--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:16:51 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML1010/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -322.05 -326.42
2 -322.11 -325.58
--------------------------------------
TOTAL -322.08 -326.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.492384 0.049085 0.111649 0.918190 0.460304 1501.00 1501.00 1.000
r(A<->C){all} 0.160370 0.019466 0.000001 0.442189 0.124547 268.49 287.60 1.000
r(A<->G){all} 0.172695 0.020356 0.000034 0.457872 0.136214 309.43 364.98 1.000
r(A<->T){all} 0.165308 0.019764 0.000007 0.452955 0.128975 213.27 311.52 1.006
r(C<->G){all} 0.164070 0.020387 0.000040 0.456697 0.122524 391.76 397.53 1.000
r(C<->T){all} 0.164476 0.018929 0.000044 0.449293 0.128260 253.13 362.65 1.000
r(G<->T){all} 0.173081 0.021315 0.000027 0.466261 0.135325 350.80 362.93 1.003
pi(A){all} 0.180659 0.000616 0.134134 0.231639 0.179772 1374.04 1437.52 1.000
pi(C){all} 0.336348 0.000903 0.281970 0.398958 0.336122 1216.14 1314.14 1.000
pi(G){all} 0.318938 0.000905 0.261873 0.379277 0.318382 1390.71 1445.86 1.000
pi(T){all} 0.164055 0.000563 0.118878 0.210361 0.162674 1400.89 1412.39 1.000
alpha{1,2} 0.405426 0.216082 0.000159 1.330127 0.234933 1328.81 1393.74 1.000
alpha{3} 0.453299 0.223251 0.000123 1.428646 0.301880 1163.76 1317.27 1.000
pinvar{all} 0.992195 0.000101 0.974261 0.999996 0.995419 1305.39 1403.19 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -314.539193
Model 2: PositiveSelection -314.539176
Model 0: one-ratio -314.539174
Model 7: beta -314.539212
Model 8: beta&w>1 -314.539174
Model 0 vs 1 3.800000001774606E-5
Model 2 vs 1 3.400000002784509E-5
Model 8 vs 7 7.600000003549212E-5
>C1
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C2
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C3
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C4
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=80
C1 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C2 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C3 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C4 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
**************************************************
C1 AVLARYSAALVRGDMCDKLAVHITSATSLG
C2 AVLARYSAALVRGDMCDKLAVHITSATSLG
C3 AVLARYSAALVRGDMCDKLAVHITSATSLG
C4 AVLARYSAALVRGDMCDKLAVHITSATSLG
******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 80 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 80 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [960]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [960]--->[960]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.351 Mb, Max= 30.506 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C2 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C3 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C4 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
**************************************************
C1 AVLARYSAALVRGDMCDKLAVHITSATSLG
C2 AVLARYSAALVRGDMCDKLAVHITSATSLG
C3 AVLARYSAALVRGDMCDKLAVHITSATSLG
C4 AVLARYSAALVRGDMCDKLAVHITSATSLG
******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
C2 GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
C3 GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
C4 GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
**************************************************
C1 CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
C2 CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
C3 CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
C4 CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
**************************************************
C1 GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
C2 GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
C3 GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
C4 GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
**************************************************
C1 GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
C2 GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
C3 GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
C4 GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
**************************************************
C1 TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
C2 TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
C3 TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
C4 TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
****************************************
>C1
GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>C2
GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>C3
GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>C4
GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>C1
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C2
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C3
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C4
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 240 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799752
Setting output file names to "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 751878039
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0066520342
Seed = 150299874
Swapseed = 1579799752
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -448.087354 -- -26.620141
Chain 2 -- -448.087354 -- -26.620141
Chain 3 -- -448.087354 -- -26.620141
Chain 4 -- -448.087354 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -448.087354 -- -26.620141
Chain 2 -- -448.087354 -- -26.620141
Chain 3 -- -448.087354 -- -26.620141
Chain 4 -- -448.087354 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-448.087] (-448.087) (-448.087) (-448.087) * [-448.087] (-448.087) (-448.087) (-448.087)
500 -- [-325.838] (-327.834) (-328.465) (-328.976) * (-327.617) (-323.594) (-328.164) [-326.475] -- 0:00:00
1000 -- (-326.413) [-327.910] (-329.183) (-328.855) * (-323.711) (-324.357) (-330.333) [-331.412] -- 0:16:39
1500 -- (-339.780) (-325.406) [-329.183] (-327.886) * (-326.281) (-327.063) (-331.326) [-324.431] -- 0:11:05
2000 -- (-326.141) (-324.445) (-326.626) [-326.992] * (-328.137) [-323.913] (-338.308) (-331.134) -- 0:08:19
2500 -- (-323.264) [-325.424] (-327.627) (-333.224) * (-327.562) (-326.789) [-331.303] (-325.257) -- 0:06:39
3000 -- (-333.122) (-325.546) [-323.044] (-326.594) * (-328.091) (-324.493) [-330.155] (-328.223) -- 0:05:32
3500 -- [-330.509] (-327.874) (-330.318) (-326.135) * (-328.060) [-327.782] (-329.659) (-330.316) -- 0:04:44
4000 -- (-327.079) (-328.616) (-331.293) [-330.023] * (-325.180) (-325.671) (-331.787) [-328.974] -- 0:04:09
4500 -- [-325.869] (-329.674) (-325.532) (-328.459) * (-327.696) (-327.104) [-326.019] (-326.694) -- 0:03:41
5000 -- (-333.180) (-328.802) [-324.081] (-323.534) * (-328.002) (-335.107) [-326.490] (-326.448) -- 0:03:19
Average standard deviation of split frequencies: 0.104757
5500 -- (-330.476) (-328.327) [-326.947] (-324.836) * [-325.642] (-325.243) (-331.212) (-327.001) -- 0:03:00
6000 -- (-324.845) (-323.484) [-325.165] (-327.371) * (-328.937) [-322.625] (-331.066) (-322.847) -- 0:02:45
6500 -- (-327.175) (-323.401) (-330.857) [-323.980] * [-327.376] (-327.681) (-329.679) (-327.542) -- 0:02:32
7000 -- (-326.090) (-327.368) (-327.982) [-326.210] * (-328.602) (-327.715) (-324.153) [-326.283] -- 0:02:21
7500 -- (-325.338) [-330.115] (-330.722) (-330.582) * (-325.047) (-325.444) [-326.072] (-325.243) -- 0:02:12
8000 -- (-326.750) (-325.241) [-327.251] (-326.316) * (-324.698) [-324.799] (-329.903) (-327.689) -- 0:02:04
8500 -- (-326.753) (-334.608) (-329.372) [-324.759] * (-324.716) [-326.729] (-330.094) (-328.994) -- 0:01:56
9000 -- (-329.035) (-330.711) [-327.001] (-327.973) * [-329.653] (-326.057) (-334.409) (-323.547) -- 0:01:50
9500 -- [-324.554] (-328.003) (-327.785) (-330.616) * [-326.633] (-328.781) (-327.659) (-332.622) -- 0:01:44
10000 -- (-324.616) (-325.725) (-329.246) [-328.924] * (-325.509) (-324.956) [-326.196] (-329.240) -- 0:01:39
Average standard deviation of split frequencies: 0.117851
10500 -- [-325.147] (-332.242) (-335.024) (-326.989) * [-325.359] (-326.465) (-331.333) (-323.931) -- 0:01:34
11000 -- [-322.030] (-323.962) (-329.728) (-323.777) * [-324.654] (-324.620) (-324.274) (-325.992) -- 0:01:29
11500 -- (-324.121) [-326.676] (-331.098) (-323.600) * (-327.428) (-328.982) (-324.574) [-323.904] -- 0:01:25
