797) (-1114.261) [-1111.949] -- 0:00:10 841500 -- (-1115.254) [-1112.286] (-1112.332) (-1111.589) * (-1112.059) (-1111.260) (-1111.695) [-1111.980] -- 0:00:10 842000 -- (-1114.372) [-1113.492] (-1110.956) (-1114.254) * (-1111.358) [-1111.895] (-1110.888) (-1114.169) -- 0:00:10 842500 -- (-1113.304) (-1110.151) (-1112.018) [-1111.848] * (-1113.400) [-1110.431] (-1111.754) (-1111.533) -- 0:00:10 843000 -- (-1112.783) [-1110.152] (-1112.619) (-1111.221) * (-1110.997) (-1111.613) [-1109.999] (-1110.298) -- 0:00:10 843500 -- (-1112.093) (-1111.686) (-1116.720) [-1109.620] * (-1114.670) (-1110.608) (-1110.902) [-1110.587] -- 0:00:10 844000 -- [-1111.240] (-1111.536) (-1111.163) (-1110.290) * [-1110.604] (-1112.201) (-1110.148) (-1110.670) -- 0:00:10 844500 -- [-1112.797] (-1113.774) (-1111.735) (-1113.782) * (-1110.554) [-1112.864] (-1109.943) (-1111.755) -- 0:00:10 845000 -- (-1111.387) (-1111.900) [-1110.573] (-1114.559) * (-1111.100) (-1112.258) (-1114.673) [-1110.791] -- 0:00:10 Average standard deviation of split frequencies: 0.008424 845500 -- (-1110.122) (-1113.235) (-1111.437) [-1112.605] * [-1115.897] (-1114.922) (-1112.838) (-1110.178) -- 0:00:10 846000 -- (-1110.093) [-1112.509] (-1111.449) (-1111.974) * (-1112.646) (-1111.746) (-1110.665) [-1113.075] -- 0:00:10 846500 -- (-1113.116) (-1112.132) (-1111.105) [-1110.090] * (-1115.649) (-1110.814) [-1112.715] (-1113.749) -- 0:00:10 847000 -- (-1111.826) (-1113.456) (-1112.541) [-1112.189] * [-1110.042] (-1110.659) (-1111.470) (-1116.312) -- 0:00:10 847500 -- (-1112.124) (-1110.536) (-1111.586) [-1111.402] * [-1111.349] (-1109.605) (-1111.106) (-1114.956) -- 0:00:10 848000 -- [-1110.625] (-1112.394) (-1111.358) (-1111.978) * (-1110.282) (-1110.593) [-1110.866] (-1110.532) -- 0:00:10 848500 -- (-1110.209) [-1112.023] (-1111.574) (-1112.855) * (-1114.413) [-1111.509] (-1110.531) (-1112.114) -- 0:00:10 849000 -- [-1116.324] (-1111.427) (-1110.970) (-1113.638) * (-1117.606) [-1112.944] (-1111.719) (-1111.759) -- 0:00:10 849500 -- (-1113.552) (-1110.600) [-1112.438] (-1114.154) * (-1113.251) (-1113.547) [-1113.782] (-1114.968) -- 0:00:10 850000 -- [-1109.643] (-1111.584) (-1110.081) (-1110.420) * (-1109.783) (-1110.845) (-1111.630) [-1111.372] -- 0:00:10 Average standard deviation of split frequencies: 0.008312 850500 -- [-1112.176] (-1113.181) (-1110.938) (-1113.069) * (-1110.661) [-1110.218] (-1110.850) (-1111.363) -- 0:00:10 851000 -- [-1113.705] (-1114.844) (-1113.038) (-1112.616) * (-1113.931) (-1109.895) [-1111.812] (-1113.003) -- 0:00:09 851500 -- (-1110.854) [-1111.732] (-1110.081) (-1109.778) * (-1114.544) (-1116.389) [-1110.834] (-1114.358) -- 0:00:09 852000 -- [-1113.370] (-1111.138) (-1111.421) (-1110.565) * (-1116.533) (-1113.615) [-1112.025] (-1111.861) -- 0:00:09 852500 -- (-1113.225) (-1110.860) (-1110.732) [-1110.841] * (-1112.187) (-1114.745) (-1111.144) [-1110.855] -- 0:00:09 853000 -- (-1115.711) [-1111.259] (-1111.022) (-1112.990) * [-1112.517] (-1113.576) (-1116.565) (-1112.456) -- 0:00:09 853500 -- (-1111.348) [-1115.984] (-1110.171) (-1110.465) * (-1110.703) [-1110.296] (-1115.481) (-1110.726) -- 0:00:09 854000 -- [-1110.170] (-1116.881) (-1109.792) (-1115.762) * (-1109.506) [-1110.839] (-1110.109) (-1109.444) -- 0:00:09 854500 -- (-1111.996) [-1111.082] (-1110.042) (-1112.048) * [-1111.137] (-1112.035) (-1110.723) (-1112.160) -- 0:00:09 855000 -- (-1111.547) (-1111.164) [-1111.529] (-1109.451) * [-1112.804] (-1112.159) (-1111.977) (-1112.496) -- 0:00:09 Average standard deviation of split frequencies: 0.008325 855500 -- [-1111.738] (-1110.728) (-1112.357) (-1109.929) * (-1111.076) [-1110.869] (-1112.048) (-1110.888) -- 0:00:09 856000 -- [-1111.388] (-1110.821) (-1114.557) (-1115.594) * (-1111.160) [-1110.411] (-1112.733) (-1110.478) -- 0:00:09 856500 -- [-1109.843] (-1112.284) (-1114.668) (-1114.768) * (-1110.729) (-1111.681) (-1110.142) [-1111.788] -- 0:00:09 857000 -- (-1111.150) (-1110.730) [-1115.102] (-1112.794) * [-1109.545] (-1111.899) (-1111.207) (-1112.854) -- 0:00:09 857500 -- [-1111.283] (-1111.604) (-1112.287) (-1111.486) * (-1109.737) [-1111.024] (-1112.057) (-1112.905) -- 0:00:09 858000 -- (-1110.274) [-1113.409] (-1113.516) (-1110.432) * [-1109.569] (-1112.276) (-1111.271) (-1116.922) -- 0:00:09 858500 -- (-1112.359) (-1111.498) [-1114.428] (-1110.420) * (-1110.363) [-1116.388] (-1111.084) (-1112.488) -- 0:00:09 859000 -- (-1114.307) (-1111.561) [-1114.359] (-1112.350) * (-1109.742) (-1113.421) (-1112.701) [-1112.415] -- 0:00:09 859500 -- (-1112.176) (-1112.520) (-1115.479) [-1109.564] * (-1109.789) (-1113.421) [-1110.398] (-1111.269) -- 0:00:09 860000 -- (-1110.503) [-1111.933] (-1114.647) (-1111.870) * (-1110.076) (-1113.916) [-1111.143] (-1111.171) -- 0:00:09 Average standard deviation of split frequencies: 0.008764 860500 -- [-1109.549] (-1115.883) (-1110.513) (-1111.229) * (-1113.809) (-1111.828) [-1111.531] (-1110.609) -- 0:00:09 861000 -- (-1117.204) (-1121.196) [-1110.144] (-1111.683) * (-1111.265) [-1110.303] (-1112.439) (-1111.199) -- 0:00:09 861500 -- (-1113.649) (-1114.313) [-1112.214] (-1110.655) * (-1109.709) (-1112.020) [-1110.677] (-1111.246) -- 0:00:09 862000 -- [-1112.575] (-1111.876) (-1114.246) (-1110.133) * (-1109.728) (-1116.352) (-1110.553) [-1117.270] -- 0:00:09 862500 -- (-1111.585) (-1112.887) (-1110.235) [-1111.042] * (-1110.296) (-1116.158) [-1109.974] (-1110.346) -- 0:00:09 863000 -- [-1113.608] (-1111.181) (-1110.759) (-1114.447) * (-1109.697) (-1113.173) (-1111.329) [-1113.969] -- 0:00:09 863500 -- (-1116.043) (-1110.972) [-1111.048] (-1110.917) * [-1109.696] (-1111.012) (-1113.609) (-1110.556) -- 0:00:09 864000 -- [-1114.575] (-1111.055) (-1112.980) (-1110.136) * [-1109.797] (-1111.201) (-1110.587) (-1109.931) -- 0:00:09 864500 -- (-1109.835) (-1112.111) [-1113.053] (-1111.128) * (-1111.675) [-1110.347] (-1110.714) (-1111.580) -- 0:00:09 865000 -- (-1112.234) (-1111.773) (-1112.358) [-1109.685] * (-1113.108) (-1111.074) [-1109.726] (-1110.376) -- 0:00:09 Average standard deviation of split frequencies: 0.008982 865500 -- (-1113.195) [-1111.706] (-1111.237) (-1109.896) * (-1112.439) [-1111.359] (-1111.107) (-1112.570) -- 0:00:09 866000 -- (-1111.027) [-1112.406] (-1116.131) (-1111.016) * (-1112.264) (-1110.928) (-1111.962) [-1111.067] -- 0:00:08 866500 -- (-1112.408) [-1111.476] (-1110.044) (-1111.393) * (-1109.679) (-1110.872) (-1110.272) [-1110.534] -- 0:00:08 867000 -- (-1112.462) (-1109.924) (-1113.523) [-1110.306] * [-1109.873] (-1110.315) (-1110.689) (-1110.252) -- 0:00:08 867500 -- (-1111.232) [-1109.953] (-1113.816) (-1111.371) * (-1110.043) (-1113.692) (-1110.662) [-1109.297] -- 0:00:08 868000 -- [-1111.525] (-1109.717) (-1115.142) (-1112.207) * (-1110.774) (-1111.891) (-1112.537) [-1109.391] -- 0:00:08 868500 -- (-1110.953) [-1111.545] (-1113.605) (-1110.234) * (-1109.892) [-1111.313] (-1110.246) (-1111.362) -- 0:00:08 869000 -- (-1110.371) [-1110.859] (-1119.357) (-1109.642) * (-1109.518) (-1114.722) (-1111.377) [-1109.667] -- 0:00:08 869500 -- (-1111.936) [-1114.860] (-1109.956) (-1109.520) * [-1109.512] (-1112.683) (-1113.233) (-1115.388) -- 0:00:08 870000 -- [-1111.718] (-1117.848) (-1110.528) (-1111.063) * [-1110.616] (-1114.498) (-1110.648) (-1113.471) -- 0:00:08 Average standard deviation of split frequencies: 0.008798 870500 -- (-1110.455) (-1113.372) (-1109.996) [-1112.031] * [-1111.695] (-1115.804) (-1110.814) (-1111.300) -- 0:00:08 871000 -- (-1109.816) [-1111.603] (-1111.131) (-1111.383) * (-1112.434) (-1110.502) (-1110.759) [-1110.641] -- 0:00:08 871500 -- (-1111.044) (-1112.545) [-1110.850] (-1110.867) * [-1110.655] (-1110.336) (-1110.462) (-1110.814) -- 0:00:08 872000 -- (-1109.906) (-1110.986) [-1110.954] (-1110.384) * (-1110.660) (-1111.790) (-1110.990) [-1111.849] -- 0:00:08 872500 -- (-1110.576) (-1110.735) (-1113.150) [-1112.330] * (-1111.289) [-1112.076] (-1110.850) (-1119.299) -- 0:00:08 873000 -- (-1111.354) (-1110.792) (-1110.993) [-1113.681] * (-1111.480) [-1110.771] (-1116.021) (-1117.219) -- 0:00:08 873500 -- [-1112.373] (-1111.168) (-1111.290) (-1109.490) * (-1111.545) [-1112.135] (-1111.027) (-1113.279) -- 0:00:08 874000 -- (-1112.860) [-1111.135] (-1111.265) (-1110.959) * [-1110.150] (-1111.332) (-1112.556) (-1110.232) -- 0:00:08 874500 -- (-1114.453) [-1110.775] (-1111.352) (-1111.946) * (-1110.992) [-1111.360] (-1112.049) (-1109.627) -- 0:00:08 875000 -- (-1110.910) (-1112.554) [-1113.599] (-1116.654) * (-1110.439) (-1111.671) [-1112.643] (-1112.468) -- 0:00:08 Average standard deviation of split frequencies: 0.008677 875500 -- (-1118.144) [-1109.793] (-1112.014) (-1112.081) * (-1112.396) (-1112.983) [-1110.969] (-1110.081) -- 0:00:08 876000 -- (-1113.116) (-1112.314) [-1111.922] (-1111.033) * (-1115.030) (-1117.061) (-1114.690) [-1110.880] -- 0:00:08 876500 -- [-1110.972] (-1110.381) (-1112.205) (-1109.770) * [-1111.589] (-1112.292) (-1114.155) (-1111.249) -- 0:00:08 877000 -- [-1109.999] (-1110.629) (-1111.071) (-1111.539) * (-1116.323) (-1112.153) [-1112.554] (-1115.082) -- 0:00:08 877500 -- (-1110.608) [-1117.371] (-1110.406) (-1114.265) * (-1114.401) (-1110.566) (-1111.352) [-1112.633] -- 0:00:08 878000 -- [-1111.490] (-1110.757) (-1109.790) (-1111.839) * (-1112.000) (-1111.385) (-1111.352) [-1111.691] -- 0:00:08 878500 -- (-1110.811) (-1111.099) [-1111.478] (-1114.537) * [-1111.622] (-1111.127) (-1111.543) (-1112.347) -- 0:00:08 879000 -- (-1112.059) [-1111.699] (-1113.137) (-1113.524) * (-1111.570) (-1110.868) (-1111.554) [-1111.995] -- 0:00:07 879500 -- (-1111.829) (-1113.194) (-1110.313) [-1109.950] * (-1110.632) [-1110.261] (-1110.392) (-1111.761) -- 0:00:07 880000 -- (-1112.478) (-1111.841) (-1113.702) [-1109.953] * [-1111.099] (-1110.276) (-1111.155) (-1114.468) -- 0:00:07 Average standard deviation of split frequencies: 0.008866 880500 -- (-1110.071) (-1112.243) (-1113.145) [-1110.624] * (-1111.425) (-1112.213) [-1110.064] (-1110.492) -- 0:00:08 881000 -- (-1109.860) (-1111.952) [-1111.322] (-1112.911) * [-1110.487] (-1113.370) (-1110.974) (-1110.223) -- 0:00:07 881500 -- (-1110.370) (-1112.161) [-1113.122] (-1112.656) * (-1110.174) (-1112.148) (-1110.719) [-1109.699] -- 0:00:07 882000 -- [-1110.355] (-1109.732) (-1111.258) (-1109.802) * (-1113.780) (-1109.578) (-1110.524) [-1113.207] -- 0:00:07 882500 -- [-1111.726] (-1109.476) (-1113.716) (-1112.906) * [-1110.349] (-1111.635) (-1112.572) (-1116.462) -- 0:00:07 883000 -- (-1112.644) (-1113.801) [-1110.383] (-1112.073) * (-1110.709) (-1110.522) [-1111.857] (-1110.034) -- 0:00:07 883500 -- (-1112.165) (-1112.334) (-1110.294) [-1112.689] * (-1113.175) [-1109.858] (-1111.587) (-1110.354) -- 0:00:07 884000 -- [-1112.063] (-1112.314) (-1110.962) (-1114.055) * [-1111.775] (-1111.048) (-1115.528) (-1109.904) -- 0:00:07 884500 -- (-1110.233) [-1111.029] (-1116.399) (-1112.471) * (-1110.076) (-1109.661) [-1111.881] (-1111.009) -- 0:00:07 885000 -- (-1109.844) [-1112.615] (-1110.511) (-1112.717) * [-1110.076] (-1110.331) (-1111.015) (-1112.502) -- 0:00:07 Average standard deviation of split frequencies: 0.008607 885500 -- (-1110.879) [-1110.725] (-1115.420) (-1110.084) * (-1111.544) (-1117.334) [-1110.011] (-1111.312) -- 0:00:07 886000 -- (-1109.818) (-1112.262) [-1112.437] (-1112.865) * (-1112.079) (-1113.180) [-1115.230] (-1114.025) -- 0:00:07 886500 -- [-1111.569] (-1110.089) (-1112.341) (-1113.031) * (-1113.720) [-1112.834] (-1111.174) (-1111.189) -- 0:00:07 887000 -- (-1111.846) (-1109.811) [-1111.253] (-1111.958) * (-1116.074) (-1112.434) (-1111.159) [-1110.022] -- 0:00:07 887500 -- (-1112.214) (-1111.156) [-1110.091] (-1112.459) * (-1113.823) (-1111.456) (-1110.717) [-1111.325] -- 0:00:07 888000 -- (-1113.708) [-1112.536] (-1111.965) (-1115.037) * (-1120.632) (-1111.376) [-1110.409] (-1112.358) -- 0:00:07 888500 -- (-1112.920) (-1113.738) [-1112.070] (-1110.306) * (-1121.411) [-1111.358] (-1110.879) (-1112.917) -- 0:00:07 889000 -- (-1112.543) [-1110.363] (-1111.087) (-1112.862) * (-1122.020) [-1111.652] (-1111.515) (-1113.543) -- 0:00:07 889500 -- (-1113.962) [-1110.197] (-1112.659) (-1111.718) * (-1111.637) (-1109.843) (-1113.355) [-1112.600] -- 0:00:07 890000 -- (-1109.723) (-1111.481) [-1112.691] (-1116.187) * (-1111.728) [-1110.885] (-1113.218) (-1112.251) -- 0:00:07 Average standard deviation of split frequencies: 0.008406 890500 -- [-1109.722] (-1111.564) (-1112.250) (-1115.295) * [-1110.845] (-1109.880) (-1110.862) (-1115.747) -- 0:00:07 891000 -- (-1110.898) (-1112.403) (-1114.417) [-1110.135] * (-1111.137) (-1113.071) [-1110.700] (-1114.308) -- 0:00:07 891500 -- (-1111.938) (-1111.911) [-1113.764] (-1111.712) * [-1111.830] (-1110.506) (-1111.228) (-1114.086) -- 0:00:07 892000 -- (-1111.493) (-1110.719) [-1112.132] (-1113.652) * (-1110.671) (-1110.884) [-1110.812] (-1113.604) -- 0:00:07 892500 -- (-1116.287) (-1112.160) [-1113.448] (-1112.583) * [-1110.853] (-1110.291) (-1111.661) (-1113.669) -- 0:00:07 893000 -- (-1113.396) (-1112.099) (-1113.019) [-1111.832] * (-1110.050) (-1110.112) (-1111.360) [-1111.660] -- 0:00:07 893500 -- (-1112.890) (-1110.695) (-1111.886) [-1112.593] * (-1111.285) (-1113.287) (-1110.802) [-1111.320] -- 0:00:07 894000 -- [-1111.603] (-1111.010) (-1110.384) (-1110.129) * [-1112.077] (-1114.684) (-1110.475) (-1110.891) -- 0:00:06 894500 -- (-1110.187) (-1111.368) [-1113.731] (-1112.272) * (-1110.027) [-1111.820] (-1109.453) (-1112.470) -- 0:00:06 895000 -- (-1111.701) (-1114.098) [-1113.083] (-1117.265) * (-1111.882) (-1110.306) [-1112.544] (-1115.829) -- 0:00:06 Average standard deviation of split frequencies: 0.008573 895500 -- [-1110.970] (-1115.686) (-1112.545) (-1116.647) * (-1109.372) [-1112.874] (-1115.161) (-1111.855) -- 0:00:06 896000 -- [-1110.763] (-1113.655) (-1110.723) (-1112.843) * (-1109.355) (-1111.773) [-1114.139] (-1111.397) -- 0:00:06 896500 -- (-1113.283) (-1110.939) (-1110.114) [-1113.677] * (-1110.323) (-1112.303) (-1110.108) [-1112.897] -- 0:00:06 897000 -- [-1110.722] (-1111.079) (-1111.003) (-1116.718) * (-1110.457) [-1112.294] (-1110.686) (-1112.640) -- 0:00:06 897500 -- [-1114.799] (-1111.505) (-1111.168) (-1115.009) * [-1112.374] (-1112.088) (-1110.711) (-1111.781) -- 0:00:06 898000 -- (-1112.437) [-1111.516] (-1112.692) (-1117.087) * [-1109.821] (-1111.495) (-1111.143) (-1110.076) -- 0:00:06 898500 -- (-1112.874) (-1114.729) [-1113.143] (-1114.261) * (-1113.206) [-1111.561] (-1113.224) (-1112.594) -- 0:00:06 899000 -- (-1111.665) (-1111.324) [-1115.624] (-1111.795) * (-1112.894) (-1111.586) (-1110.653) [-1110.893] -- 0:00:06 899500 -- (-1112.452) [-1111.937] (-1112.520) (-1111.568) * (-1110.488) [-1110.041] (-1110.998) (-1115.900) -- 0:00:06 900000 -- (-1111.727) (-1111.224) (-1114.989) [-1113.747] * [-1112.381] (-1112.729) (-1110.569) (-1115.870) -- 0:00:06 Average standard deviation of split frequencies: 0.008344 900500 -- (-1112.212) (-1113.335) (-1110.002) [-1111.342] * [-1109.687] (-1113.659) (-1110.159) (-1110.634) -- 0:00:06 901000 -- [-1110.624] (-1112.376) (-1111.871) (-1111.786) * (-1110.037) (-1111.718) [-1112.041] (-1110.962) -- 0:00:06 901500 -- (-1115.251) [-1111.483] (-1111.891) (-1112.574) * (-1110.392) (-1110.710) [-1110.257] (-1111.902) -- 0:00:06 902000 -- (-1112.306) (-1112.721) [-1113.414] (-1109.983) * (-1117.438) (-1109.457) (-1110.576) [-1111.572] -- 0:00:06 902500 -- (-1110.659) [-1112.580] (-1111.223) (-1109.804) * (-1111.749) [-1110.622] (-1112.482) (-1112.521) -- 0:00:06 903000 -- (-1115.414) [-1112.552] (-1109.626) (-1114.501) * [-1110.292] (-1110.766) (-1111.412) (-1112.366) -- 0:00:06 903500 -- (-1110.285) (-1114.728) (-1109.327) [-1112.156] * (-1112.160) [-1110.028] (-1113.807) (-1110.230) -- 0:00:06 904000 -- (-1110.338) (-1112.094) (-1110.004) [-1110.957] * (-1110.581) (-1111.430) (-1113.476) [-1112.742] -- 0:00:06 904500 -- [-1111.828] (-1111.615) (-1111.157) (-1110.902) * (-1111.808) (-1111.088) (-1113.947) [-1109.708] -- 0:00:06 905000 -- [-1112.062] (-1113.204) (-1111.885) (-1111.869) * (-1111.899) (-1111.612) (-1110.331) [-1111.193] -- 0:00:06 Average standard deviation of split frequencies: 0.008539 905500 -- (-1112.810) (-1111.599) [-1113.259] (-1115.237) * (-1115.263) (-1111.002) (-1110.077) [-1110.840] -- 0:00:06 906000 -- (-1109.904) (-1110.527) (-1115.422) [-1112.857] * (-1115.995) [-1110.174] (-1112.182) (-1118.378) -- 0:00:06 906500 -- (-1112.444) [-1112.263] (-1115.638) (-1111.983) * (-1117.863) [-1110.532] (-1113.100) (-1111.883) -- 0:00:06 907000 -- [-1111.159] (-1112.226) (-1110.021) (-1110.027) * [-1114.261] (-1113.922) (-1109.882) (-1115.981) -- 0:00:06 907500 -- [-1110.793] (-1110.675) (-1111.395) (-1114.851) * (-1112.071) (-1111.874) (-1110.572) [-1111.181] -- 0:00:06 908000 -- (-1109.682) (-1111.952) [-1112.856] (-1110.922) * (-1113.086) [-1112.143] (-1115.343) (-1112.105) -- 0:00:06 908500 -- (-1112.962) [-1109.669] (-1111.386) (-1111.035) * (-1111.384) (-1113.972) (-1110.762) [-1112.110] -- 0:00:06 909000 -- [-1115.454] (-1109.877) (-1112.140) (-1110.122) * (-1115.181) [-1111.067] (-1112.611) (-1118.783) -- 0:00:06 909500 -- [-1110.218] (-1110.858) (-1114.878) (-1111.858) * (-1116.243) [-1111.176] (-1112.730) (-1109.959) -- 0:00:05 910000 -- (-1110.582) (-1110.899) (-1113.897) [-1111.162] * (-1112.963) (-1111.789) (-1115.462) [-1110.321] -- 0:00:05 Average standard deviation of split frequencies: 0.008994 910500 -- (-1109.633) (-1112.954) (-1114.275) [-1113.760] * (-1117.440) (-1109.734) (-1111.779) [-1112.497] -- 0:00:05 911000 -- [-1111.140] (-1109.421) (-1112.290) (-1110.597) * (-1111.236) (-1116.483) [-1112.728] (-1113.544) -- 0:00:05 911500 -- (-1110.116) [-1113.897] (-1109.891) (-1113.355) * (-1111.808) (-1117.150) [-1109.939] (-1111.389) -- 