12000 -- (-329.284) [-327.419] (-326.405) (-326.846) * (-326.863) (-330.635) (-326.701) [-325.072] -- 0:01:22
12500 -- (-332.595) (-326.429) [-326.493] (-322.803) * (-329.821) [-328.302] (-323.438) (-322.869) -- 0:01:19
13000 -- (-327.972) [-327.068] (-323.799) (-322.473) * (-328.338) (-328.590) [-323.009] (-322.447) -- 0:01:15
13500 -- [-325.590] (-332.075) (-322.248) (-322.493) * (-332.739) (-336.041) (-325.792) [-323.806] -- 0:01:13
14000 -- (-329.217) (-322.631) (-322.984) [-325.803] * (-325.013) (-326.120) (-328.472) [-321.536] -- 0:01:10
14500 -- (-329.661) (-330.051) [-322.249] (-325.431) * (-322.552) (-328.852) (-331.050) [-324.012] -- 0:01:07
15000 -- (-330.703) (-325.782) [-323.872] (-328.835) * (-323.459) (-328.754) (-333.024) [-321.640] -- 0:01:05
Average standard deviation of split frequencies: 0.078567
15500 -- (-328.727) (-329.935) (-322.040) [-322.910] * [-325.075] (-326.071) (-328.367) (-322.376) -- 0:01:03
16000 -- [-327.854] (-326.674) (-321.405) (-323.791) * [-324.820] (-326.021) (-325.615) (-321.648) -- 0:01:01
16500 -- (-324.542) [-328.728] (-322.252) (-323.134) * (-322.412) (-329.565) [-324.799] (-323.978) -- 0:00:59
17000 -- (-326.384) (-325.391) (-321.799) [-323.381] * (-322.786) (-328.416) (-330.910) [-322.193] -- 0:00:57
17500 -- (-329.514) (-325.814) (-325.358) [-327.827] * [-321.003] (-324.930) (-329.756) (-324.219) -- 0:00:56
18000 -- (-325.766) (-325.228) [-323.822] (-322.062) * [-325.410] (-328.082) (-325.344) (-324.956) -- 0:00:54
18500 -- (-325.434) (-326.264) [-322.465] (-322.801) * (-321.365) (-325.989) (-327.537) [-322.287] -- 0:00:53
19000 -- (-329.911) (-327.995) (-323.337) [-324.082] * (-321.568) (-328.705) (-328.163) [-322.118] -- 0:00:51
19500 -- [-321.442] (-324.311) (-326.952) (-325.537) * (-322.501) (-325.421) [-325.949] (-322.870) -- 0:00:50
20000 -- (-332.878) (-323.649) [-322.172] (-323.243) * (-322.937) (-330.576) [-325.911] (-323.101) -- 0:00:49
Average standard deviation of split frequencies: 0.015207
20500 -- (-328.038) (-328.617) [-323.207] (-325.510) * (-324.209) [-327.054] (-323.312) (-324.438) -- 0:00:47
21000 -- (-327.451) [-324.571] (-324.048) (-324.707) * (-323.130) (-322.863) [-321.727] (-321.115) -- 0:00:46
21500 -- [-330.469] (-326.079) (-321.111) (-323.777) * (-321.115) [-329.623] (-322.657) (-323.149) -- 0:00:45
22000 -- (-329.960) (-323.085) [-321.004] (-326.229) * (-321.538) (-330.752) [-322.650] (-325.177) -- 0:00:44
22500 -- (-330.349) (-330.855) (-320.943) [-324.885] * (-321.566) [-327.833] (-322.109) (-327.738) -- 0:00:43
23000 -- [-332.072] (-329.165) (-320.922) (-321.893) * (-322.399) (-331.510) (-325.557) [-326.978] -- 0:00:42
23500 -- (-329.643) [-328.759] (-321.714) (-321.956) * (-322.206) (-330.333) [-323.685] (-323.653) -- 0:01:23
24000 -- (-328.657) (-330.367) [-325.128] (-322.823) * (-321.863) (-322.067) (-322.409) [-320.813] -- 0:01:21
24500 -- (-327.231) (-325.800) (-321.684) [-321.101] * (-322.677) (-325.288) (-326.683) [-321.773] -- 0:01:19
25000 -- (-333.148) (-328.764) (-322.417) [-323.053] * (-321.631) [-323.033] (-326.851) (-321.959) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- (-333.680) (-324.823) (-322.732) [-322.088] * [-321.326] (-322.926) (-323.115) (-321.204) -- 0:01:16
26000 -- (-320.443) (-326.020) (-325.396) [-326.399] * (-321.220) [-322.039] (-321.804) (-321.281) -- 0:01:14
26500 -- (-322.627) (-326.892) (-322.052) [-326.497] * [-321.596] (-328.381) (-324.502) (-322.257) -- 0:01:13
27000 -- (-323.476) (-328.375) (-324.055) [-322.661] * [-320.905] (-321.310) (-322.338) (-322.615) -- 0:01:12
27500 -- (-322.298) (-328.025) (-323.732) [-322.284] * (-323.949) (-322.359) (-326.160) [-323.813] -- 0:01:10
28000 -- (-324.703) [-327.116] (-321.154) (-321.760) * (-321.403) (-320.680) [-322.385] (-324.738) -- 0:01:09
28500 -- (-321.903) (-331.175) (-323.658) [-323.896] * (-321.732) (-321.033) [-323.770] (-321.603) -- 0:01:08
29000 -- (-322.002) [-325.395] (-322.269) (-322.070) * (-323.108) [-322.196] (-324.310) (-321.872) -- 0:01:06
29500 -- (-326.675) (-328.736) (-324.565) [-324.668] * (-325.572) [-322.387] (-323.639) (-322.702) -- 0:01:05
30000 -- (-323.151) (-329.867) (-323.483) [-322.404] * (-324.784) (-323.013) [-324.088] (-324.667) -- 0:01:04
Average standard deviation of split frequencies: 0.040992
30500 -- (-323.420) (-324.349) [-324.214] (-328.144) * (-323.511) (-322.413) [-322.731] (-322.928) -- 0:01:03
31000 -- (-321.016) [-328.182] (-321.084) (-320.742) * (-324.119) (-327.782) [-321.204] (-324.429) -- 0:01:02
31500 -- [-323.847] (-327.548) (-322.969) (-321.596) * (-323.034) [-322.505] (-323.847) (-321.512) -- 0:01:01
32000 -- [-320.894] (-327.908) (-321.568) (-327.001) * (-321.444) [-325.572] (-327.354) (-321.025) -- 0:01:00
32500 -- [-323.517] (-329.813) (-323.523) (-324.475) * [-324.160] (-324.344) (-321.593) (-322.414) -- 0:00:59
33000 -- (-321.818) [-329.067] (-321.244) (-328.315) * (-322.480) [-324.768] (-322.274) (-323.879) -- 0:00:58
33500 -- (-324.064) [-327.324] (-320.521) (-321.553) * (-322.009) (-323.852) (-322.511) [-322.970] -- 0:00:57
34000 -- [-321.183] (-328.030) (-323.192) (-323.927) * (-321.474) [-323.674] (-322.491) (-321.262) -- 0:00:56
34500 -- (-321.109) (-327.353) [-326.250] (-324.055) * (-322.712) (-327.563) (-324.120) [-322.223] -- 0:00:55
35000 -- (-321.538) (-328.184) (-324.248) [-321.188] * [-323.460] (-325.917) (-322.958) (-323.859) -- 0:00:55
Average standard deviation of split frequencies: 0.052378
35500 -- (-322.234) [-327.469] (-321.568) (-330.508) * [-321.801] (-323.063) (-324.439) (-323.525) -- 0:00:54
36000 -- (-322.748) (-326.689) [-321.284] (-321.803) * (-322.086) (-321.021) (-321.857) [-321.796] -- 0:00:53
36500 -- [-321.230] (-330.262) (-323.101) (-322.478) * (-323.811) [-321.492] (-321.826) (-322.865) -- 0:00:52
37000 -- (-320.694) (-330.854) (-323.209) [-324.748] * (-329.899) [-321.551] (-326.095) (-324.978) -- 0:00:52
37500 -- (-322.505) (-333.220) [-324.710] (-321.821) * (-326.333) [-321.473] (-326.181) (-322.840) -- 0:00:51
38000 -- (-323.402) (-327.163) (-322.270) [-326.357] * (-325.104) (-323.363) (-322.826) [-321.354] -- 0:00:50
38500 -- (-324.093) (-329.548) [-323.687] (-322.567) * [-321.713] (-325.636) (-322.567) (-321.995) -- 0:00:49
39000 -- (-323.508) (-336.414) [-325.543] (-325.685) * [-321.913] (-326.502) (-323.162) (-321.224) -- 0:00:49
39500 -- (-320.931) (-328.593) (-327.266) [-324.363] * (-323.117) [-322.351] (-322.293) (-323.376) -- 0:00:48
40000 -- [-322.125] (-321.244) (-333.898) (-321.109) * (-321.600) [-320.707] (-323.013) (-321.170) -- 0:00:48
Average standard deviation of split frequencies: 0.038640
40500 -- [-322.683] (-323.476) (-322.717) (-320.733) * (-321.614) [-322.009] (-321.294) (-321.751) -- 0:00:47
41000 -- (-321.001) (-322.703) (-323.915) [-325.992] * (-325.463) [-321.651] (-322.203) (-326.018) -- 0:00:46
41500 -- (-326.160) (-327.303) (-323.334) [-323.928] * (-323.564) (-323.693) (-322.568) [-321.822] -- 0:00:46
42000 -- (-323.136) (-326.634) (-321.180) [-322.602] * (-327.000) [-321.673] (-322.489) (-323.490) -- 0:00:45
42500 -- (-324.828) (-322.699) [-321.290] (-322.519) * (-324.352) (-326.143) [-320.490] (-322.261) -- 0:00:45
43000 -- (-323.105) [-321.054] (-321.325) (-324.103) * (-321.479) (-321.328) (-322.395) [-322.208] -- 0:00:44
43500 -- [-321.680] (-325.891) (-321.262) (-323.102) * [-322.224] (-323.507) (-320.949) (-321.915) -- 0:00:43
44000 -- (-323.412) [-320.808] (-321.655) (-322.937) * (-322.201) (-323.881) [-320.940] (-322.439) -- 0:00:43
44500 -- (-321.728) [-321.450] (-322.934) (-323.531) * (-321.442) (-322.914) (-322.409) [-322.445] -- 0:00:42
45000 -- (-321.968) (-321.040) [-322.370] (-322.456) * (-323.810) (-323.569) (-321.858) [-326.998] -- 0:00:42
Average standard deviation of split frequencies: 0.034160
45500 -- [-323.094] (-326.862) (-321.551) (-321.593) * (-324.496) [-324.474] (-321.890) (-324.059) -- 0:00:41
46000 -- [-322.884] (-321.494) (-323.154) (-322.215) * (-323.609) (-326.420) [-322.185] (-320.893) -- 0:01:02
46500 -- (-321.406) (-321.108) (-323.522) [-322.200] * [-322.090] (-324.176) (-323.304) (-322.113) -- 0:01:01
47000 -- (-322.378) (-324.524) [-324.395] (-327.486) * (-322.378) [-322.681] (-322.382) (-322.834) -- 0:01:00
47500 -- (-324.157) (-325.600) (-331.550) [-321.349] * (-321.056) (-320.965) [-321.555] (-324.701) -- 0:01:00
48000 -- (-322.585) (-322.320) (-326.365) [-322.549] * (-324.647) (-325.367) (-330.517) [-322.512] -- 0:00:59
48500 -- (-321.485) (-324.624) [-322.257] (-322.693) * [-322.092] (-325.466) (-332.944) (-322.536) -- 0:00:58
49000 -- (-324.677) (-321.516) (-322.357) [-321.193] * (-328.870) (-322.246) (-321.187) [-321.101] -- 0:00:58
49500 -- [-322.395] (-325.337) (-321.168) (-322.029) * (-324.556) (-325.061) (-322.255) [-320.662] -- 0:00:57
50000 -- (-323.195) (-325.535) [-323.058] (-320.915) * (-323.528) (-328.394) [-322.143] (-325.788) -- 0:00:57
Average standard deviation of split frequencies: 0.018608
50500 -- [-322.251] (-321.097) (-322.872) (-321.446) * (-322.361) [-322.617] (-322.465) (-322.180) -- 0:00:56
51000 -- (-326.126) (-323.181) [-321.750] (-325.473) * (-322.240) (-324.760) (-326.032) [-322.977] -- 0:00:55
51500 -- (-324.239) (-322.785) [-327.985] (-321.542) * [-322.638] (-323.325) (-324.781) (-323.150) -- 0:00:55
52000 -- [-322.292] (-324.639) (-321.897) (-321.079) * [-322.029] (-328.821) (-321.967) (-322.854) -- 0:00:54
52500 -- (-322.739) (-322.566) (-321.499) [-322.541] * (-323.102) (-322.329) [-321.975] (-321.009) -- 0:00:54
53000 -- (-324.835) (-325.853) [-321.022] (-321.225) * [-321.264] (-324.665) (-328.892) (-321.819) -- 0:00:53
53500 -- (-322.121) (-324.816) [-321.656] (-322.595) * (-324.053) (-320.959) (-320.882) [-321.659] -- 0:00:53
54000 -- (-326.675) [-323.667] (-321.846) (-321.985) * (-322.642) [-324.165] (-323.359) (-322.627) -- 0:00:52
54500 -- (-323.915) (-321.547) [-322.511] (-321.400) * [-322.273] (-325.421) (-321.930) (-322.456) -- 0:00:52
55000 -- (-321.255) (-322.277) [-324.939] (-322.919) * (-322.358) (-321.626) (-325.029) [-324.067] -- 0:00:51
Average standard deviation of split frequencies: 0.022448
55500 -- (-328.677) (-322.491) (-321.568) [-323.979] * (-320.783) (-323.632) (-325.513) [-324.369] -- 0:00:51
56000 -- (-323.404) (-321.910) (-323.786) [-322.946] * (-321.704) [-323.115] (-323.383) (-323.871) -- 0:00:50
56500 -- (-323.070) (-320.604) [-321.292] (-324.667) * (-322.806) (-321.932) [-321.551] (-323.983) -- 0:00:50
57000 -- (-321.578) (-321.552) (-323.126) [-322.587] * [-323.274] (-323.913) (-321.471) (-323.726) -- 0:00:49
57500 -- (-321.038) [-322.495] (-320.608) (-322.677) * [-323.526] (-324.754) (-323.736) (-324.667) -- 0:00:49
58000 -- (-323.627) (-322.246) [-321.315] (-326.651) * (-323.929) (-323.964) [-321.878] (-321.464) -- 0:00:48
58500 -- [-321.466] (-324.118) (-322.288) (-325.095) * (-322.699) [-322.373] (-321.771) (-323.716) -- 0:00:48
59000 -- [-323.461] (-322.199) (-323.719) (-322.477) * [-323.159] (-323.109) (-326.376) (-327.522) -- 0:00:47
59500 -- (-321.358) [-322.239] (-323.131) (-321.081) * (-321.950) [-322.966] (-323.360) (-327.320) -- 0:00:47
60000 -- (-321.671) (-322.103) [-321.773] (-321.817) * (-324.326) (-324.420) (-324.175) [-321.376] -- 0:00:47
Average standard deviation of split frequencies: 0.015541
60500 -- (-322.273) (-324.029) [-322.096] (-322.426) * (-325.254) [-323.106] (-321.612) (-321.376) -- 0:00:46
61000 -- (-322.125) (-324.932) [-325.208] (-322.406) * (-323.385) [-323.076] (-322.977) (-323.027) -- 0:00:46
61500 -- (-323.851) (-321.560) [-322.809] (-323.935) * (-322.430) [-323.792] (-323.985) (-322.164) -- 0:00:45
62000 -- (-324.838) [-322.796] (-321.736) (-323.978) * (-322.612) (-322.550) [-322.229] (-324.571) -- 0:00:45
62500 -- (-324.010) (-321.876) (-324.738) [-321.305] * (-323.577) (-321.197) (-323.710) [-324.023] -- 0:00:45
63000 -- (-321.110) (-324.710) (-323.363) [-321.464] * (-324.473) [-324.717] (-321.521) (-326.950) -- 0:00:44
63500 -- (-324.101) (-326.759) (-322.902) [-321.572] * [-322.850] (-323.323) (-322.082) (-327.950) -- 0:00:44
64000 -- (-324.994) (-324.799) [-322.211] (-321.336) * (-321.150) (-321.345) [-322.631] (-325.641) -- 0:00:43
64500 -- (-324.411) (-323.788) [-322.998] (-321.838) * (-322.758) (-321.694) (-321.839) [-328.304] -- 0:00:43
65000 -- (-320.751) (-322.965) (-323.741) [-321.862] * (-321.851) (-322.379) [-322.052] (-329.796) -- 0:00:43
Average standard deviation of split frequencies: 0.004762
65500 -- [-321.900] (-322.814) (-323.752) (-324.704) * (-322.109) (-325.600) [-322.761] (-323.495) -- 0:00:42
66000 -- (-322.041) (-322.430) [-326.757] (-324.219) * (-323.100) (-326.001) (-324.174) [-323.271] -- 0:00:42
66500 -- (-321.869) [-324.577] (-322.218) (-325.967) * (-323.702) (-321.040) [-322.211] (-329.111) -- 0:00:42
67000 -- (-322.298) (-327.313) [-322.230] (-324.594) * (-323.185) (-322.980) [-323.737] (-324.890) -- 0:00:41
67500 -- (-323.827) [-321.729] (-323.023) (-324.093) * (-324.049) (-321.852) (-323.755) [-322.876] -- 0:00:41
68000 -- (-323.282) (-323.183) [-323.924] (-326.356) * (-321.678) [-320.554] (-323.495) (-325.777) -- 0:00:41
68500 -- (-321.184) [-324.312] (-324.541) (-323.873) * [-321.020] (-325.569) (-323.527) (-324.388) -- 0:00:40
69000 -- (-324.310) (-321.831) (-322.878) [-321.221] * (-322.389) [-321.695] (-321.290) (-324.668) -- 0:00:53
69500 -- (-323.404) (-323.139) (-324.811) [-321.745] * (-321.162) (-321.085) [-320.540] (-321.693) -- 0:00:53
70000 -- (-325.154) (-320.891) (-326.513) [-324.192] * (-320.801) (-323.982) [-321.929] (-321.334) -- 0:00:53
Average standard deviation of split frequencies: 0.022236
70500 -- (-326.068) [-321.312] (-321.377) (-321.767) * (-328.061) [-322.132] (-322.470) (-320.736) -- 0:00:52
71000 -- (-324.043) [-321.488] (-324.906) (-321.028) * (-321.498) (-321.583) [-324.939] (-321.172) -- 0:00:52
71500 -- (-322.183) (-321.382) [-321.346] (-322.167) * (-322.047) (-323.264) [-323.259] (-321.878) -- 0:00:51
72000 -- [-320.943] (-321.394) (-324.305) (-326.014) * (-324.286) (-323.033) [-322.538] (-322.358) -- 0:00:51
72500 -- (-321.704) (-322.395) (-323.344) [-321.467] * [-325.685] (-321.151) (-323.217) (-321.413) -- 0:00:51
73000 -- (-323.005) (-325.053) [-321.723] (-322.553) * (-326.893) (-323.739) (-321.025) [-326.707] -- 0:00:50
73500 -- (-325.214) (-328.022) (-324.477) [-321.542] * [-322.132] (-321.328) (-325.733) (-324.911) -- 0:00:50
74000 -- (-337.198) [-322.350] (-321.864) (-321.525) * (-323.697) [-321.192] (-325.429) (-327.903) -- 0:00:50
74500 -- (-329.331) [-322.189] (-321.785) (-326.398) * (-324.127) [-323.080] (-325.739) (-320.839) -- 0:00:49
75000 -- (-321.251) (-322.218) (-325.598) [-324.719] * [-326.289] (-321.493) (-325.395) (-322.873) -- 0:00:49
Average standard deviation of split frequencies: 0.028946
75500 -- (-320.901) (-322.607) (-324.613) [-323.068] * [-323.641] (-320.690) (-322.968) (-323.996) -- 0:00:48
76000 -- (-327.834) (-320.884) (-321.335) [-321.687] * (-328.660) [-323.035] (-323.127) (-321.542) -- 0:00:48
76500 -- (-324.677) (-323.027) [-324.000] (-321.358) * (-323.172) (-326.131) (-320.952) [-320.693] -- 0:00:48
77000 -- (-324.538) (-323.304) (-322.246) [-322.567] * (-322.720) (-322.421) (-325.635) [-324.440] -- 0:00:47
77500 -- (-320.992) (-325.572) (-323.468) [-323.315] * (-326.226) [-322.361] (-321.891) (-324.149) -- 0:00:47
78000 -- [-323.414] (-322.157) (-325.534) (-320.498) * [-321.803] (-323.250) (-322.121) (-324.854) -- 0:00:47
78500 -- (-323.891) [-321.822] (-321.903) (-321.745) * [-322.043] (-323.826) (-323.105) (-321.377) -- 0:00:46
79000 -- (-324.432) (-323.878) (-323.605) [-321.398] * (-324.497) [-321.496] (-322.314) (-322.059) -- 0:00:46
79500 -- (-321.891) (-323.117) (-321.624) [-321.791] * (-324.871) [-321.337] (-321.512) (-323.393) -- 0:00:46
80000 -- (-325.420) [-322.335] (-322.727) (-323.494) * (-327.246) [-323.509] (-321.544) (-320.929) -- 0:00:46
Average standard deviation of split frequencies: 0.023375
80500 -- (-324.580) (-320.705) (-322.920) [-324.854] * (-323.922) [-322.508] (-328.169) (-321.261) -- 0:00:45
81000 -- (-321.017) (-326.472) (-322.462) [-321.570] * (-323.591) (-322.523) [-321.727] (-323.457) -- 0:00:45
81500 -- (-322.234) (-324.935) (-324.589) [-321.505] * (-321.724) (-320.472) [-322.245] (-321.015) -- 0:00:45
82000 -- [-322.439] (-322.604) (-321.961) (-322.512) * [-321.652] (-320.589) (-322.885) (-320.991) -- 0:00:44
82500 -- (-322.367) (-327.224) (-322.219) [-321.708] * (-322.139) [-322.663] (-326.510) (-320.775) -- 0:00:44
83000 -- (-325.375) (-320.948) [-325.509] (-322.162) * (-321.462) [-323.175] (-324.399) (-321.356) -- 0:00:44