0:00:05 912000 -- (-1111.536) [-1110.631] (-1113.041) (-1109.876) * (-1114.829) (-1116.997) [-1111.118] (-1109.869) -- 0:00:05 912500 -- (-1112.452) (-1111.153) (-1112.720) [-1114.634] * [-1116.656] (-1110.808) (-1112.549) (-1111.631) -- 0:00:05 913000 -- [-1110.574] (-1110.721) (-1114.555) (-1110.787) * (-1115.266) (-1111.535) (-1112.245) [-1110.553] -- 0:00:05 913500 -- (-1110.122) (-1110.859) (-1115.367) [-1111.384] * (-1112.881) (-1112.959) [-1110.245] (-1111.859) -- 0:00:05 914000 -- (-1109.583) (-1112.906) [-1113.440] (-1112.587) * (-1112.025) (-1111.231) (-1111.147) [-1110.375] -- 0:00:05 914500 -- [-1111.883] (-1110.945) (-1110.158) (-1111.761) * (-1112.543) [-1110.096] (-1110.434) (-1110.738) -- 0:00:05 915000 -- (-1111.901) (-1111.305) [-1110.156] (-1112.085) * (-1114.616) (-1112.378) (-1109.692) [-1110.145] -- 0:00:05 Average standard deviation of split frequencies: 0.009263 915500 -- (-1111.127) (-1110.276) (-1113.923) [-1116.614] * (-1111.570) [-1112.108] (-1111.286) (-1109.990) -- 0:00:05 916000 -- (-1111.369) (-1109.877) [-1111.679] (-1114.431) * (-1113.649) [-1115.420] (-1113.126) (-1109.753) -- 0:00:05 916500 -- (-1114.536) (-1111.657) [-1111.146] (-1112.625) * (-1113.137) (-1114.312) (-1114.994) [-1110.071] -- 0:00:05 917000 -- [-1112.396] (-1113.405) (-1116.480) (-1112.205) * (-1111.163) (-1116.378) [-1110.241] (-1110.415) -- 0:00:05 917500 -- (-1110.212) (-1111.171) (-1114.268) [-1114.554] * (-1113.089) (-1112.389) (-1111.707) [-1112.619] -- 0:00:05 918000 -- (-1113.668) [-1110.636] (-1111.499) (-1115.666) * (-1115.300) (-1112.864) [-1110.895] (-1110.315) -- 0:00:05 918500 -- (-1113.690) (-1114.228) [-1112.495] (-1110.980) * (-1114.395) (-1114.569) [-1110.531] (-1110.941) -- 0:00:05 919000 -- [-1112.787] (-1109.495) (-1111.039) (-1113.185) * (-1112.695) (-1110.611) [-1111.300] (-1110.780) -- 0:00:05 919500 -- (-1113.112) [-1109.680] (-1112.010) (-1110.088) * (-1110.963) [-1113.020] (-1112.401) (-1113.790) -- 0:00:05 920000 -- (-1111.558) [-1111.340] (-1110.747) (-1110.672) * [-1111.789] (-1113.661) (-1115.432) (-1114.690) -- 0:00:05 Average standard deviation of split frequencies: 0.009408 920500 -- (-1112.682) (-1115.458) (-1113.506) [-1110.345] * [-1113.458] (-1113.011) (-1113.225) (-1114.161) -- 0:00:05 921000 -- (-1111.163) (-1113.584) [-1115.965] (-1116.085) * (-1110.264) (-1118.505) (-1114.713) [-1111.887] -- 0:00:05 921500 -- [-1111.174] (-1112.174) (-1114.134) (-1113.719) * (-1110.223) (-1112.348) (-1111.486) [-1112.625] -- 0:00:05 922000 -- (-1111.126) (-1110.742) (-1110.637) [-1111.598] * (-1110.619) [-1111.963] (-1109.964) (-1110.971) -- 0:00:05 922500 -- [-1112.253] (-1111.308) (-1110.971) (-1116.955) * (-1114.315) (-1109.544) [-1110.859] (-1120.105) -- 0:00:05 923000 -- [-1112.529] (-1110.992) (-1110.912) (-1112.880) * (-1117.369) (-1109.751) (-1110.209) [-1111.471] -- 0:00:05 923500 -- (-1110.803) (-1111.460) (-1109.974) [-1111.708] * (-1117.777) (-1111.339) [-1114.177] (-1111.645) -- 0:00:05 924000 -- (-1110.173) (-1112.367) [-1115.142] (-1111.357) * (-1114.713) (-1111.305) [-1115.541] (-1115.993) -- 0:00:05 924500 -- (-1110.340) [-1110.773] (-1112.750) (-1112.533) * (-1114.316) [-1111.798] (-1113.547) (-1114.809) -- 0:00:04 925000 -- (-1111.366) (-1109.308) (-1111.834) [-1113.574] * [-1114.426] (-1111.383) (-1111.599) (-1112.426) -- 0:00:04 Average standard deviation of split frequencies: 0.009291 925500 -- [-1111.185] (-1109.320) (-1115.714) (-1116.507) * [-1112.115] (-1110.794) (-1112.642) (-1112.320) -- 0:00:04 926000 -- (-1113.988) [-1110.082] (-1116.363) (-1114.521) * (-1110.594) [-1111.905] (-1110.373) (-1112.231) -- 0:00:04 926500 -- [-1111.073] (-1110.417) (-1110.794) (-1114.002) * (-1111.343) (-1110.909) [-1110.105] (-1112.153) -- 0:00:04 927000 -- [-1110.687] (-1119.274) (-1112.563) (-1111.085) * (-1114.881) [-1112.108] (-1109.776) (-1111.049) -- 0:00:04 927500 -- (-1110.504) [-1113.771] (-1113.056) (-1110.228) * (-1112.919) (-1110.503) (-1114.251) [-1114.410] -- 0:00:04 928000 -- (-1110.287) (-1112.997) [-1111.124] (-1112.394) * [-1113.314] (-1111.402) (-1117.665) (-1111.840) -- 0:00:04 928500 -- (-1111.073) (-1114.538) [-1114.608] (-1113.225) * [-1111.237] (-1111.187) (-1113.690) (-1109.978) -- 0:00:04 929000 -- [-1112.093] (-1110.619) (-1115.949) (-1111.597) * (-1112.313) (-1112.904) [-1115.640] (-1109.950) -- 0:00:04 929500 -- (-1111.031) (-1117.210) (-1115.977) [-1112.067] * (-1113.557) [-1114.681] (-1111.519) (-1112.292) -- 0:00:04 930000 -- [-1113.472] (-1111.161) (-1111.560) (-1118.469) * (-1113.679) (-1112.561) [-1112.667] (-1110.379) -- 0:00:04 Average standard deviation of split frequencies: 0.009307 930500 -- [-1114.488] (-1112.702) (-1112.735) (-1118.111) * (-1110.885) (-1112.379) [-1114.314] (-1112.694) -- 0:00:04 931000 -- (-1110.292) (-1114.476) (-1114.292) [-1114.726] * (-1111.423) (-1110.719) (-1114.083) [-1110.306] -- 0:00:04 931500 -- (-1110.139) (-1121.302) (-1117.150) [-1111.175] * (-1111.779) [-1110.826] (-1113.281) (-1112.635) -- 0:00:04 932000 -- [-1112.448] (-1119.252) (-1111.866) (-1111.842) * (-1112.561) (-1111.463) (-1111.908) [-1110.151] -- 0:00:04 932500 -- (-1109.850) (-1113.941) [-1111.958] (-1114.522) * (-1113.349) (-1111.630) (-1111.575) [-1110.643] -- 0:00:04 933000 -- (-1111.807) (-1109.607) [-1112.169] (-1112.459) * (-1111.701) [-1112.016] (-1111.666) (-1111.997) -- 0:00:04 933500 -- [-1110.943] (-1115.437) (-1110.084) (-1114.034) * (-1113.052) (-1114.070) (-1110.616) [-1111.453] -- 0:00:04 934000 -- (-1110.921) (-1114.164) [-1112.840] (-1111.855) * (-1117.494) [-1114.879] (-1112.521) (-1111.289) -- 0:00:04 934500 -- [-1111.260] (-1112.027) (-1114.255) (-1110.807) * (-1111.986) (-1114.334) (-1112.488) [-1112.265] -- 0:00:04 935000 -- (-1113.026) [-1110.597] (-1111.453) (-1110.654) * (-1115.719) (-1112.103) (-1111.170) [-1112.201] -- 0:00:04 Average standard deviation of split frequencies: 0.009160 935500 -- (-1112.749) (-1112.887) [-1111.511] (-1110.489) * [-1109.839] (-1110.993) (-1112.511) (-1113.774) -- 0:00:04 936000 -- (-1115.183) (-1112.737) [-1111.684] (-1113.375) * (-1109.903) [-1111.640] (-1114.212) (-1109.367) -- 0:00:04 936500 -- (-1110.184) (-1111.301) [-1111.793] (-1111.312) * (-1112.549) (-1112.496) (-1110.247) [-1111.158] -- 0:00:04 937000 -- (-1111.551) (-1109.579) (-1110.463) [-1112.422] * (-1112.381) [-1111.546] (-1111.194) (-1112.879) -- 0:00:04 937500 -- (-1111.911) (-1110.334) [-1111.102] (-1112.289) * [-1111.851] (-1110.716) (-1112.347) (-1112.841) -- 0:00:04 938000 -- (-1113.216) [-1110.437] (-1112.858) (-1111.146) * (-1112.984) (-1110.259) [-1112.395] (-1114.124) -- 0:00:04 938500 -- (-1110.573) (-1112.451) (-1112.257) [-1110.909] * (-1110.311) (-1113.837) (-1110.571) [-1111.717] -- 0:00:04 939000 -- (-1114.656) (-1113.608) (-1113.109) [-1111.071] * (-1112.124) (-1112.240) (-1114.285) [-1112.276] -- 0:00:04 939500 -- (-1112.826) (-1111.983) (-1109.988) [-1110.892] * (-1115.243) (-1112.166) (-1110.004) [-1110.498] -- 0:00:03 940000 -- [-1111.709] (-1112.144) (-1110.629) (-1111.212) * (-1112.392) (-1111.389) [-1110.624] (-1112.963) -- 0:00:03 Average standard deviation of split frequencies: 0.008958 940500 -- [-1112.260] (-1112.440) (-1110.186) (-1111.140) * (-1115.119) (-1112.221) [-1112.810] (-1112.564) -- 0:00:03 941000 -- (-1113.872) [-1117.125] (-1110.177) (-1109.679) * (-1112.599) [-1114.392] (-1113.486) (-1117.478) -- 0:00:03 941500 -- (-1112.856) [-1114.681] (-1114.952) (-1111.380) * (-1109.989) (-1111.532) (-1111.898) [-1110.002] -- 0:00:03 942000 -- (-1112.824) [-1115.818] (-1111.623) (-1110.143) * (-1111.081) (-1109.600) (-1113.411) [-1110.273] -- 0:00:03 942500 -- (-1110.731) (-1115.825) (-1119.410) [-1110.187] * [-1110.901] (-1111.231) (-1110.368) (-1113.709) -- 0:00:03 943000 -- (-1112.705) [-1115.042] (-1116.000) (-1111.426) * (-1110.872) (-1110.048) [-1111.734] (-1115.109) -- 0:00:03 943500 -- (-1111.621) (-1111.983) (-1112.739) [-1112.995] * (-1111.390) [-1110.689] (-1110.846) (-1114.632) -- 0:00:03 944000 -- [-1110.509] (-1114.535) (-1110.409) (-1112.720) * (-1113.772) (-1114.573) (-1110.471) [-1115.635] -- 0:00:03 944500 -- [-1109.703] (-1114.855) (-1110.565) (-1112.729) * (-1113.945) (-1111.686) (-1111.483) [-1112.345] -- 0:00:03 945000 -- (-1111.223) (-1110.501) [-1109.574] (-1114.136) * [-1111.442] (-1115.415) (-1111.534) (-1111.030) -- 0:00:03 Average standard deviation of split frequencies: 0.009406 945500 -- (-1111.859) (-1112.043) (-1110.750) [-1112.698] * (-1120.592) (-1111.458) (-1109.940) [-1111.229] -- 0:00:03 946000 -- [-1110.992] (-1110.708) (-1111.203) (-1111.847) * (-1113.099) [-1110.144] (-1112.888) (-1110.046) -- 0:00:03 946500 -- (-1112.779) [-1117.879] (-1113.075) (-1113.684) * (-1113.668) (-1113.960) [-1112.354] (-1110.894) -- 0:00:03 947000 -- (-1111.051) (-1109.456) [-1113.831] (-1114.774) * (-1110.987) (-1116.409) (-1113.149) [-1113.861] -- 0:00:03 947500 -- (-1112.701) (-1109.974) [-1114.408] (-1111.099) * (-1111.419) [-1113.973] (-1112.190) (-1116.455) -- 0:00:03 948000 -- (-1112.056) [-1109.641] (-1109.353) (-1111.916) * (-1114.900) [-1112.667] (-1111.629) (-1111.168) -- 0:00:03 948500 -- (-1111.979) (-1111.287) (-1109.805) [-1109.815] * (-1110.413) [-1113.745] (-1110.206) (-1110.948) -- 0:00:03 949000 -- (-1113.215) [-1110.299] (-1110.343) (-1111.825) * (-1110.981) [-1112.208] (-1110.062) (-1112.571) -- 0:00:03 949500 -- (-1111.156) (-1112.517) (-1111.693) [-1111.123] * [-1114.412] (-1113.898) (-1114.661) (-1112.876) -- 0:00:03 950000 -- (-1111.782) [-1113.066] (-1112.179) (-1111.747) * (-1115.188) (-1111.996) (-1109.701) [-1111.155] -- 0:00:03 Average standard deviation of split frequencies: 0.009236 950500 -- (-1110.514) (-1110.593) (-1111.387) [-1112.540] * [-1112.226] (-1110.733) (-1110.354) (-1111.536) -- 0:00:03 951000 -- (-1112.847) (-1113.884) (-1111.222) [-1111.316] * (-1110.781) (-1111.538) (-1110.743) [-1110.706] -- 0:00:03 951500 -- [-1111.212] (-1113.521) (-1115.206) (-1110.919) * (-1112.890) [-1109.953] (-1109.383) (-1115.040) -- 0:00:03 952000 -- (-1111.421) (-1111.017) (-1110.740) [-1114.486] * [-1113.308] (-1110.436) (-1109.574) (-1114.472) -- 0:00:03 952500 -- (-1112.753) [-1109.887] (-1112.302) (-1111.491) * (-1112.101) (-1110.260) (-1111.925) [-1111.854] -- 0:00:03 953000 -- (-1115.732) (-1111.212) (-1111.536) [-1113.053] * [-1112.829] (-1111.330) (-1112.175) (-1112.499) -- 0:00:03 953500 -- (-1110.857) (-1110.899) [-1114.539] (-1114.252) * (-1112.547) (-1111.177) (-1113.263) [-1112.749] -- 0:00:03 954000 -- [-1110.508] (-1113.404) (-1109.846) (-1114.179) * [-1111.202] (-1112.724) (-1112.063) (-1113.049) -- 0:00:03 954500 -- [-1112.710] (-1111.935) (-1112.008) (-1111.701) * [-1111.866] (-1112.163) (-1110.503) (-1111.700) -- 0:00:03 955000 -- [-1113.343] (-1120.021) (-1111.043) (-1110.998) * [-1112.922] (-1111.529) (-1113.253) (-1109.638) -- 0:00:02 Average standard deviation of split frequencies: 0.008942 955500 -- [-1111.161] (-1114.277) (-1113.117) (-1110.917) * (-1112.677) [-1111.764] (-1111.274) (-1112.273) -- 0:00:02 956000 -- (-1111.890) (-1115.222) [-1114.533] (-1112.517) * (-1110.288) (-1111.067) (-1112.876) [-1112.497] -- 0:00:02 956500 -- (-1113.444) (-1117.614) [-1111.562] (-1111.739) * (-1113.117) (-1109.607) (-1114.171) [-1114.542] -- 0:00:02 957000 -- [-1112.394] (-1109.951) (-1110.265) (-1111.908) * (-1113.617) (-1112.326) [-1110.109] (-1111.810) -- 0:00:02 957500 -- (-1117.099) (-1112.560) (-1113.611) [-1111.019] * [-1113.458] (-1116.750) (-1111.325) (-1109.974) -- 0:00:02 958000 -- (-1115.094) [-1110.463] (-1119.089) (-1112.007) * (-1112.570) (-1111.452) [-1110.769] (-1111.572) -- 0:00:02 958500 -- (-1114.917) (-1110.597) (-1111.156) [-1111.792] * [-1111.953] (-1111.775) (-1112.816) (-1115.661) -- 0:00:02 959000 -- [-1111.890] (-1115.283) (-1111.550) (-1110.700) * (-1111.099) [-1111.811] (-1112.386) (-1114.744) -- 0:00:02 959500 -- (-1109.827) (-1110.865) (-1117.607) [-1109.907] * (-1116.735) [-1110.954] (-1111.316) (-1111.590) -- 0:00:02 960000 -- (-1110.559) (-1110.222) (-1114.826) [-1112.119] * (-1111.892) (-1111.406) [-1109.781] (-1111.730) -- 0:00:02 Average standard deviation of split frequencies: 0.008373 960500 -- (-1110.506) (-1113.556) (-1116.900) [-1110.039] * (-1115.729) (-1110.987) (-1115.186) [-1111.602] -- 0:00:02 961000 -- (-1111.016) [-1114.963] (-1110.848) (-1116.360) * (-1118.047) (-1113.181) (-1110.964) [-1111.376] -- 0:00:02 961500 -- (-1113.700) (-1113.080) (-1110.819) [-1119.302] * (-1113.588) (-1110.914) (-1109.950) [-1110.437] -- 0:00:02 962000 -- (-1113.298) [-1111.571] (-1111.301) (-1110.561) * (-1114.829) (-1110.741) [-1110.048] (-1111.357) -- 0:00:02 962500 -- (-1115.153) (-1114.154) (-1111.881) [-1112.465] * (-1112.083) (-1110.127) [-1113.468] (-1111.448) -- 0:00:02 963000 -- (-1112.059) (-1110.426) [-1112.902] (-1117.272) * (-1113.863) (-1110.229) [-1113.816] (-1110.720) -- 0:00:02 963500 -- (-1111.167) (-1110.513) (-1114.756) [-1112.554] * (-1112.596) [-1110.235] (-1113.414) (-1110.864) -- 0:00:02 964000 -- [-1110.357] (-1110.636) (-1111.844) (-1112.062) * (-1113.515) (-1110.098) (-1110.139) [-1110.201] -- 0:00:02 964500 -- (-1110.175) (-1111.428) (-1115.306) [-1111.682] * (-1111.740) (-1110.253) [-1110.829] (-1110.206) -- 0:00:02 965000 -- (-1112.319) [-1111.545] (-1112.170) (-1112.241) * [-1110.237] (-1114.017) (-1110.925) (-1110.941) -- 0:00:02 Average standard deviation of split frequencies: 0.008267 965500 -- (-1111.380) (-1110.391) (-1110.687) [-1110.145] * [-1110.528] (-1111.256) (-1115.692) (-1110.613) -- 0:00:02 966000 -- (-1110.762) (-1111.904) [-1109.580] (-1113.992) * (-1109.809) (-1112.369) [-1110.448] (-1111.223) -- 0:00:02 966500 -- (-1112.278) (-1112.077) (-1112.584) [-1111.479] * [-1110.959] (-1113.702) (-1111.772) (-1111.000) -- 0:00:02 967000 -- (-1111.524) [-1112.284] (-1113.668) (-1111.618) * (-1111.705) [-1112.550] (-1110.640) (-1118.722) -- 0:00:02 967500 -- (-1111.981) [-1115.013] (-1110.496) (-1110.221) * (-1113.171) (-1112.994) [-1110.789] (-1113.662) -- 0:00:02 968000 -- (-1112.854) (-1119.307) [-1114.081] (-1111.962) * (-1111.547) [-1110.934] (-1111.109) (-1111.722) -- 0:00:02 968500 -- (-1110.744) (-1111.169) (-1110.950) [-1110.684] * (-1111.007) [-1113.764] (-1111.402) (-1111.190) -- 0:00:02 969000 -- (-1109.969) (-1110.311) [-1111.462] (-1110.532) * (-1118.428) (-1109.785) (-1116.935) [-1110.651] -- 0:00:02 969500 -- (-1110.503) (-1115.934) (-1113.877) [-1110.984] * (-1120.885) (-1109.620) (-1113.617) [-1113.240] -- 0:00:02 970000 -- (-1113.172) (-1115.848) [-1110.794] (-1111.490) * (-1118.393) (-1114.533) [-1115.370] (-1114.017) -- 0:00:01 Average standard deviation of split frequencies: 0.008113 970500 -- [-1113.495] (-1113.243) (-1114.691) (-1109.789) * (-1115.486) [-1111.823] (-1117.130) (-1111.958) -- 0:00:01 971000 -- (-1115.054) (-1114.012) (-1111.317) [-1109.849] * (-1113.529) [-1111.328] (-1115.100) (-1113.711) -- 0:00:01 971500 -- (-1112.642) [-1110.506] (-1115.000) (-1110.828) * (-1112.860) (-1116.245) [-1111.431] (-1110.994) -- 0:00:01 972000 -- (-1114.166) (-1111.033) [-1113.448] (-1110.758) * [-1109.869] (-1112.190) (-1109.442) (-1111.122) -- 0:00:01 972500 -- (-1113.905) [-1110.156] (-1114.870) (-1110.906) * [-1109.894] (-1112.891) (-1109.861) (-1113.258) -- 0:00:01 973000 -- (-1111.386) (-1111.948) (-1112.680) [-1110.796] * (-1111.688) (-1111.456) [-1110.401] (-1112.269) -- 0:00:01 973500 -- [-1114.644] (-1115.468) (-1112.114) (-1112.246) * [-1110.975] (-1112.289) (-1112.062) (-1115.771) -- 0:00:01 974000 -- [-1110.598] (-1110.175) (-1111.112) (-1111.257) * [-1110.883] (-1113.742) (-1110.107) (-1111.030) -- 0:00:01 974500 -- (-1113.838) (-1109.865) [-1111.297] (-1112.042) * (-1110.464) [-1111.284] (-1113.458) (-1111.696) -- 0:00:01 975000 -- (-1115.599) (-1110.844) [-1111.041] (-1115.287) * (-1111.589) (-1110.667) (-1111.112) [-1110.870] -- 0:00:01 Average standard deviation of split frequencies: 0.008392 975500 -- (-1112.210) [-1112.385] (-1115.441) (-1111.042) * [-1110.919] (-1112.324) (-1111.892) (-1112.463) -- 0:00:01 976000 -- (-1111.988) (-1110.014) [-1110.243] (-1110.006) * (-1112.239) (-1113.371) (-1112.557) [-1109.540] -- 0:00:01 976500 -- (-1116.204) (-1112.665) (-1111.598) [-1110.511] * [-1110.875] (-1113.307) (-1112.270) (-1111.319) -- 0:00:01 977000 -- [-1114.673] (-1110.797) (-1113.777) (-1111.180) * [-1110.969] (-1111.164) (-1114.898) (-1112.015) -- 0:00:01 977500 -- (-1114.824) [-1111.796] (-1110.434) (-1114.041) * (-1110.788) (-1114.884) [-1112.667] (-1110.890) -- 0:00:01 978000 -- (-1110.822) (-1112.064) [-1112.132] (-1113.916) * (-1110.916) (-1113.019) [-1111.039] (-1111.115) -- 0:00:01 978500 -- [-1110.356] (-1110.643) (-1111.567) (-1111.397) * [-1111.411] (-1110.608) (-1110.634) (-1110.550) -- 0:00:01 979000 -- (-1110.318) [-1113.723] (-1111.881) (-1114.171) * (-1115.938) [-1110.140] (-1110.640) (-1110.586) -- 0:00:01 979500 -- (-1110.458) (-1111.663) (-1116.366) [-1111.747] * (-1112.038) [-1111.781] (-1111.348) (-1109.444) -- 0:00:01 980000 -- (-1111.163) (-1111.098) (-1110.652) [-1109.634] * (-1110.859) (-1115.460) (-1113.016) [-1110.724] -- 0:00:01 Average standard deviation of split frequencies: 0.008562 980500 -- (-1112.395) [-1111.669] (-1111.988) (-1111.828) * (-1114.105) [-1113.009] (-1110.528) (-1113.091) -- 0:00:01 981000 -- [-1110.206] (-1110.679) (-1110.232) (-1111.643) * (-1110.825) (-1115.806) (-1111.598) [-1112.249] -- 0:00:01 981500 -- (-1113.948) (-1111.701) (-1113.065) [-1112.813] * (-1109.398) [-1111.071] (-1110.114) (-1111.788) -- 0:00:01 982000 -- [-1115.875] (-1111.051) (-1116.424) (-1111.393) * (-1111.716) (-1110.201) [-1109.930] (-1111.430) -- 