83500 -- (-321.841) [-323.100] (-324.203) (-322.159) * (-322.381) (-322.811) [-323.880] (-321.293) -- 0:00:43
84000 -- [-321.994] (-325.217) (-325.946) (-321.712) * (-324.076) (-324.245) [-331.845] (-322.133) -- 0:00:43
84500 -- (-320.676) [-322.473] (-320.518) (-321.450) * (-323.847) [-323.351] (-320.697) (-323.951) -- 0:00:43
85000 -- [-322.847] (-326.445) (-321.349) (-323.087) * [-323.420] (-322.232) (-321.884) (-321.340) -- 0:00:43
Average standard deviation of split frequencies: 0.025580
85500 -- [-323.184] (-322.434) (-322.594) (-321.057) * (-323.247) [-323.680] (-321.681) (-323.006) -- 0:00:42
86000 -- (-323.362) [-322.146] (-324.585) (-328.313) * [-322.842] (-321.838) (-321.458) (-322.465) -- 0:00:42
86500 -- [-321.062] (-323.651) (-323.703) (-323.512) * [-321.979] (-321.433) (-326.643) (-322.339) -- 0:00:42
87000 -- (-322.253) (-323.484) (-321.847) [-320.943] * [-322.535] (-322.523) (-322.940) (-323.268) -- 0:00:41
87500 -- (-320.947) [-324.505] (-323.033) (-323.842) * [-325.732] (-323.672) (-324.651) (-322.012) -- 0:00:41
88000 -- [-321.909] (-321.064) (-326.046) (-325.298) * [-323.387] (-323.507) (-322.192) (-323.997) -- 0:00:41
88500 -- (-322.929) (-322.366) (-321.131) [-321.808] * (-321.222) (-321.421) (-320.826) [-323.030] -- 0:00:41
89000 -- (-323.138) (-324.534) (-321.031) [-323.123] * [-322.042] (-324.751) (-324.033) (-320.851) -- 0:00:40
89500 -- (-326.988) (-321.578) (-321.019) [-326.402] * (-321.027) (-322.359) [-321.711] (-321.356) -- 0:00:40
90000 -- [-325.323] (-322.111) (-322.800) (-321.410) * (-324.620) (-320.799) (-325.822) [-322.843] -- 0:00:40
Average standard deviation of split frequencies: 0.006932
90500 -- (-321.678) (-321.401) [-320.994] (-325.296) * [-322.982] (-323.198) (-322.539) (-323.164) -- 0:00:40
91000 -- [-322.414] (-322.275) (-323.837) (-324.005) * (-322.613) (-321.621) (-324.591) [-322.712] -- 0:00:49
91500 -- (-323.767) [-321.138] (-327.410) (-322.749) * (-324.614) (-322.860) (-321.704) [-325.141] -- 0:00:49
92000 -- (-327.425) (-324.411) [-321.847] (-322.103) * (-320.751) (-320.846) (-324.398) [-322.935] -- 0:00:49
92500 -- (-321.380) (-325.878) (-322.228) [-322.476] * (-326.116) [-324.565] (-322.997) (-322.790) -- 0:00:49
93000 -- (-322.218) (-325.128) [-321.576] (-324.361) * (-322.527) (-325.984) [-324.707] (-322.619) -- 0:00:48
93500 -- (-323.044) [-321.551] (-325.456) (-324.811) * (-324.895) [-323.403] (-325.488) (-321.982) -- 0:00:48
94000 -- [-322.085] (-322.390) (-325.128) (-326.883) * [-324.406] (-322.851) (-321.401) (-322.973) -- 0:00:48
94500 -- (-322.175) [-321.532] (-321.276) (-326.840) * [-324.718] (-322.722) (-323.203) (-321.657) -- 0:00:47
95000 -- [-323.362] (-323.573) (-323.804) (-324.223) * (-321.699) (-321.620) (-326.686) [-322.598] -- 0:00:47
Average standard deviation of split frequencies: 0.006547
95500 -- [-323.731] (-320.711) (-322.686) (-321.176) * (-320.948) (-323.254) [-322.121] (-328.773) -- 0:00:47
96000 -- (-322.528) (-322.783) [-321.875] (-322.689) * (-321.952) (-321.702) (-324.608) [-324.006] -- 0:00:47
96500 -- (-322.437) (-324.742) [-328.882] (-327.107) * (-322.532) (-321.529) [-327.162] (-321.809) -- 0:00:46
97000 -- (-323.613) [-322.854] (-329.023) (-325.539) * [-322.532] (-320.975) (-324.382) (-322.638) -- 0:00:46
97500 -- [-324.110] (-323.008) (-323.765) (-321.142) * (-324.662) (-321.203) [-324.166] (-322.933) -- 0:00:46
98000 -- (-321.339) (-321.839) [-323.064] (-320.797) * [-323.440] (-325.351) (-327.732) (-323.026) -- 0:00:46
98500 -- (-321.110) (-322.181) (-326.588) [-326.124] * (-324.518) (-323.045) [-322.899] (-321.283) -- 0:00:45
99000 -- (-323.872) [-325.125] (-327.972) (-321.958) * [-322.082] (-322.411) (-323.575) (-322.459) -- 0:00:45
99500 -- (-324.910) [-323.567] (-324.414) (-320.690) * (-325.230) (-321.951) [-323.387] (-320.978) -- 0:00:45
100000 -- (-321.747) (-326.200) (-321.890) [-322.493] * [-321.978] (-323.744) (-323.699) (-321.696) -- 0:00:45
Average standard deviation of split frequencies: 0.006244
100500 -- (-322.504) (-325.662) (-322.303) [-321.225] * (-322.226) [-322.887] (-324.511) (-322.445) -- 0:00:44
101000 -- (-324.829) [-323.794] (-325.124) (-322.143) * (-325.100) (-324.961) (-323.678) [-325.002] -- 0:00:44
101500 -- (-330.913) (-322.537) [-323.560] (-323.306) * (-321.109) [-321.778] (-321.820) (-323.879) -- 0:00:44
102000 -- (-322.202) [-322.212] (-323.031) (-320.748) * (-322.309) [-322.540] (-322.826) (-322.941) -- 0:00:44
102500 -- (-324.611) (-321.886) [-321.444] (-324.390) * (-322.088) (-327.096) (-321.783) [-322.356] -- 0:00:43
103000 -- [-322.044] (-320.968) (-325.092) (-321.290) * (-321.402) (-322.304) (-322.147) [-324.402] -- 0:00:43
103500 -- (-321.610) [-323.761] (-326.472) (-323.176) * [-321.860] (-322.945) (-321.977) (-322.657) -- 0:00:43
104000 -- (-321.781) [-321.775] (-324.931) (-323.248) * (-322.767) (-321.107) [-323.148] (-325.030) -- 0:00:43
104500 -- (-325.626) (-322.268) (-324.321) [-323.294] * (-323.025) (-321.270) (-324.105) [-322.990] -- 0:00:42
105000 -- [-321.164] (-323.778) (-323.658) (-322.391) * (-321.510) [-322.652] (-322.413) (-323.575) -- 0:00:42
Average standard deviation of split frequencies: 0.020754
105500 -- (-327.716) (-320.827) (-321.488) [-321.972] * (-323.539) (-322.625) (-326.032) [-324.543] -- 0:00:42
106000 -- [-326.098] (-321.403) (-324.668) (-322.078) * (-321.753) (-322.510) (-323.351) [-324.864] -- 0:00:42
106500 -- (-329.800) [-321.910] (-322.052) (-326.505) * (-321.445) (-322.517) [-324.923] (-324.331) -- 0:00:41
107000 -- [-320.911] (-323.039) (-320.932) (-322.595) * (-322.189) (-322.817) (-321.616) [-321.812] -- 0:00:41
107500 -- [-321.836] (-324.347) (-321.710) (-321.395) * (-324.818) [-324.843] (-321.481) (-325.803) -- 0:00:41
108000 -- (-324.374) (-326.401) [-322.748] (-325.952) * (-320.761) [-321.792] (-322.915) (-321.917) -- 0:00:41
108500 -- (-329.319) [-323.034] (-326.915) (-321.003) * (-322.503) (-323.705) (-326.893) [-322.306] -- 0:00:41
109000 -- (-324.807) [-322.620] (-324.759) (-322.756) * (-322.075) [-325.595] (-322.971) (-321.986) -- 0:00:40
109500 -- (-322.760) [-324.584] (-321.208) (-322.162) * (-331.847) [-323.781] (-321.236) (-321.022) -- 0:00:40
110000 -- [-324.554] (-322.234) (-321.844) (-320.446) * (-324.391) (-321.750) [-322.671] (-321.222) -- 0:00:40
Average standard deviation of split frequencies: 0.011359
110500 -- (-321.829) (-321.620) [-323.128] (-323.619) * [-325.264] (-321.379) (-326.186) (-324.485) -- 0:00:40
111000 -- [-323.438] (-322.143) (-324.098) (-322.688) * (-327.211) (-323.835) [-321.308] (-321.351) -- 0:00:40
111500 -- (-321.815) (-323.475) [-321.027] (-320.748) * (-323.538) (-323.355) [-320.906] (-323.032) -- 0:00:39
112000 -- (-322.228) (-324.145) [-321.772] (-320.695) * [-325.703] (-321.420) (-322.269) (-320.838) -- 0:00:39
112500 -- (-321.910) [-325.213] (-322.751) (-321.666) * (-320.606) [-323.679] (-323.939) (-322.340) -- 0:00:39
113000 -- [-322.684] (-320.956) (-322.613) (-327.522) * [-321.697] (-320.653) (-325.633) (-325.313) -- 0:00:39
113500 -- (-321.594) [-321.350] (-321.033) (-324.708) * (-322.416) (-322.639) [-326.007] (-322.574) -- 0:00:46
114000 -- (-322.439) [-321.732] (-322.495) (-322.690) * [-321.023] (-324.490) (-324.042) (-321.803) -- 0:00:46
114500 -- (-324.648) (-322.761) [-322.425] (-321.953) * [-322.777] (-323.929) (-324.586) (-323.788) -- 0:00:46
115000 -- (-323.866) (-322.228) [-325.677] (-322.439) * (-324.522) (-322.129) (-321.876) [-321.687] -- 0:00:46
Average standard deviation of split frequencies: 0.010837
115500 -- (-323.160) (-324.082) [-321.206] (-321.583) * (-323.991) (-322.635) (-321.334) [-323.807] -- 0:00:45
116000 -- (-325.279) (-325.112) (-321.917) [-322.435] * (-321.605) (-324.739) (-321.182) [-323.325] -- 0:00:45
116500 -- (-320.894) (-326.798) (-327.062) [-325.707] * (-325.807) [-321.934] (-321.526) (-326.455) -- 0:00:45
117000 -- (-322.199) (-323.502) [-324.035] (-322.230) * (-327.633) [-321.678] (-322.132) (-320.672) -- 0:00:45
117500 -- (-321.983) (-322.130) [-322.610] (-324.608) * [-320.828] (-325.624) (-321.824) (-329.294) -- 0:00:45
118000 -- (-322.166) (-325.393) [-322.841] (-323.666) * [-321.247] (-326.101) (-324.549) (-321.442) -- 0:00:44
118500 -- [-323.173] (-325.245) (-323.739) (-323.793) * (-323.701) (-320.909) (-323.358) [-325.138] -- 0:00:44
119000 -- (-323.543) (-325.523) (-326.678) [-326.184] * [-321.154] (-323.076) (-323.612) (-328.472) -- 0:00:44
119500 -- (-322.174) [-325.100] (-323.624) (-323.672) * (-324.014) (-320.972) (-322.587) [-321.085] -- 0:00:44
120000 -- (-321.806) (-326.691) (-322.646) [-321.812] * (-323.062) (-323.661) (-322.266) [-321.709] -- 0:00:44
Average standard deviation of split frequencies: 0.007813
120500 -- [-323.287] (-325.380) (-323.884) (-323.485) * (-324.685) (-324.662) (-324.962) [-322.554] -- 0:00:43
121000 -- [-322.388] (-324.809) (-321.611) (-322.119) * (-323.335) [-321.175] (-323.967) (-323.374) -- 0:00:43
121500 -- (-322.633) (-320.854) (-321.240) [-321.518] * [-326.457] (-323.099) (-321.341) (-327.825) -- 0:00:43
122000 -- (-322.067) (-321.847) (-324.518) [-320.892] * (-326.818) (-321.407) (-324.600) [-322.064] -- 0:00:43
122500 -- (-321.476) [-321.509] (-323.847) (-324.385) * (-329.927) [-321.497] (-324.655) (-323.237) -- 0:00:42
123000 -- [-323.111] (-322.783) (-324.476) (-321.412) * (-322.652) [-320.936] (-321.510) (-325.121) -- 0:00:42
123500 -- [-322.503] (-325.109) (-325.554) (-323.097) * [-322.040] (-322.237) (-324.122) (-325.626) -- 0:00:42
124000 -- (-321.446) (-322.555) [-322.344] (-321.468) * (-326.551) (-321.328) [-323.065] (-324.600) -- 0:00:42
124500 -- (-322.124) [-322.647] (-321.422) (-321.312) * (-322.859) (-321.626) (-325.699) [-322.030] -- 0:00:42
125000 -- (-320.871) (-321.756) [-322.150] (-324.959) * [-321.654] (-323.370) (-322.138) (-323.261) -- 0:00:42
Average standard deviation of split frequencies: 0.009977
125500 -- (-322.414) [-321.729] (-324.462) (-327.064) * (-322.058) [-323.140] (-323.502) (-323.745) -- 0:00:41
126000 -- (-325.528) (-324.781) [-322.021] (-321.983) * (-322.560) (-324.543) [-323.493] (-325.873) -- 0:00:41
126500 -- (-325.109) [-325.290] (-323.332) (-321.549) * (-320.640) [-321.768] (-321.501) (-321.219) -- 0:00:41
127000 -- [-321.559] (-323.733) (-326.064) (-321.176) * (-324.381) (-324.938) (-323.944) [-323.628] -- 0:00:41
127500 -- (-328.712) (-327.378) [-324.956] (-324.166) * (-325.253) (-321.976) (-323.571) [-322.832] -- 0:00:41
128000 -- (-325.203) [-322.024] (-324.583) (-323.516) * (-322.307) (-322.756) [-321.897] (-323.130) -- 0:00:40
128500 -- (-324.826) (-321.025) (-326.717) [-323.678] * (-322.719) [-323.263] (-324.185) (-322.148) -- 0:00:40
129000 -- (-323.817) (-320.927) [-324.287] (-323.882) * (-323.500) (-321.874) [-323.326] (-322.350) -- 0:00:40
129500 -- [-325.347] (-321.262) (-320.820) (-320.890) * [-323.851] (-322.718) (-324.824) (-322.248) -- 0:00:40
130000 -- (-321.834) (-326.831) (-320.943) [-322.710] * (-321.282) (-323.369) (-322.632) [-322.523] -- 0:00:40
Average standard deviation of split frequencies: 0.004810
130500 -- (-322.768) [-321.811] (-321.314) (-323.164) * (-322.820) (-322.647) (-323.530) [-324.600] -- 0:00:39
131000 -- [-324.361] (-323.147) (-321.404) (-324.677) * (-324.999) [-321.392] (-322.261) (-328.310) -- 0:00:39
131500 -- (-322.945) [-324.971] (-322.118) (-322.106) * (-327.820) [-323.495] (-322.099) (-322.684) -- 0:00:39
132000 -- (-323.302) (-328.238) (-321.230) [-320.852] * (-324.291) (-321.687) [-322.003] (-323.074) -- 0:00:39
132500 -- (-322.296) (-324.647) [-322.430] (-322.305) * (-327.469) (-322.907) [-322.873] (-320.640) -- 0:00:39
133000 -- (-320.864) (-325.438) [-321.884] (-321.798) * (-328.323) (-322.815) [-322.251] (-324.371) -- 0:00:39
133500 -- (-322.219) (-323.818) [-322.074] (-325.152) * (-325.976) (-322.922) (-323.194) [-321.051] -- 0:00:38
134000 -- (-321.160) (-322.262) [-323.623] (-321.739) * [-323.890] (-321.677) (-323.055) (-322.114) -- 0:00:38
134500 -- [-325.105] (-322.781) (-322.687) (-323.040) * (-327.295) (-321.272) [-321.634] (-324.122) -- 0:00:38
135000 -- (-325.353) (-325.778) [-321.787] (-328.202) * (-324.289) (-320.967) (-322.211) [-321.773] -- 0:00:38
Average standard deviation of split frequencies: 0.004622
135500 -- (-325.706) [-323.994] (-329.687) (-323.122) * (-322.421) [-324.292] (-323.387) (-325.061) -- 0:00:38
136000 -- (-326.879) [-322.164] (-325.075) (-324.102) * (-321.296) (-321.403) [-323.337] (-323.245) -- 0:00:38
136500 -- (-324.773) (-321.912) [-322.276] (-324.451) * (-321.387) (-321.984) [-321.111] (-323.844) -- 0:00:44
137000 -- (-321.687) (-321.881) (-323.502) [-322.975] * [-320.958] (-324.501) (-322.937) (-328.371) -- 0:00:44
137500 -- (-322.948) (-321.857) [-323.599] (-323.512) * (-321.489) (-321.928) (-321.993) [-325.729] -- 0:00:43
138000 -- (-321.414) [-325.107] (-322.643) (-321.930) * [-327.508] (-324.835) (-322.620) (-327.731) -- 0:00:43
138500 -- (-326.823) (-334.004) (-328.957) [-321.466] * [-323.675] (-322.653) (-321.627) (-322.169) -- 0:00:43
139000 -- [-321.471] (-324.939) (-322.558) (-321.776) * (-322.952) (-325.108) [-320.898] (-323.185) -- 0:00:43
139500 -- (-321.339) (-324.376) [-321.240] (-322.814) * (-325.613) (-324.134) [-323.644] (-322.508) -- 0:00:43
140000 -- (-324.197) [-322.406] (-325.127) (-323.247) * (-320.835) (-323.009) [-322.861] (-321.324) -- 0:00:43
Average standard deviation of split frequencies: 0.004468
140500 -- (-325.110) (-320.918) (-322.532) [-324.464] * (-325.789) (-323.506) (-324.128) [-322.597] -- 0:00:42
141000 -- (-322.407) [-320.979] (-320.899) (-323.878) * [-321.484] (-325.475) (-322.365) (-321.080) -- 0:00:42
141500 -- (-321.516) [-321.428] (-324.197) (-324.965) * (-321.660) [-322.428] (-321.644) (-321.495) -- 0:00:42
142000 -- (-323.736) (-321.638) [-322.609] (-322.944) * (-322.731) [-323.032] (-323.782) (-326.211) -- 0:00:42
142500 -- [-322.056] (-325.882) (-321.913) (-323.018) * (-323.887) [-323.598] (-322.330) (-323.940) -- 0:00:42
143000 -- [-323.060] (-324.441) (-321.845) (-326.411) * [-322.146] (-325.592) (-323.329) (-322.595) -- 0:00:41
143500 -- (-324.892) (-322.772) [-323.213] (-327.392) * (-321.845) (-322.694) [-323.752] (-324.634) -- 0:00:41
144000 -- [-320.865] (-326.667) (-321.487) (-321.541) * (-325.971) [-322.057] (-324.188) (-322.333) -- 0:00:41
144500 -- [-322.731] (-322.748) (-321.233) (-323.062) * (-321.092) [-324.454] (-321.867) (-322.537) -- 0:00:41
145000 -- (-323.915) (-322.566) [-323.039] (-324.676) * (-324.969) (-321.452) [-320.720] (-322.384) -- 0:00:41
Average standard deviation of split frequencies: 0.008610
145500 -- (-322.793) (-324.010) (-322.323) [-322.554] * (-321.054) [-321.535] (-322.244) (-322.765) -- 0:00:41
146000 -- (-326.414) (-323.300) [-323.372] (-321.882) * (-325.823) (-327.442) [-321.176] (-321.926) -- 0:00:40
146500 -- [-323.009] (-322.138) (-322.746) (-323.525) * [-324.653] (-321.198) (-321.434) (-323.922) -- 0:00:40
147000 -- (-323.119) [-326.350] (-323.107) (-322.802) * (-329.543) (-320.832) [-324.767] (-324.912) -- 0:00:40
147500 -- (-322.528) (-324.281) (-327.311) [-322.854] * [-323.457] (-320.562) (-322.877) (-322.721) -- 0:00:40
148000 -- [-321.325] (-331.457) (-331.780) (-326.608) * (-322.185) [-321.111] (-322.094) (-320.827) -- 0:00:40
148500 -- (-325.131) (-322.981) [-322.279] (-322.364) * (-324.689) (-321.578) [-322.173] (-324.472) -- 0:00:40
149000 -- (-322.584) (-322.646) [-324.680] (-323.925) * [-327.126] (-322.817) (-325.273) (-322.161) -- 0:00:39
149500 -- (-321.684) [-325.209] (-324.050) (-327.195) * (-323.507) (-324.588) (-326.238) [-322.840] -- 0:00:39
150000 -- [-322.959] (-321.213) (-324.854) (-322.390) * [-321.838] (-323.427) (-322.815) (-322.369) -- 0:00:39
Average standard deviation of split frequencies: 0.008343
150500 -- (-323.144) (-321.476) (-325.645) [-321.553] * (-324.741) (-322.056) (-323.287) [-324.020] -- 0:00:39
151000 -- (-324.955) (-321.731) [-325.912] (-324.991) * (-322.201) (-321.897) [-321.358] (-321.239) -- 0:00:39
151500 -- (-321.980) (-323.123) (-324.208) [-323.413] * [-321.988] (-320.959) (-322.951) (-327.736) -- 0:00:39
152000 -- (-322.801) (-321.675) [-321.912] (-323.327) * [-327.227] (-322.518) (-327.018) (-331.403) -- 0:00:39
152500 -- (-322.339) [-323.494] (-322.995) (-322.044) * (-322.113) (-323.438) [-323.985] (-325.725) -- 0:00:38
153000 -- [-322.305] (-321.959) (-323.381) (-322.405) * (-321.580) (-326.104) (-323.173) [-325.832] -- 0:00:38
153500 -- (-322.417) (-324.181) [-322.506] (-324.189) * (-322.239) (-322.118) (-323.029) [-325.813] -- 0:00:38
154000 -- (-324.753) (-324.503) (-321.584) [-321.540] * (-323.336) (-322.771) (-323.096) [-321.744] -- 0:00:38
154500 -- (-323.264) (-322.252) [-320.908] (-324.127) * (-326.105) (-321.093) [-322.947] (-324.160) -- 0:00:38