0:00:01 982500 -- (-1115.469) (-1112.815) [-1113.970] (-1111.661) * [-1111.609] (-1110.199) (-1109.738) (-1110.987) -- 0:00:01 983000 -- (-1110.194) (-1114.262) (-1111.668) [-1111.292] * (-1113.032) (-1113.673) (-1110.601) [-1111.104] -- 0:00:01 983500 -- (-1113.203) (-1110.639) (-1111.341) [-1113.029] * (-1111.347) (-1110.552) [-1110.976] (-1111.785) -- 0:00:01 984000 -- [-1109.966] (-1112.692) (-1110.610) (-1113.939) * [-1112.905] (-1112.896) (-1111.207) (-1115.153) -- 0:00:01 984500 -- (-1111.032) (-1110.857) (-1112.434) [-1112.029] * (-1112.447) (-1109.773) [-1112.046] (-1111.659) -- 0:00:01 985000 -- (-1111.781) (-1109.696) [-1113.236] (-1110.134) * (-1109.972) (-1111.595) [-1114.477] (-1115.185) -- 0:00:00 Average standard deviation of split frequencies: 0.008815 985500 -- (-1114.330) (-1110.291) (-1119.489) [-1111.605] * (-1110.025) (-1109.855) (-1113.073) [-1110.662] -- 0:00:00 986000 -- (-1110.655) [-1112.448] (-1113.714) (-1113.106) * (-1109.829) (-1110.078) (-1114.265) [-1110.464] -- 0:00:00 986500 -- [-1120.466] (-1111.006) (-1113.072) (-1113.331) * [-1112.073] (-1113.972) (-1112.325) (-1112.144) -- 0:00:00 987000 -- (-1113.132) [-1111.554] (-1112.229) (-1117.552) * (-1114.865) (-1110.399) (-1112.174) [-1110.534] -- 0:00:00 987500 -- (-1112.220) [-1110.433] (-1110.284) (-1115.547) * (-1113.802) [-1110.872] (-1115.196) (-1110.134) -- 0:00:00 988000 -- (-1112.958) (-1112.561) [-1111.701] (-1113.184) * (-1112.488) (-1111.081) (-1111.062) [-1110.866] -- 0:00:00 988500 -- [-1114.498] (-1112.412) (-1114.063) (-1113.604) * [-1111.410] (-1111.798) (-1111.102) (-1119.768) -- 0:00:00 989000 -- [-1113.484] (-1114.226) (-1111.861) (-1112.159) * (-1112.279) (-1109.823) [-1111.310] (-1117.481) -- 0:00:00 989500 -- [-1113.966] (-1110.105) (-1111.710) (-1113.065) * [-1112.666] (-1110.160) (-1111.708) (-1116.281) -- 0:00:00 990000 -- (-1112.839) [-1110.439] (-1111.549) (-1111.737) * (-1117.405) (-1110.349) [-1110.515] (-1111.208) -- 0:00:00 Average standard deviation of split frequencies: 0.009041 990500 -- (-1112.212) [-1114.405] (-1112.382) (-1109.977) * [-1110.920] (-1110.160) (-1115.023) (-1111.649) -- 0:00:00 991000 -- (-1115.298) (-1111.531) (-1112.346) [-1110.633] * (-1111.273) (-1111.495) [-1114.001] (-1109.968) -- 0:00:00 991500 -- [-1113.917] (-1112.510) (-1110.663) (-1112.803) * (-1112.454) [-1111.767] (-1112.510) (-1112.259) -- 0:00:00 992000 -- (-1111.049) (-1115.463) [-1112.569] (-1112.279) * [-1111.646] (-1110.921) (-1114.315) (-1116.810) -- 0:00:00 992500 -- (-1112.545) (-1116.604) [-1109.800] (-1112.196) * (-1112.625) (-1112.090) (-1110.373) [-1114.643] -- 0:00:00 993000 -- (-1113.043) [-1112.117] (-1109.562) (-1114.424) * (-1111.681) (-1111.873) [-1110.582] (-1112.595) -- 0:00:00 993500 -- [-1110.612] (-1114.566) (-1110.605) (-1112.881) * [-1110.535] (-1110.786) (-1113.531) (-1110.378) -- 0:00:00 994000 -- (-1110.782) [-1115.693] (-1111.068) (-1111.005) * (-1113.248) [-1115.526] (-1111.718) (-1113.884) -- 0:00:00 994500 -- [-1111.078] (-1113.963) (-1110.557) (-1110.237) * (-1117.279) [-1114.046] (-1111.293) (-1109.819) -- 0:00:00 995000 -- (-1112.227) (-1110.681) [-1111.104] (-1111.867) * (-1114.078) [-1111.411] (-1109.978) (-1111.429) -- 0:00:00 Average standard deviation of split frequencies: 0.009141 995500 -- (-1113.118) [-1112.942] (-1110.409) (-1110.081) * [-1110.327] (-1111.159) (-1111.310) (-1110.099) -- 0:00:00 996000 -- (-1112.569) [-1115.156] (-1110.065) (-1109.934) * [-1117.927] (-1110.260) (-1112.329) (-1110.753) -- 0:00:00 996500 -- (-1112.288) (-1112.241) (-1112.246) [-1110.814] * [-1110.523] (-1110.014) (-1111.853) (-1111.885) -- 0:00:00 997000 -- [-1115.347] (-1113.849) (-1111.808) (-1113.312) * (-1113.126) [-1110.173] (-1112.053) (-1116.526) -- 0:00:00 997500 -- (-1111.991) (-1114.548) (-1117.702) [-1110.371] * (-1120.466) [-1110.902] (-1111.842) (-1112.719) -- 0:00:00 998000 -- [-1110.156] (-1113.256) (-1113.236) (-1110.525) * (-1119.371) (-1109.703) (-1109.657) [-1112.700] -- 0:00:00 998500 -- (-1110.324) (-1111.925) [-1110.495] (-1111.239) * (-1116.487) (-1110.440) (-1113.297) [-1109.924] -- 0:00:00 999000 -- (-1110.447) (-1113.440) [-1110.348] (-1113.239) * [-1110.819] (-1110.634) (-1115.704) (-1109.927) -- 0:00:00 999500 -- (-1114.411) [-1111.474] (-1111.048) (-1112.635) * (-1111.480) (-1110.632) (-1109.911) [-1110.737] -- 0:00:00 1000000 -- [-1110.632] (-1111.536) (-1111.619) (-1110.562) * (-1110.273) [-1110.397] (-1110.074) (-1114.341) -- 0:00:00 Average standard deviation of split frequencies: 0.008921 Analysis completed in 1 mins 6 seconds Analysis used 64.33 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1109.27 Likelihood of best state for "cold" chain of run 2 was -1109.27 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.8 % ( 70 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 26.4 % ( 28 %) Dirichlet(Pi{all}) 29.0 % ( 23 %) Slider(Pi{all}) 79.3 % ( 52 %) Multiplier(Alpha{1,2}) 78.4 % ( 55 %) Multiplier(Alpha{3}) 19.4 % ( 23 %) Slider(Pinvar{all}) 98.6 % ( 97 %) ExtSPR(Tau{all},V{all}) 70.0 % ( 74 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.7 % ( 91 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 21 %) Multiplier(V{all}) 97.4 % ( 97 %) Nodeslider(V{all}) 30.1 % ( 16 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 75.4 % ( 74 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 26.6 % ( 25 %) Dirichlet(Pi{all}) 28.9 % ( 29 %) Slider(Pi{all}) 78.7 % ( 51 %) Multiplier(Alpha{1,2}) 77.8 % ( 52 %) Multiplier(Alpha{3}) 19.5 % ( 30 %) Slider(Pinvar{all}) 98.6 % ( 99 %) ExtSPR(Tau{all},V{all}) 70.4 % ( 75 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 89 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 26 %) Multiplier(V{all}) 97.4 % ( 98 %) Nodeslider(V{all}) 30.7 % ( 29 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166761 0.82 0.67 3 | 166982 166912 0.84 4 | 166423 166700 166222 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166325 0.82 0.67 3 | 166544 166917 0.83 4 | 166487 166802 166925 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1110.70 | 2 | | | | 2 1 | | 1 12 2 2 | | 11 1 2 2 2 2 2 2 2 | | 2 1*1 2 1 1 1 1 1 1 1 1 2 2 | |* 1 1 11 2 1 1 11 22 2 12 | | 12 2 2 211 211 2 1 22 1 21 | | 2 1 2 1 2 1 122 1 2 1 2| | 2 2 1 * 1 2 2 1 1 1 1 2 | | 1 2 2 2 1 2 11 1* 1| | 2 2 2 12 | | 2 2 1 1 | | 1 2* | | 2 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1112.74 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1110.95 -1116.25 2 -1111.01 -1114.04 -------------------------------------- TOTAL -1110.98 -1115.66 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898407 0.085046 0.358458 1.463366 0.868765 1501.00 1501.00 1.000 r(A<->C){all} 0.153167 0.017877 0.000109 0.426474 0.117168 192.00 193.11 1.001 r(A<->G){all} 0.172905 0.021451 0.000119 0.474471 0.134703 221.19 237.59 1.002 r(A<->T){all} 0.161169 0.018959 0.000053 0.442735 0.122687 415.33 424.54 1.000 r(C<->G){all} 0.179303 0.020589 0.000006 0.468777 0.147868 222.77 302.26 1.009 r(C<->T){all} 0.165050 0.021208 0.000008 0.466203 0.122026 165.04 169.95 1.000 r(G<->T){all} 0.168407 0.019792 0.000012 0.455699 0.130199 250.18 259.67 1.001 pi(A){all} 0.194612 0.000192 0.169568 0.224507 0.194529 1090.14 1220.43 1.001 pi(C){all} 0.289595 0.000241 0.259497 0.319912 0.289711 1156.27 1314.83 1.000 pi(G){all} 0.340704 0.000276 0.308668 0.373637 0.340468 1248.49 1315.05 1.000 pi(T){all} 0.175090 0.000174 0.150475 0.201502 0.174776 1204.26 1205.32 1.000 alpha{1,2} 0.421717 0.241729 0.000148 1.402246 0.246173 953.81 1075.28 1.002 alpha{3} 0.450212 0.242088 0.000236 1.412011 0.279265 1177.13 1250.52 1.000 pinvar{all} 0.998146 0.000005 0.994120 1.000000 0.998829 1047.43 1114.52 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ..**** 8 -- ...*.* 9 -- ..*.*. 10 -- ....** 11 -- .**... 12 -- ...**. 13 -- .*..*. 14 -- .*.*.. 15 -- .***.* 16 -- ..*..* 17 -- .****. 18 -- .*...* 19 -- .**.** 20 -- ..**.. 21 -- .*.*** 22 -- .**.*. ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 476 0.158561 0.006595 0.153897 0.163225 2 8 448 0.149234 0.010364 0.141905 0.156562 2 9 446 0.148568 0.002827 0.146569 0.150566 2 10 444 0.147901 0.007537 0.142572 0.153231 2 11 441 0.146902 0.015546 0.135909 0.157895 2 12 435 0.144903 0.003298 0.142572 0.147235 2 13 434 0.144570 0.000942 0.143904 0.145237 2 14 432 0.143904 0.002827 0.141905 0.145903 2 15 425 0.141572 0.012719 0.132578 0.150566 2 16 418 0.139241 0.011306 0.131246 0.147235 2 17 416 0.138574 0.016959 0.126582 0.150566 2 18 405 0.134910 0.018373 0.121919 0.147901 2 19 403 0.134244 0.011777 0.125916 0.142572 2 20 400 0.133245 0.003769 0.130580 0.135909 2 21 395 0.131579 0.010835 0.123917 0.139241 2 22 293 0.097602 0.007066 0.092605 0.102598 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.102595 0.010477 0.000014 0.320258 0.069483 1.000 2 length{all}[2] 0.095947 0.009211 0.000001 0.288727 0.066363 1.001 2 length{all}[3] 0.100116 0.010200 0.000016 0.294708 0.067873 1.000 2 length{all}[4] 0.103238 0.009864 0.000016 0.303753 0.073872 1.001 2 length{all}[5] 0.098180 0.009535 0.000027 0.288766 0.067415 1.000 2 length{all}[6] 0.099807 0.009892 0.000106 0.301316 0.070413 1.000 2 length{all}[7] 0.097318 0.009449 0.000051 0.292556 0.072366 1.005 2 length{all}[8] 0.094616 0.006627 0.000189 0.251260 0.071956 1.004 2 length{all}[9] 0.096140 0.008927 0.000376 0.281576 0.070631 1.017 2 length{all}[10] 0.095109 0.007537 0.000827 0.277508 0.074336 0.998 2 length{all}[11] 0.098510 0.009444 0.000053 0.282277 0.071432 1.004 2 length{all}[12] 0.093787 0.008545 0.000106 0.278491 0.069444 1.001 2 length{all}[13] 0.096553 0.009947 0.000287 0.283789 0.063784 0.998 2 length{all}[14] 0.097496 0.008362 0.000104 0.291378 0.069270 1.006 2 length{all}[15] 0.110466 0.011454 0.000193 0.321162 0.075480 0.998 2 length{all}[16] 0.097485 0.008926 0.000328 0.289261 0.067621 0.998 2 length{all}[17] 0.106039 0.013127 0.000852 0.323421 0.066800 1.003 2 length{all}[18] 0.099685 0.010729 0.000154 0.291736 0.067361 1.001 2 length{all}[19] 0.111151 0.011006 0.000799 0.327103 0.076254 0.998 2 length{all}[20] 0.097404 0.009860 0.000214 0.264011 0.066722 0.997 2 length{all}[21] 0.097210 0.007998 0.000131 0.273382 0.069108 0.999 2 length{all}[22] 0.097971 0.010454 0.000507 0.299003 0.066254 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.008921 Maximum standard deviation of split frequencies = 0.018373 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001 Maximum PSRF for parameter values = 1.017 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /-------------------------------------------------------------------- C1 (1) | |----------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------ C5 (5) | \--------------------------------------------------------------------- C6 (6) |--------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 44 trees 90 % credible set contains 90 trees 95 % credible set contains 97 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 822 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 56 patterns at 274 / 274 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 56 patterns at 274 / 274 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 54656 bytes for conP 4928 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.015498 0.040813 0.013822 0.091207 0.063594 0.013228 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1129.839441 Iterating by ming2 Initial: fx= 1129.839441 x= 0.01550 0.04081 0.01382 0.09121 0.06359 0.01323 0.30000 1.30000 1 h-m-p 0.0000 0.0000 661.4645 ++ 1108.500135 m 0.0000 13 | 1/8 2 h-m-p 0.0005 0.0217 60.3797 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 604.8044 ++ 1107.699708 m 0.0000 44 | 2/8 4 h-m-p 0.0001 0.0259 50.5733 ---------.. | 2/8 5 h-m-p 0.0000 0.0000 540.1526 ++ 1105.897668 m 0.0000 73 | 3/8 6 h-m-p 0.0001 0.0329 40.0131 ---------.. | 3/8 7 h-m-p 0.0000 0.0001 466.7469 ++ 1085.417481 m 0.0001 102 | 4/8 8 h-m-p 0.0012 0.0438 30.1440 -----------.. | 4/8 9 h-m-p 0.0000 0.0001 382.1164 ++ 1073.009367 m 0.0001 133 | 5/8 10 h-m-p 0.0011 0.0640 20.6733 -----------.. | 5/8 11 h-m-p 0.0000 0.0001 270.6916 ++ 1065.414765 m 0.0001 164 | 6/8 12 h-m-p 0.6181 8.0000 0.0000 ++ 1065.414765 m 8.0000 175 | 6/8 13 h-m-p 0.0850 8.0000 0.0010 ++++ 1065.414765 m 8.0000 190 | 6/8 14 h-m-p 0.0037 0.1541 2.0536 -------Y 1065.414765 0 0.0000 210 | 6/8 15 h-m-p 0.1563 8.0000 0.0000 ---Y 1065.414765 0 0.0006 224 | 6/8 16 h-m-p 0.0486 8.0000 0.0000 --Y 1065.414765 0 0.0008 239 Out.. lnL = -1065.414765 240 lfun, 240 eigenQcodon, 1440 P(t) Time used: 0:01 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.063681 0.029205 0.052427 0.087854 0.015839 0.078842 0.307562 0.686340 0.456486 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 9.714981 np = 9 lnL0 = -1151.936554 Iterating by ming2 Initial: fx= 1151.936554 x= 0.06368 0.02920 0.05243 0.08785 0.01584 0.07884 0.30756 0.68634 0.45649 1 h-m-p 0.0000 0.0001 634.6879 ++ 1127.392220 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0002 380.9568 ++ 1109.550982 m 0.0002 26 | 2/9 3 h-m-p 0.0000 0.0001 546.6655 ++ 1086.446405 m 0.0001 38 | 3/9 4 h-m-p 0.0001 0.0003 252.8304 ++ 1075.866969 m 0.0003 50 | 4/9 5 h-m-p 0.0000 0.0000 4597716.3983 ++ 1067.578773 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 155195.9453 ++ 1065.414660 m 0.0000 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0001 ++ 1065.414660 m 8.0000 86 | 6/9 8 h-m-p 0.0058 2.9189 0.3408 ------------.. | 6/9 9 h-m-p 0.0160 8.0000 0.0003 +++++ 1065.414659 m 8.0000 129 | 6/9 10 h-m-p 0.0095 3.9725 0.2484 -----------Y 1065.414659 0 0.0000 155 | 6/9 11 h-m-p 0.0160 8.0000 0.0019 +++++ 1065.414655 m 8.0000 173 | 6/9 12 h-m-p 0.0553 3.3875 0.2736 --------------.. | 6/9 13 h-m-p 0.0160 8.0000 0.0003 +++++ 1065.414654 m 8.0000 218 | 6/9 14 h-m-p 0.0105 4.1934 0.2408 ---------C 1065.414654 0 0.0000 242 | 6/9 15 h-m-p 0.0160 8.0000 0.0021 +++++ 1065.414649 m 8.0000 260 | 6/9 16 h-m-p 0.0611 3.5424 0.2695 -----------C 1065.414649 0 0.0000 286 | 6/9 17 h-m-p 0.0160 8.0000 0.0004 +++++ 1065.414648 m 8.0000 304 | 6/9 18 h-m-p 0.0051 1.4968 0.5732 ----------C 1065.414648 0 0.0000 329 | 6/9 19 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/9 20 h-m-p 0.0160 8.0000 0.0003 +++++ 1065.414647 m 8.0000 373 | 6/9 21 h-m-p 0.0117 4.4145 0.2337 ---------Y 1065.414647 0 0.0000 397 | 6/9 22 h-m-p 0.0160 8.0000 0.0056 +++++ 1065.414631 m 8.0000 415 | 6/9 23 h-m-p 0.1751 3.5703 0.2562 ------------Y 1065.414631 0 0.0000 442 | 6/9 24 h-m-p 0.0160 8.0000 0.0194 +++++ 1065.414536 m 8.0000 460 | 6/9 25 h-m-p 0.5666 4.0071 0.2735 -------------Y 1065.414536 0 0.0000 488 | 6/9 26 h-m-p 0.0160 8.0000 0.0009 +++++ 1065.414529 m 8.0000 506 | 6/9 27 h-m-p 0.0468 7.9647 0.1488 --------------.. | 6/9 28 h-m-p 0.0160 8.0000 0.0010 +++++ 1065.414520 m 8.0000 551 | 6/9 29 h-m-p 0.0571 8.0000 0.1431 --------------.. | 6/9 30 h-m-p 0.0160 8.0000 0.0011 +++++ 1065.414511 m 8.0000 596 | 6/9 31 h-m-p 0.0622 8.0000 0.1392 --------------.. | 6/9 32 h-m-p 0.0160 8.0000 0.0012 +++++ 1065.414500 m 8.0000 641 | 6/9 33 h-m-p 0.0683 8.0000 0.1353 -----------C 1065.414500 0 0.0000 667 | 6/9 34 h-m-p 0.0160 8.0000 0.0022 +++++ 1065.414483 m 8.0000 685 | 6/9 35 h-m-p 0.0906 5.8019 0.1910 ------------C 1065.414483 0 0.0000 712 | 6/9 36 h-m-p 0.0160 8.0000 0.0022 +++++ 1065.414469 m 8.0000 730 | 6/9 37 h-m-p 0.0723 8.0000 0.2457 -------------C 1065.414469 0 0.0000 758 | 6/9 38 h-m-p 0.0160 8.0000 0.0002 ------N 1065.414469 0 0.0000 779 | 6/9 39 h-m-p 0.0160 8.0000 0.0002 -------C 1065.414469 0 0.0000 801 Out.. lnL = -1065.414469 802 lfun, 2406 eigenQcodon, 9624 P(t) Time used: 0:04 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.038140 0.021030 0.073407 0.057194 0.031334 0.054962 0.264254 1.272268 0.151235 0.305268 1.325826 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 9.920622 np = 11 lnL0 = -1136.864627 Iterating by ming2 Initial: fx= 1136.864627 x= 0.03814 0.02103 0.07341 0.05719 0.03133 0.05496 0.26425 1.27227 0.15124 0.30527 1.32583 1 h-m-p 0.0000 0.0001 610.1939 ++ 1105.086956 m 0.0001 16 | 1/11 2 h-m-p 0.0001 0.0003 222.3625 ++ 1091.193680 m 0.0003 30 | 2/11 3 h-m-p 0.0000 0.0000 4486.6183 ++ 1084.265090 m 0.0000 44 | 3/11 4 h-m-p 0.0000 0.0000 2524.7546 ++ 1070.871789 m 0.0000 58 | 4/11 5 h-m-p 0.0000 0.0000 22987.6752 ++ 1069.676247 m 0.0000 72 | 5/11 6 h-m-p 0.0000 0.0000 358245.4427 ++ 1067.430247 m 0.0000 86 | 6/11 7 h-m-p 0.0029 0.0945 6.4110 ------------.. | 6/11 8 h-m-p 0.0000 0.0000 265.6580 ++ 1065.414664 m 0.0000 124 | 7/11 9 h-m-p 0.0600 8.0000 0.0000 ++++ 1065.414664 m 8.0000 140 | 7/11 10 h-m-p 0.0244 8.0000 0.0053 +++++ 1065.414664 m 8.0000 161 | 7/11 11 h-m-p 0.0104 0.2849 4.1082 -------------.. | 7/11 12 h-m-p 0.0160 8.0000 0.0001 +++++ 1065.414664 m 8.0000 207 | 7/11 13 h-m-p 0.0051 2.5684 0.2397 +++++ 1065.414585 m 2.5684 228 | 8/11 14 h-m-p 0.3377 8.0000 1.6677 ---------------.. | 8/11 15 h-m-p 0.0160 8.0000 0.0001 +++++ 1065.414585 m 8.0000 276 | 8/11 16 h-m-p 0.0160 8.0000 0.8677 ------------N 1065.414585 0 0.0000 305 | 8/11 17 h-m-p 0.0160 8.0000 0.0148 +++++ 1065.414569 m 8.0000 325 | 8/11 18 h-m-p 0.0286 8.0000 4.1308 -------------Y 1065.414569 0 0.0000 355 | 8/11 19 h-m-p 0.0160 8.0000 0.0001 +++++ 1065.414569 m 8.0000 372 | 8/11 20 h-m-p 0.0002 0.1017 24.2833 ---------Y 1065.414569 0 0.0000 398 | 8/11 21 h-m-p 0.0160 8.0000 0.0000 ---Y 1065.414569 0 0.0001 415 | 8/11 22 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11 23 h-m-p 0.0160 8.0000 0.0001 +++++ 1065.414569 m 8.0000 463 | 8/11 24 h-m-p 0.0160 8.0000 4.5500 ------------C 1065.414569 0 0.0000 492 | 8/11 25 h-m-p 0.0102 5.1005 0.0031 +++++ 1065.414567 m 5.1005 509 | 