155000 -- (-321.445) (-321.180) (-322.590) [-323.487] * (-326.169) [-321.724] (-323.677) (-321.501) -- 0:00:38
Average standard deviation of split frequencies: 0.008058
155500 -- [-325.689] (-327.286) (-321.519) (-323.139) * (-323.196) [-320.850] (-322.591) (-328.843) -- 0:00:38
156000 -- (-322.364) (-322.853) [-322.352] (-321.859) * (-321.181) [-321.751] (-325.074) (-322.705) -- 0:00:37
156500 -- [-323.208] (-323.871) (-323.000) (-323.705) * (-323.270) (-322.110) [-324.326] (-321.194) -- 0:00:37
157000 -- (-320.703) (-323.068) (-321.446) [-321.743] * [-323.716] (-323.462) (-322.860) (-322.234) -- 0:00:37
157500 -- (-324.638) (-326.309) [-321.606] (-323.851) * (-327.231) (-324.396) [-321.722] (-328.439) -- 0:00:37
158000 -- (-322.455) (-323.615) [-322.431] (-322.191) * [-325.399] (-321.174) (-320.796) (-327.234) -- 0:00:37
158500 -- (-325.193) (-321.983) (-320.708) [-322.102] * (-323.099) (-322.227) [-321.574] (-322.091) -- 0:00:37
159000 -- (-322.007) (-323.017) [-321.077] (-322.641) * (-320.811) (-321.396) (-321.059) [-323.229] -- 0:00:37
159500 -- [-321.271] (-322.849) (-322.533) (-322.667) * (-322.209) (-323.306) (-322.834) [-321.126] -- 0:00:42
160000 -- (-321.428) [-322.965] (-320.836) (-327.644) * (-321.425) [-321.614] (-324.064) (-322.816) -- 0:00:42
Average standard deviation of split frequencies: 0.009780
160500 -- (-321.138) (-321.704) (-322.630) [-323.650] * (-320.937) (-322.147) [-322.478] (-325.083) -- 0:00:41
161000 -- [-321.120] (-321.802) (-330.773) (-321.884) * (-322.355) (-323.736) [-321.460] (-325.413) -- 0:00:41
161500 -- [-323.257] (-322.077) (-333.123) (-325.310) * (-323.788) (-322.246) [-322.141] (-323.937) -- 0:00:41
162000 -- [-324.015] (-324.003) (-325.213) (-324.891) * (-324.879) [-322.016] (-321.979) (-322.575) -- 0:00:41
162500 -- (-326.412) (-324.080) (-324.089) [-322.982] * (-322.316) (-322.851) (-320.640) [-326.063] -- 0:00:41
163000 -- (-324.355) (-321.790) [-326.598] (-322.408) * (-322.700) (-322.542) (-321.970) [-321.344] -- 0:00:41
163500 -- (-322.739) [-321.674] (-325.243) (-323.058) * [-322.063] (-324.538) (-323.894) (-323.345) -- 0:00:40
164000 -- (-323.313) (-321.295) (-322.677) [-322.722] * (-323.493) (-322.849) (-321.150) [-321.472] -- 0:00:40
164500 -- (-322.501) [-321.594] (-320.981) (-321.000) * (-321.371) (-321.565) (-328.268) [-322.026] -- 0:00:40
165000 -- (-323.292) (-322.937) (-327.014) [-323.180] * [-326.593] (-324.751) (-321.817) (-323.140) -- 0:00:40
Average standard deviation of split frequencies: 0.017039
165500 -- (-329.460) (-324.013) (-323.393) [-323.889] * (-327.120) (-323.450) (-322.726) [-321.997] -- 0:00:40
166000 -- (-323.583) [-322.232] (-323.523) (-322.250) * (-327.028) [-324.400] (-320.809) (-322.259) -- 0:00:40
166500 -- [-322.700] (-323.755) (-322.185) (-322.486) * (-321.530) [-321.249] (-323.567) (-323.244) -- 0:00:40
167000 -- (-326.566) (-323.129) (-324.918) [-323.361] * (-321.950) (-322.300) (-321.463) [-322.641] -- 0:00:39
167500 -- [-322.739] (-322.732) (-322.427) (-322.791) * [-321.901] (-326.102) (-325.030) (-323.420) -- 0:00:39
168000 -- (-326.933) (-321.629) (-321.393) [-323.624] * (-322.728) (-326.733) [-325.606] (-323.314) -- 0:00:39
168500 -- [-322.232] (-321.527) (-323.138) (-324.528) * (-327.173) (-326.184) (-322.586) [-322.007] -- 0:00:39
169000 -- [-322.716] (-322.194) (-321.660) (-324.209) * (-321.893) [-328.808] (-321.841) (-320.845) -- 0:00:39
169500 -- [-322.257] (-325.452) (-322.171) (-322.426) * (-323.192) (-325.555) (-323.244) [-323.749] -- 0:00:39
170000 -- (-321.441) (-329.999) (-321.754) [-320.928] * (-322.544) (-321.213) (-324.324) [-323.399] -- 0:00:39
Average standard deviation of split frequencies: 0.022097
170500 -- (-321.104) (-331.298) [-322.325] (-324.416) * (-322.341) (-322.232) [-322.543] (-322.697) -- 0:00:38
171000 -- (-322.478) [-327.574] (-322.013) (-323.152) * (-320.817) (-323.079) (-323.738) [-321.449] -- 0:00:38
171500 -- [-322.269] (-322.498) (-322.859) (-325.245) * (-324.239) (-323.364) [-323.817] (-322.906) -- 0:00:38
172000 -- (-320.707) (-322.375) [-324.196] (-323.172) * (-325.011) [-320.957] (-321.449) (-329.116) -- 0:00:38
172500 -- (-321.860) (-321.505) (-321.858) [-323.061] * (-325.425) [-322.996] (-321.082) (-326.332) -- 0:00:38
173000 -- (-321.777) [-321.494] (-325.553) (-321.676) * [-322.885] (-321.829) (-321.369) (-321.890) -- 0:00:38
173500 -- (-322.781) [-320.745] (-321.438) (-325.465) * (-321.190) (-323.563) (-321.992) [-322.469] -- 0:00:38
174000 -- (-322.772) (-324.334) (-323.996) [-321.116] * (-320.958) (-324.632) (-326.442) [-320.870] -- 0:00:37
174500 -- [-324.105] (-324.614) (-323.515) (-321.937) * (-322.450) (-320.498) (-322.683) [-321.306] -- 0:00:37
175000 -- (-322.546) [-322.762] (-321.916) (-323.838) * (-324.391) (-325.022) (-323.008) [-320.975] -- 0:00:37
Average standard deviation of split frequencies: 0.021427
175500 -- (-322.065) (-321.133) (-324.167) [-321.341] * [-320.600] (-323.099) (-322.540) (-323.803) -- 0:00:37
176000 -- (-322.513) (-327.016) [-322.422] (-321.549) * (-320.656) (-321.827) [-321.502] (-323.529) -- 0:00:37
176500 -- [-323.722] (-323.225) (-321.879) (-323.530) * [-321.395] (-320.803) (-324.122) (-324.946) -- 0:00:37
177000 -- (-322.311) (-320.684) [-322.484] (-322.098) * (-320.984) (-321.679) [-324.879] (-324.059) -- 0:00:37
177500 -- (-326.009) (-324.052) [-323.956] (-324.081) * [-322.142] (-321.906) (-323.109) (-324.466) -- 0:00:37
178000 -- (-322.518) [-322.951] (-323.481) (-323.973) * (-322.336) [-323.431] (-327.213) (-321.225) -- 0:00:36
178500 -- (-322.883) (-320.663) (-320.717) [-323.714] * (-323.677) (-321.723) [-322.181] (-320.589) -- 0:00:36
179000 -- (-323.084) [-322.870] (-323.950) (-322.966) * [-321.108] (-322.110) (-328.221) (-323.425) -- 0:00:36
179500 -- (-322.264) [-323.743] (-328.761) (-324.832) * [-325.019] (-324.022) (-322.217) (-323.349) -- 0:00:36
180000 -- [-322.347] (-321.754) (-324.115) (-322.999) * (-323.426) (-324.647) [-321.625] (-326.973) -- 0:00:36
Average standard deviation of split frequencies: 0.017395
180500 -- (-328.781) [-323.301] (-327.970) (-321.799) * (-321.856) [-322.593] (-321.825) (-327.380) -- 0:00:36
181000 -- (-320.929) [-321.297] (-322.151) (-321.934) * (-322.349) (-325.143) (-322.415) [-325.553] -- 0:00:36
181500 -- (-322.335) [-321.763] (-324.806) (-325.134) * (-322.100) (-325.532) [-323.071] (-321.916) -- 0:00:36
182000 -- (-322.647) (-324.177) (-322.403) [-321.328] * (-324.500) (-325.933) (-320.650) [-323.746] -- 0:00:40
182500 -- (-322.772) (-321.187) (-321.987) [-321.190] * (-323.544) (-323.332) (-322.189) [-326.471] -- 0:00:40
183000 -- (-321.545) (-325.285) (-325.479) [-321.498] * [-324.597] (-323.152) (-321.582) (-327.641) -- 0:00:40
183500 -- [-321.893] (-321.544) (-326.131) (-322.992) * (-322.637) [-321.664] (-320.989) (-323.088) -- 0:00:40
184000 -- [-326.040] (-322.726) (-325.335) (-321.856) * (-321.753) (-323.890) (-321.740) [-321.129] -- 0:00:39
184500 -- (-325.392) (-322.285) (-321.897) [-323.081] * (-324.003) [-321.843] (-321.635) (-325.878) -- 0:00:39
185000 -- (-321.906) (-321.608) [-323.764] (-323.791) * [-323.339] (-327.124) (-321.657) (-322.572) -- 0:00:39
Average standard deviation of split frequencies: 0.021965
185500 -- (-321.045) [-321.388] (-321.547) (-322.915) * (-322.312) [-322.438] (-321.757) (-322.817) -- 0:00:39
186000 -- (-322.892) [-321.552] (-321.579) (-325.116) * (-325.158) [-323.573] (-323.858) (-325.738) -- 0:00:39
186500 -- (-323.505) [-321.552] (-323.053) (-325.874) * [-321.605] (-322.407) (-323.239) (-325.132) -- 0:00:39
187000 -- (-323.970) [-321.071] (-321.474) (-323.171) * (-324.853) [-326.063] (-322.420) (-325.327) -- 0:00:39
187500 -- [-323.079] (-328.496) (-324.263) (-321.900) * (-325.305) [-326.552] (-322.107) (-324.143) -- 0:00:39
188000 -- (-322.429) [-325.561] (-322.697) (-327.308) * (-321.340) [-323.350] (-322.007) (-322.129) -- 0:00:38
188500 -- (-321.431) (-329.080) (-325.788) [-320.693] * [-321.839] (-321.460) (-322.336) (-323.454) -- 0:00:38
189000 -- (-325.068) (-324.115) [-321.411] (-322.122) * [-320.730] (-324.179) (-321.544) (-322.809) -- 0:00:38
189500 -- (-321.583) (-324.878) (-321.088) [-323.740] * [-320.802] (-322.091) (-324.590) (-322.268) -- 0:00:38
190000 -- (-320.707) (-321.879) (-320.807) [-325.375] * (-321.035) (-321.537) [-322.035] (-324.082) -- 0:00:38
Average standard deviation of split frequencies: 0.023076
190500 -- (-320.475) (-322.061) [-322.018] (-322.626) * [-323.014] (-326.056) (-323.813) (-321.606) -- 0:00:38
191000 -- (-326.827) (-324.124) [-322.975] (-324.175) * (-321.262) [-323.130] (-324.352) (-321.702) -- 0:00:38
191500 -- [-323.324] (-325.049) (-322.647) (-325.643) * (-321.424) (-320.573) (-323.662) [-325.527] -- 0:00:37
192000 -- (-323.699) (-325.465) [-321.861] (-326.168) * (-321.814) [-321.839] (-325.982) (-323.621) -- 0:00:37
192500 -- (-327.272) [-325.053] (-321.913) (-321.342) * (-324.938) (-322.503) (-324.713) [-323.530] -- 0:00:37
193000 -- (-324.395) [-324.577] (-330.443) (-325.852) * (-325.098) (-323.289) (-327.264) [-322.379] -- 0:00:37
193500 -- (-323.676) (-320.578) (-324.875) [-327.927] * (-321.775) [-323.786] (-323.959) (-322.869) -- 0:00:37
194000 -- (-321.959) (-324.670) [-324.155] (-324.616) * (-323.636) [-325.090] (-328.398) (-324.930) -- 0:00:37
194500 -- (-323.996) [-324.636] (-321.467) (-323.946) * (-322.309) [-322.352] (-325.725) (-321.942) -- 0:00:37
195000 -- [-321.823] (-323.276) (-321.535) (-325.404) * (-322.804) [-322.321] (-321.675) (-322.660) -- 0:00:37
Average standard deviation of split frequencies: 0.030465
195500 -- (-320.927) (-323.614) [-321.725] (-323.346) * (-322.567) (-325.450) (-326.336) [-322.227] -- 0:00:37
196000 -- (-322.925) [-322.872] (-322.922) (-324.892) * (-322.460) (-323.790) [-321.510] (-322.699) -- 0:00:36
196500 -- (-324.398) (-324.586) (-323.674) [-325.260] * (-321.241) [-325.141] (-320.871) (-322.752) -- 0:00:36
197000 -- (-325.880) [-321.722] (-328.004) (-324.389) * [-321.617] (-321.671) (-325.138) (-321.795) -- 0:00:36
197500 -- [-322.991] (-320.900) (-327.043) (-323.453) * [-323.135] (-324.330) (-321.687) (-322.808) -- 0:00:36
198000 -- (-321.685) (-324.617) [-326.392] (-325.446) * (-321.309) (-320.878) (-322.148) [-321.532] -- 0:00:36
198500 -- (-323.020) (-326.625) (-323.155) [-321.632] * (-326.441) (-321.472) [-322.460] (-327.544) -- 0:00:36
199000 -- (-325.475) [-322.932] (-323.014) (-324.101) * (-322.929) (-321.358) (-321.072) [-322.558] -- 0:00:36
199500 -- (-325.828) (-324.627) [-325.669] (-321.912) * (-321.092) (-323.020) [-330.835] (-322.995) -- 0:00:36
200000 -- [-324.965] (-322.692) (-321.867) (-324.723) * (-327.463) (-325.269) (-321.650) [-320.871] -- 0:00:36
Average standard deviation of split frequencies: 0.028190
200500 -- [-322.950] (-321.639) (-327.212) (-325.164) * (-324.908) (-321.622) [-320.783] (-322.715) -- 0:00:35
201000 -- (-324.297) (-321.673) (-325.939) [-320.780] * [-322.945] (-322.946) (-322.108) (-328.648) -- 0:00:35
201500 -- [-323.181] (-322.259) (-325.431) (-321.520) * [-321.943] (-321.224) (-321.997) (-321.736) -- 0:00:35
202000 -- [-323.190] (-323.512) (-320.971) (-321.719) * (-321.025) (-321.118) [-322.443] (-325.307) -- 0:00:35
202500 -- (-322.486) [-323.519] (-320.741) (-322.935) * (-324.417) (-322.352) (-320.609) [-327.627] -- 0:00:35
203000 -- (-324.052) (-320.645) (-324.662) [-322.863] * (-323.156) [-321.309] (-323.700) (-325.949) -- 0:00:35
203500 -- [-323.817] (-323.205) (-324.125) (-321.022) * (-322.531) (-321.210) [-321.980] (-321.289) -- 0:00:35
204000 -- (-321.387) (-322.067) [-320.563] (-322.206) * (-325.890) [-321.190] (-321.817) (-322.229) -- 0:00:35
204500 -- (-321.361) (-325.936) [-324.472] (-321.151) * (-323.779) (-320.689) [-323.638] (-325.231) -- 0:00:35
205000 -- (-322.391) (-321.743) [-323.097] (-327.379) * (-323.050) (-322.107) [-321.171] (-320.974) -- 0:00:38
Average standard deviation of split frequencies: 0.024409
205500 -- (-322.806) (-323.176) (-323.093) [-325.071] * (-321.793) (-324.240) (-322.776) [-321.286] -- 0:00:38
206000 -- (-324.286) (-322.120) [-320.690] (-321.225) * (-322.845) (-322.953) (-324.780) [-321.152] -- 0:00:38
206500 -- (-320.589) (-323.784) [-322.268] (-324.403) * (-322.796) (-322.833) (-331.178) [-320.598] -- 0:00:38
207000 -- (-321.266) [-323.042] (-325.384) (-323.791) * [-323.167] (-323.357) (-324.915) (-324.193) -- 0:00:38
207500 -- (-328.501) (-322.494) (-323.086) [-324.044] * (-322.897) (-321.859) [-323.736] (-323.354) -- 0:00:38
208000 -- [-320.883] (-322.775) (-323.533) (-320.473) * (-322.306) [-325.382] (-326.873) (-322.697) -- 0:00:38
208500 -- [-322.422] (-328.978) (-322.142) (-325.457) * (-323.681) [-322.341] (-324.415) (-325.775) -- 0:00:37
209000 -- (-328.210) (-323.082) (-322.298) [-323.466] * (-323.136) [-322.182] (-326.148) (-322.736) -- 0:00:37
209500 -- (-325.045) (-327.314) (-323.746) [-324.736] * (-322.780) (-322.657) [-325.198] (-322.834) -- 0:00:37
210000 -- (-324.848) [-323.073] (-321.427) (-321.081) * [-322.041] (-324.688) (-321.211) (-322.381) -- 0:00:37
Average standard deviation of split frequencies: 0.029836
210500 -- (-322.572) (-323.901) (-324.002) [-324.505] * [-320.923] (-323.190) (-322.220) (-323.064) -- 0:00:37
211000 -- (-324.667) (-321.738) (-322.002) [-323.285] * (-324.752) [-321.549] (-323.172) (-321.750) -- 0:00:37
211500 -- (-328.186) (-324.970) [-322.704] (-321.390) * (-321.773) [-324.727] (-321.410) (-327.961) -- 0:00:37
212000 -- (-324.407) [-322.026] (-322.798) (-322.690) * [-321.094] (-322.148) (-322.446) (-325.158) -- 0:00:37
212500 -- (-320.770) (-325.004) (-324.329) [-322.247] * (-324.546) (-323.849) (-323.205) [-322.180] -- 0:00:37
213000 -- [-322.932] (-324.555) (-324.814) (-326.249) * (-326.035) (-323.970) [-321.242] (-322.524) -- 0:00:36
213500 -- (-321.108) (-320.541) [-327.173] (-323.419) * [-324.986] (-321.737) (-321.405) (-321.694) -- 0:00:36
214000 -- (-322.745) (-324.558) [-322.568] (-325.392) * (-324.479) (-322.502) [-326.267] (-324.261) -- 0:00:36
214500 -- [-322.912] (-325.054) (-321.969) (-329.724) * (-324.158) [-320.644] (-321.601) (-322.149) -- 0:00:36
215000 -- (-322.063) (-321.255) (-323.969) [-323.855] * (-325.199) (-320.779) (-326.798) [-322.547] -- 0:00:36
Average standard deviation of split frequencies: 0.029099
215500 -- (-326.803) (-325.690) [-321.107] (-325.651) * (-323.448) [-321.625] (-321.487) (-323.481) -- 0:00:36
216000 -- (-323.165) [-322.585] (-321.945) (-321.230) * (-325.116) (-321.912) [-321.747] (-323.971) -- 0:00:36
216500 -- (-323.650) (-321.354) [-321.111] (-324.325) * (-326.376) (-324.438) (-321.946) [-322.274] -- 0:00:36
217000 -- (-322.800) (-323.709) [-325.497] (-323.695) * (-324.665) (-321.174) (-322.052) [-324.067] -- 0:00:36
217500 -- (-322.742) [-323.361] (-324.839) (-321.504) * (-323.912) (-321.836) (-326.318) [-323.372] -- 0:00:35
218000 -- (-321.894) (-324.033) [-326.712] (-322.544) * (-321.650) (-322.429) [-325.817] (-323.659) -- 0:00:35
218500 -- (-326.706) [-321.785] (-322.733) (-324.175) * (-320.849) (-321.138) (-323.451) [-322.048] -- 0:00:35
219000 -- [-322.100] (-321.912) (-321.228) (-321.133) * (-321.348) (-321.755) [-321.979] (-324.943) -- 0:00:35
219500 -- [-325.972] (-321.915) (-322.975) (-324.037) * [-322.648] (-323.063) (-320.979) (-327.516) -- 0:00:35
220000 -- [-323.924] (-322.954) (-322.363) (-325.578) * (-323.355) (-320.972) (-323.909) [-322.793] -- 0:00:35
Average standard deviation of split frequencies: 0.032756
220500 -- (-321.995) [-320.650] (-322.025) (-322.057) * (-324.805) (-323.478) (-323.005) [-324.349] -- 0:00:35
221000 -- (-323.495) [-321.172] (-322.322) (-322.468) * (-323.844) [-324.209] (-322.451) (-323.373) -- 0:00:35
221500 -- (-321.713) [-324.742] (-323.270) (-321.174) * (-322.027) [-322.718] (-325.020) (-321.243) -- 0:00:35
222000 -- (-321.861) (-321.316) [-321.202] (-321.988) * [-323.465] (-322.865) (-323.573) (-327.253) -- 0:00:35
222500 -- (-323.816) (-326.060) [-324.537] (-323.953) * (-325.528) (-321.496) [-322.830] (-324.269) -- 0:00:34
223000 -- [-320.877] (-325.340) (-321.963) (-325.859) * (-321.616) (-323.394) [-324.355] (-322.688) -- 0:00:34
223500 -- [-321.652] (-323.775) (-321.205) (-323.365) * (-321.782) (-324.829) (-322.785) [-322.420] -- 0:00:34
224000 -- (-326.728) (-321.374) (-322.879) [-320.397] * [-322.890] (-323.537) (-325.368) (-322.414) -- 0:00:34
224500 -- (-325.812) (-322.679) (-324.633) [-324.391] * (-322.921) (-325.935) [-322.227] (-321.890) -- 0:00:34
225000 -- [-325.164] (-323.443) (-322.406) (-322.911) * (-323.658) (-323.071) (-324.259) [-321.851] -- 0:00:34
Average standard deviation of split frequencies: 0.031983