9/11 26 h-m-p 0.0160 8.0000 1.8972 -------------.. | 9/11 27 h-m-p 0.0160 8.0000 0.0001 +++++ 1065.414567 m 8.0000 554 | 9/11 28 h-m-p 0.0160 8.0000 1.2196 +++++ 1065.414313 m 8.0000 573 | 9/11 29 h-m-p 1.6000 8.0000 0.0033 ++ 1065.414313 m 8.0000 587 | 9/11 30 h-m-p 0.0957 8.0000 0.2717 --------C 1065.414313 0 0.0000 611 | 9/11 31 h-m-p 0.0160 8.0000 0.0000 -N 1065.414313 0 0.0010 628 | 9/11 32 h-m-p 0.0101 5.0726 19.3407 ++++N 1065.414313 0 2.5972 648 | 9/11 33 h-m-p 1.6000 8.0000 0.0000 Y 1065.414313 0 1.6000 662 | 9/11 34 h-m-p 0.0160 8.0000 0.0000 Y 1065.414313 0 0.0160 678 Out.. lnL = -1065.414313 679 lfun, 2716 eigenQcodon, 12222 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1065.473085 S = -1065.415505 -0.022287 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:08 did 20 / 56 patterns 0:08 did 30 / 56 patterns 0:08 did 40 / 56 patterns 0:08 did 50 / 56 patterns 0:08 did 56 / 56 patterns 0:08 Time used: 0:08 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.094540 0.073448 0.019012 0.053562 0.062271 0.086918 0.000100 0.475779 1.768141 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 20.652931 np = 9 lnL0 = -1161.655064 Iterating by ming2 Initial: fx= 1161.655064 x= 0.09454 0.07345 0.01901 0.05356 0.06227 0.08692 0.00011 0.47578 1.76814 1 h-m-p 0.0000 0.0000 570.8402 ++ 1161.346993 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0053 76.1159 +++++ 1135.973741 m 0.0053 29 | 2/9 3 h-m-p 0.0001 0.0004 233.4265 ++ 1110.668376 m 0.0004 41 | 3/9 4 h-m-p 0.0001 0.0005 184.2246 ++ 1091.618767 m 0.0005 53 | 4/9 5 h-m-p 0.0001 0.0005 33.3266 ++ 1082.869086 m 0.0005 65 | 5/9 6 h-m-p 0.0002 0.0008 22.4031 ++ 1082.756072 m 0.0008 77 | 6/9 7 h-m-p 0.0000 0.0002 162.4815 ++ 1077.038914 m 0.0002 89 | 7/9 8 h-m-p 0.0160 8.0000 0.8621 -------------.. | 7/9 9 h-m-p 0.0000 0.0002 239.6994 +++ 1065.414313 m 0.0002 127 | 8/9 10 h-m-p 1.6000 8.0000 0.0000 Y 1065.414313 0 1.6000 139 | 8/9 11 h-m-p 0.0160 8.0000 0.0000 Y 1065.414313 0 0.0160 152 Out.. lnL = -1065.414313 153 lfun, 1683 eigenQcodon, 9180 P(t) Time used: 0:10 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.086339 0.101805 0.071625 0.012636 0.092704 0.067684 0.000100 0.900000 0.281336 1.782740 1.301763 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 19.081176 np = 11 lnL0 = -1164.675282 Iterating by ming2 Initial: fx= 1164.675282 x= 0.08634 0.10180 0.07163 0.01264 0.09270 0.06768 0.00011 0.90000 0.28134 1.78274 1.30176 1 h-m-p 0.0000 0.0000 500.9157 ++ 1164.505231 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0001 508.2747 ++ 1148.483641 m 0.0001 30 | 2/11 3 h-m-p 0.0002 0.0008 214.4776 ++ 1084.996789 m 0.0008 44 | 3/11 4 h-m-p 0.0001 0.0003 173.5306 ++ 1080.776150 m 0.0003 58 | 4/11 5 h-m-p 0.0000 0.0001 2619.1411 ++ 1074.810419 m 0.0001 72 | 5/11 6 h-m-p 0.0009 0.0045 18.4699 -----------.. | 5/11 7 h-m-p 0.0000 0.0000 430.8114 ++ 1069.854181 m 0.0000 109 | 6/11 8 h-m-p 0.0003 0.0043 28.7722 ++ 1066.787610 m 0.0043 123 | 7/11 9 h-m-p 0.0000 0.0001 410.2852 ++ 1065.414437 m 0.0001 137 | 8/11 10 h-m-p 1.6000 8.0000 0.0001 ----------Y 1065.414437 0 0.0000 161 | 8/11 11 h-m-p 0.0160 8.0000 0.0030 +++++ 1065.414412 m 8.0000 181 | 8/11 12 h-m-p 0.1299 3.2719 0.1858 ------------Y 1065.414412 0 0.0000 210 | 8/11 13 h-m-p 0.0160 8.0000 0.0014 +++++ 1065.414402 m 8.0000 230 | 8/11 14 h-m-p 0.0452 7.3686 0.2421 --------------.. | 8/11 15 h-m-p 0.0160 8.0000 0.0021 +++++ 1065.414364 m 8.0000 279 | 8/11 16 h-m-p 0.1415 8.0000 0.1176 ---------------.. | 8/11 17 h-m-p 0.0160 7.9861 0.0024 +++++ 1065.414313 m 7.9861 329 | 9/11 18 h-m-p 1.6000 8.0000 0.0000 -N 1065.414313 0 0.1000 347 Out.. lnL = -1065.414313 348 lfun, 4176 eigenQcodon, 22968 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1065.490302 S = -1065.415504 -0.033370 Calculating f(w|X), posterior probabilities of site classes. did 10 / 56 patterns 0:16 did 20 / 56 patterns 0:16 did 30 / 56 patterns 0:17 did 40 / 56 patterns 0:17 did 50 / 56 patterns 0:17 did 56 / 56 patterns 0:17 Time used: 0:17 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=274 NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ NC_002677_1_NP_301939_1_811_ML1306 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ ************************************************** NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA NC_002677_1_NP_301939_1_811_ML1306 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA ************************************************** NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT NC_002677_1_NP_301939_1_811_ML1306 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT ************************************************** NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV NC_002677_1_NP_301939_1_811_ML1306 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV ************************************************** NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG NC_002677_1_NP_301939_1_811_ML1306 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG ************************************************** NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 KIDGDALAAEFERYLRRRRPGFGR NC_002677_1_NP_301939_1_811_ML1306 KIDGDALAAEFERYLRRRRPGFGR NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 KIDGDALAAEFERYLRRRRPGFGR NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 KIDGDALAAEFERYLRRRRPGFGR NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 KIDGDALAAEFERYLRRRRPGFGR NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 KIDGDALAAEFERYLRRRRPGFGR ************************
>NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >NC_002677_1_NP_301939_1_811_ML1306 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG >NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 GTGGCAGCGTTTGAGGGTTGGAACGATGCCAGCGATGCGGCCAGCGGAGC CCTAGAGCATCTGAATGCCGTCTGGGAAGCCGATCCGATTGTGGAGATCG ACGACGAGGCCTACTACGACTACCAAGTGAATCGCCCGGTCATCCGCCAG GTCGATGGAGTTACTCGGGAGCTGGTGTGGCCAGCGATGCGGATCTCATA CTGTCGCCCACCGGGCAGTGACCGCAATGTGGTGTTGATGCACGGAGTAG AGCCAAACATGCGCTGGCGCACCTTCTGCACTGAGTTGCTGACCATCGCG GACAGGCTCAACGTCGACACTGTCGTGATTCTCGGAGCGTTGCTGGCCGA CACCCCGCATACTCGGCCGGTGCCAGTCTCGGGTGCGGCCTACTCACCGG AGTCGGCGCGGCGCTTCGGTCTGGAGGAAACCCGTTACGAGGGCCCTACA GGGATCGCCGGGGTGTTCCAAGACGCCTGCGTAGCGGCCAGGATACCGGC GGTGATGTTCTGGGCAGCGGTGCCCCACTATGTGTCGCACCCACCCAACC CGAAAGCGACAGTCGCGCTGCTGCGCCGCGTAGAAGACGTGCTCGACGTC GAAGTCCCGTTAGCTGATCTGCCGACGCAAGCCGAGGACTGGGAACAGGC AATCACCGAGATAGCTGCCGAGGACGATGAGCTGGCCGAATACGTGCATT CACTGGAGCAGCGCGGCGACGCCGAGGTCGATGTAAATGATGCGTTGGGC AAGATCGATGGCGACGCGCTGGCAGCCGAGTTCGAACGCTATCTACGTAG GCGGCGCCCGGGATTCGGGCGG
>NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >NC_002677_1_NP_301939_1_811_ML1306 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR >NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 VAAFEGWNDASDAASGALEHLNAVWEADPIVEIDDEAYYDYQVNRPVIRQ VDGVTRELVWPAMRISYCRPPGSDRNVVLMHGVEPNMRWRTFCTELLTIA DRLNVDTVVILGALLADTPHTRPVPVSGAAYSPESARRFGLEETRYEGPT GIAGVFQDACVAARIPAVMFWAAVPHYVSHPPNPKATVALLRRVEDVLDV EVPLADLPTQAEDWEQAITEIAAEDDELAEYVHSLEQRGDAEVDVNDALG KIDGDALAAEFERYLRRRRPGFGR
#NEXUS [ID: 5493071704] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 NC_002677_1_NP_301939_1_811_ML1306 NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 ; end; begin trees; translate 1 NC_011896_1_WP_010908260_1_1375_MLBR_RS06465, 2 NC_002677_1_NP_301939_1_811_ML1306, 3 NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080, 4 NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775, 5 NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090, 6 NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06948257,2:0.06636317,3:0.06787322,4:0.07387188,5:0.06741517,6:0.07041294); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06948257,2:0.06636317,3:0.06787322,4:0.07387188,5:0.06741517,6:0.07041294); end;
Estimated marginal likelihoods for runs sampled in files "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1110.95 -1116.25 2 -1111.01 -1114.04 -------------------------------------- TOTAL -1110.98 -1115.66 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/6res/ML1306/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.898407 0.085046 0.358458 1.463366 0.868765 1501.00 1501.00 1.000 r(A<->C){all} 0.153167 0.017877 0.000109 0.426474 0.117168 192.00 193.11 1.001 r(A<->G){all} 0.172905 0.021451 0.000119 0.474471 0.134703 221.19 237.59 1.002 r(A<->T){all} 0.161169 0.018959 0.000053 0.442735 0.122687 415.33 424.54 1.000 r(C<->G){all} 0.179303 0.020589 0.000006 0.468777 0.147868 222.77 302.26 1.009 r(C<->T){all} 0.165050 0.021208 0.000008 0.466203 0.122026 165.04 169.95 1.000 r(G<->T){all} 0.168407 0.019792 0.000012 0.455699 0.130199 250.18 259.67 1.001 pi(A){all} 0.194612 0.000192 0.169568 0.224507 0.194529 1090.14 1220.43 1.001 pi(C){all} 0.289595 0.000241 0.259497 0.319912 0.289711 1156.27 1314.83 1.000 pi(G){all} 0.340704 0.000276 0.308668 0.373637 0.340468 1248.49 1315.05 1.000 pi(T){all} 0.175090 0.000174 0.150475 0.201502 0.174776 1204.26 1205.32 1.000 alpha{1,2} 0.421717 0.241729 0.000148 1.402246 0.246173 953.81 1075.28 1.002 alpha{3} 0.450212 0.242088 0.000236 1.412011 0.279265 1177.13 1250.52 1.000 pinvar{all} 0.998146 0.000005 0.994120 1.000000 0.998829 1047.43 1114.52 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1306/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 274 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1 TTC 6 6 6 6 6 6 | TCC 0 0 0 0 0 0 | TAC 7 7 7 7 7 7 | TGC 2 2 2 2 2 2 Leu TTA 1 1 1 1 1 1 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 2 2 2 2 2 2 CTC 3 3 3 3 3 3 | CCC 2 2 2 2 2 2 | CAC 3 3 3 3 3 3 | CGC 12 12 12 12 12 12 CTA 2 2 2 2 2 2 | CCA 5 5 5 5 5 5 | Gln CAA 3 3 3 3 3 3 | CGA 0 0 0 0 0 0 CTG 11 11 11 11 11 11 | CCG 11 11 11 11 11 11 | CAG 3 3 3 3 3 3 | CGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 2 2 2 2 | Thr ACT 4 4 4 4 4 4 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1 ATC 7 7 7 7 7 7 | ACC 5 5 5 5 5 5 | AAC 4 4 4 4 4 4 | AGC 2 2 2 2 2 2 ATA 2 2 2 2 2 2 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0 Met ATG 4 4 4 4 4 4 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 1 1 1 1 1 | Ala GCT 2 2 2 2 2 2 | Asp GAT 9 9 9 9 9 9 | Gly GGT 3 3 3 3 3 3 GTC 10 10 10 10 10 10 | GCC 16 16 16 16 16 16 | GAC 14 14 14 14 14 14 | GGC 5 5 5 5 5 5 GTA 4 4 4 4 4 4 | GCA 4 4 4 4 4 4 | Glu GAA 7 7 7 7 7 7 | GGA 5 5 5 5 5 5 GTG 14 14 14 14 14 14 | GCG 14 14 14 14 14 14 | GAG 17 17 17 17 17 17 | GGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010908260_1_1375_MLBR_RS06465 position 1: T:0.13139 C:0.24453 A:0.15693 G:0.46715 position 2: T:0.26277 C:0.26642 A:0.28467 G:0.18613 position 3: T:0.13139 C:0.35766 A:0.14234 G:0.36861 Average T:0.17518 C:0.28954 A:0.19465 G:0.34063 #2: NC_002677_1_NP_301939_1_811_ML1306 position 1: T:0.13139 C:0.24453 A:0.15693 G:0.46715 position 2: T:0.26277 C:0.26642 A:0.28467 G:0.18613 position 3: T:0.13139 C:0.35766 A:0.14234 G:0.36861 Average T:0.17518 C:0.28954 A:0.19465 G:0.34063 #3: NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080 position 1: T:0.13139 C:0.24453 A:0.15693 G:0.46715 position 2: T:0.26277 C:0.26642 A:0.28467 G:0.18613 position 3: T:0.13139 C:0.35766 A:0.14234 G:0.36861 Average T:0.17518 C:0.28954 A:0.19465 G:0.34063 #4: NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775 position 1: T:0.13139 C:0.24453 A:0.15693 G:0.46715 position 2: T:0.26277 C:0.26642 A:0.28467 G:0.18613 position 3: T:0.13139 C:0.35766 A:0.14234 G:0.36861 Average T:0.17518 C:0.28954 A:0.19465 G:0.34063 #5: NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090 position 1: T:0.13139 C:0.24453 A:0.15693 G:0.46715 position 2: T:0.26277 C:0.26642 A:0.28467 G:0.18613 position 3: T:0.13139 C:0.35766 A:0.14234 G:0.36861 Average T:0.17518 C:0.28954 A:0.19465 G:0.34063 #6: NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250 position 1: T:0.13139 C:0.24453 A:0.15693 G:0.46715 position 2: T:0.26277 C:0.26642 A:0.28467 G:0.18613 position 3: T:0.13139 C:0.35766 A:0.14234 G:0.36861 Average T:0.17518 C:0.28954 A:0.19465 G:0.34063 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 6 TTC 36 | TCC 0 | TAC 42 | TGC 12 Leu L TTA 6 | TCA 18 | *** * TAA 0 | *** * TGA 0 TTG 24 | TCG 18 | TAG 0 | Trp W TGG 36 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 12 CTC 18 | CCC 12 | CAC 18 | CGC 72 CTA 12 | CCA 30 | Gln Q CAA 18 | CGA 0 CTG 66 | CCG 66 | CAG 18 | CGG 36 ------------------------------------------------------------------------------ Ile I ATT 12 | Thr T ACT 24 | Asn N AAT 24 | Ser S AGT 6 ATC 42 | ACC 30 | AAC 24 | AGC 12 ATA 12 | ACA 12 | Lys K AAA 6 | Arg R AGA 0 Met M ATG 24 | ACG 6 | AAG 6 | AGG 18 ------------------------------------------------------------------------------ Val V GTT 6 | Ala A GCT 12 | Asp D GAT 54 | Gly G GGT 18 GTC 60 | GCC 96 | GAC 84 | GGC 30 GTA 24 | GCA 24 | Glu E GAA 42 | GGA 30 GTG 84 | GCG 84 | GAG 102 | GGG 18 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.13139 C:0.24453 A:0.15693 G:0.46715 position 2: T:0.26277 C:0.26642 A:0.28467 G:0.18613 position 3: T:0.13139 C:0.35766 A:0.14234 G:0.36861 Average T:0.17518 C:0.28954 A:0.19465 G:0.34063 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1065.414765 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.307562 1.301763 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908260_1_1375_MLBR_RS06465: 0.000004, NC_002677_1_NP_301939_1_811_ML1306: 0.000004, NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080: 0.000004, NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775: 0.000004, NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090: 0.000004, NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.30756 omega (dN/dS) = 1.30176 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 634.5 187.5 1.3018 0.0000 0.0000 0.0 0.0 7..2 0.000 634.5 187.5 1.3018 0.0000 0.0000 0.0 0.0 7..3 0.000 634.5 187.5 1.3018 0.0000 0.0000 0.0 0.0 7..4 0.000 634.5 187.5 1.3018 0.0000 0.0000 0.0 0.0 7..5 0.000 634.5 187.5 1.3018 0.0000 0.0000 0.0 0.0 7..6 0.000 634.5 187.5 1.3018 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:01 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1065.414469 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.264254 0.970806 0.033737 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908260_1_1375_MLBR_RS06465: 0.000004, NC_002677_1_NP_301939_1_811_ML1306: 0.000004, NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080: 0.000004, NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775: 0.000004, NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090: 0.000004, NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.26425 MLEs of dN/dS (w) for site classes (K=2) p: 0.97081 0.02919 w: 0.03374 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 635.5 186.5 0.0619 0.0000 0.0000 0.0 0.0 7..2 0.000 635.5 186.5 0.0619 0.0000 0.0000 0.0 0.0 7..3 0.000 635.5 186.5 0.0619 0.0000 0.0000 0.0 0.0 7..4 0.000 635.5 186.5 0.0619 0.0000 0.0000 0.0 0.0 7..5 0.000 635.5 186.5 0.0619 0.0000 0.0000 0.0 0.0 7..6 0.000 635.5 186.5 0.0619 0.0000 0.0000 0.0 0.0 Time used: 0:04 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1065.414313 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908260_1_1375_MLBR_RS06465: 0.000004, NC_002677_1_NP_301939_1_811_ML1306: 0.000004, NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080: 0.000004, NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775: 0.000004, NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090: 0.000004, NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 1.00000 0.00000 0.00000 w: 0.00000 1.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908260_1_1375_MLBR_RS06465) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.009 0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:08 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1065.414313 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.691150 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908260_1_1375_MLBR_RS06465: 0.000004, NC_002677_1_NP_301939_1_811_ML1306: 0.000004, NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080: 0.000004, NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775: 0.000004, NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090: 0.000004, NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.69115 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:10 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1065.414313 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.794148 1.468780 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010908260_1_1375_MLBR_RS06465: 0.000004, NC_002677_1_NP_301939_1_811_ML1306: 0.000004, NZ_LVXE01000057_1_WP_010908260_1_2242_A3216_RS12080: 0.000004, NZ_LYPH01000062_1_WP_010908260_1_2253_A8144_RS10775: 0.000004, NZ_CP029543_1_WP_010908260_1_1395_DIJ64_RS07090: 0.000004, NZ_AP014567_1_WP_010908260_1_1427_JK2ML_RS07250: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.00500 q = 1.79415 (p1 = 0.00001) w = 1.46878 MLEs of dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.46878 (note that p[10] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 642.9 179.1 0.0000 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010908260_1_1375_MLBR_RS06465) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.094 0.096 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.105 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.095 Time used: 0:17
Model 1: NearlyNeutral -1065.414469 Model 2: PositiveSelection -1065.414313 Model 0: one-ratio -1065.414765 Model 7: beta -1065.414313 Model 8: beta&w>1 -1065.414313 Model 0 vs 1 5.919999998695857E-4 Model 2 vs 1 3.120000001217704E-4 Model 8 vs 7 0.0