225500 -- [-323.435] (-320.998) (-323.954) (-321.775) * (-321.375) [-324.446] (-324.685) (-327.556) -- 0:00:34
226000 -- (-322.518) (-324.636) (-322.087) [-321.948] * (-323.746) [-321.783] (-324.678) (-326.894) -- 0:00:34
226500 -- [-322.620] (-321.630) (-324.815) (-323.468) * (-322.262) [-322.058] (-322.227) (-325.446) -- 0:00:34
227000 -- (-321.447) [-323.327] (-321.629) (-327.045) * (-326.640) (-322.207) (-321.027) [-321.862] -- 0:00:34
227500 -- (-321.757) (-324.169) (-322.743) [-320.892] * (-327.992) [-323.308] (-322.041) (-321.470) -- 0:00:37
228000 -- (-322.917) (-331.781) (-327.415) [-324.368] * (-321.932) (-332.230) [-326.090] (-321.290) -- 0:00:37
228500 -- (-323.470) [-322.979] (-328.739) (-324.284) * [-322.955] (-321.432) (-324.432) (-322.698) -- 0:00:37
229000 -- [-325.833] (-327.823) (-322.902) (-322.297) * (-321.349) (-321.453) [-321.717] (-326.955) -- 0:00:37
229500 -- [-324.270] (-322.328) (-326.248) (-323.828) * [-321.397] (-322.303) (-320.878) (-324.742) -- 0:00:36
230000 -- (-321.903) [-324.595] (-326.203) (-329.105) * [-320.583] (-321.269) (-323.481) (-324.401) -- 0:00:36
Average standard deviation of split frequencies: 0.028611
230500 -- (-320.860) (-322.368) (-321.386) [-321.147] * [-323.569] (-323.185) (-323.961) (-322.421) -- 0:00:36
231000 -- (-326.306) (-324.130) [-321.702] (-325.928) * (-322.426) [-322.432] (-321.368) (-323.404) -- 0:00:36
231500 -- (-322.828) (-321.268) (-321.202) [-323.056] * (-323.116) (-325.085) (-322.600) [-320.994] -- 0:00:36
232000 -- (-327.744) (-324.313) [-323.390] (-323.082) * (-322.533) [-320.651] (-321.006) (-322.981) -- 0:00:36
232500 -- (-324.050) (-322.821) (-322.256) [-322.629] * (-321.405) [-326.397] (-324.741) (-322.510) -- 0:00:36
233000 -- (-321.505) (-324.570) (-322.225) [-325.916] * (-321.655) [-322.718] (-323.859) (-322.840) -- 0:00:36
233500 -- (-321.207) [-322.181] (-324.091) (-323.915) * (-323.941) (-322.236) (-324.730) [-323.340] -- 0:00:36
234000 -- [-322.764] (-321.307) (-321.350) (-321.271) * (-327.827) (-322.510) [-326.108] (-323.897) -- 0:00:36
234500 -- (-322.796) (-320.861) (-321.333) [-323.226] * (-321.810) (-322.525) (-324.561) [-323.777] -- 0:00:35
235000 -- (-323.316) [-321.645] (-323.841) (-326.343) * [-321.869] (-322.721) (-324.455) (-321.633) -- 0:00:35
Average standard deviation of split frequencies: 0.025301
235500 -- (-322.790) (-321.237) [-320.770] (-323.594) * (-322.884) [-321.395] (-324.082) (-322.062) -- 0:00:35
236000 -- (-324.697) (-325.181) (-325.052) [-323.609] * (-327.024) (-323.812) [-322.404] (-323.299) -- 0:00:35
236500 -- (-321.387) [-322.306] (-322.809) (-321.229) * (-322.414) (-324.341) [-321.091] (-322.778) -- 0:00:35
237000 -- (-321.142) (-322.223) (-325.045) [-323.775] * [-324.987] (-322.303) (-323.449) (-325.996) -- 0:00:35
237500 -- (-322.150) (-323.811) (-323.199) [-321.234] * (-322.034) (-321.015) [-324.510] (-323.423) -- 0:00:35
238000 -- (-322.932) [-323.088] (-321.842) (-321.463) * (-323.719) (-321.255) [-323.622] (-324.959) -- 0:00:35
238500 -- (-322.496) [-322.750] (-322.739) (-323.548) * (-322.087) (-323.810) (-322.501) [-325.099] -- 0:00:35
239000 -- [-321.455] (-322.600) (-325.576) (-323.445) * [-322.444] (-322.901) (-322.015) (-324.138) -- 0:00:35
239500 -- [-322.016] (-323.684) (-321.649) (-325.461) * (-322.363) [-322.358] (-320.872) (-323.272) -- 0:00:34
240000 -- (-324.836) [-321.513] (-321.444) (-323.687) * (-320.833) (-325.945) (-323.561) [-322.849] -- 0:00:34
Average standard deviation of split frequencies: 0.024811
240500 -- (-323.872) (-322.289) [-322.733] (-321.544) * (-322.780) [-322.424] (-323.305) (-323.946) -- 0:00:34
241000 -- [-321.038] (-325.596) (-323.916) (-322.656) * (-325.648) (-323.531) (-325.710) [-321.401] -- 0:00:34
241500 -- [-321.908] (-323.268) (-321.794) (-322.029) * (-324.297) (-325.728) (-321.102) [-322.995] -- 0:00:34
242000 -- (-321.401) (-320.940) [-320.515] (-321.959) * (-323.644) (-328.287) [-324.523] (-322.036) -- 0:00:34
242500 -- (-323.064) (-322.376) (-326.351) [-321.290] * (-322.304) (-323.253) [-321.744] (-323.364) -- 0:00:34
243000 -- [-322.812] (-323.916) (-323.047) (-320.991) * (-321.628) [-324.411] (-324.199) (-324.008) -- 0:00:34
243500 -- (-323.991) (-322.067) (-322.630) [-320.707] * (-323.977) (-323.842) [-322.929] (-325.437) -- 0:00:34
244000 -- (-327.397) [-320.779] (-321.895) (-323.942) * [-325.153] (-323.412) (-322.984) (-323.891) -- 0:00:34
244500 -- (-321.974) (-320.949) (-322.061) [-323.966] * (-323.699) (-322.202) [-321.039] (-321.096) -- 0:00:33
245000 -- (-321.362) [-321.752] (-323.142) (-321.918) * (-321.573) [-321.726] (-323.786) (-320.997) -- 0:00:33
Average standard deviation of split frequencies: 0.028105
245500 -- (-323.794) (-323.968) [-321.724] (-322.649) * (-321.635) [-322.332] (-320.761) (-323.433) -- 0:00:33
246000 -- [-323.981] (-324.587) (-322.286) (-321.547) * (-321.424) [-322.962] (-323.782) (-324.225) -- 0:00:33
246500 -- (-321.683) [-322.140] (-321.434) (-323.755) * (-322.301) (-328.383) [-323.374] (-320.727) -- 0:00:33
247000 -- (-321.962) (-323.958) [-321.827] (-322.066) * (-322.092) (-321.641) [-324.926] (-322.580) -- 0:00:33
247500 -- (-324.668) (-322.466) [-322.894] (-322.256) * [-322.066] (-322.482) (-328.404) (-322.089) -- 0:00:33
248000 -- (-323.061) [-321.967] (-323.726) (-323.233) * [-320.937] (-321.776) (-323.469) (-322.162) -- 0:00:33
248500 -- (-322.369) [-325.123] (-322.359) (-322.535) * (-321.059) (-321.755) [-321.932] (-322.325) -- 0:00:33
249000 -- [-322.163] (-322.263) (-321.350) (-331.057) * (-322.913) [-322.352] (-324.002) (-324.900) -- 0:00:36
249500 -- [-324.662] (-320.898) (-322.647) (-321.974) * (-323.277) (-326.158) (-322.691) [-321.388] -- 0:00:36
250000 -- (-321.884) (-321.912) (-323.924) [-322.742] * [-322.364] (-325.990) (-321.709) (-322.983) -- 0:00:36
Average standard deviation of split frequencies: 0.027582
250500 -- (-333.068) (-325.641) [-323.442] (-322.290) * (-323.733) [-321.827] (-323.640) (-321.950) -- 0:00:35
251000 -- (-321.627) (-322.254) [-321.008] (-322.109) * (-323.642) [-322.248] (-321.073) (-335.074) -- 0:00:35
251500 -- (-322.068) [-324.909] (-321.548) (-322.254) * (-323.213) [-321.545] (-320.721) (-323.811) -- 0:00:35
252000 -- [-321.625] (-321.717) (-321.702) (-321.738) * (-322.332) [-322.304] (-323.038) (-325.257) -- 0:00:35
252500 -- (-320.957) [-327.087] (-325.739) (-321.817) * (-323.057) (-330.155) (-320.940) [-324.269] -- 0:00:35
253000 -- (-325.445) [-323.429] (-322.133) (-322.928) * (-322.492) [-322.445] (-322.205) (-321.720) -- 0:00:35
253500 -- (-321.763) (-322.956) (-325.276) [-321.520] * [-322.047] (-321.337) (-329.588) (-323.196) -- 0:00:35
254000 -- (-321.112) [-322.142] (-323.818) (-323.574) * (-323.709) [-323.328] (-322.606) (-322.791) -- 0:00:35
254500 -- (-325.966) [-323.154] (-323.973) (-325.213) * (-323.729) (-322.852) [-321.194] (-321.273) -- 0:00:35
255000 -- (-326.881) (-322.524) [-321.139] (-322.570) * (-321.294) [-321.642] (-323.399) (-322.719) -- 0:00:35
Average standard deviation of split frequencies: 0.023325
255500 -- (-325.889) (-323.980) [-325.661] (-321.783) * [-324.031] (-320.723) (-323.408) (-322.241) -- 0:00:34
256000 -- (-320.650) [-322.270] (-321.408) (-323.498) * (-324.317) [-321.998] (-324.194) (-325.544) -- 0:00:34
256500 -- (-322.267) (-322.814) [-324.017] (-322.738) * (-321.154) (-323.776) (-323.402) [-321.884] -- 0:00:34
257000 -- (-321.818) [-325.450] (-325.091) (-321.833) * [-323.466] (-323.525) (-321.457) (-322.684) -- 0:00:34
257500 -- (-322.560) [-323.676] (-323.607) (-322.932) * (-323.598) [-321.053] (-327.666) (-321.738) -- 0:00:34
258000 -- [-327.250] (-323.007) (-325.210) (-323.356) * [-322.377] (-322.280) (-325.814) (-321.658) -- 0:00:34
258500 -- (-322.971) (-322.142) (-323.529) [-323.553] * [-322.207] (-321.714) (-323.266) (-327.524) -- 0:00:34
259000 -- (-324.436) (-324.909) (-323.054) [-321.178] * (-323.083) (-322.026) [-323.952] (-326.322) -- 0:00:34
259500 -- (-322.722) [-321.627] (-323.915) (-324.136) * (-329.232) (-324.000) [-323.441] (-322.477) -- 0:00:34
260000 -- (-325.437) (-322.966) [-321.569] (-322.217) * [-322.287] (-323.079) (-322.937) (-321.626) -- 0:00:34
Average standard deviation of split frequencies: 0.025318
260500 -- (-323.677) [-322.250] (-322.972) (-321.563) * (-323.311) (-323.056) [-321.335] (-323.297) -- 0:00:34
261000 -- (-324.901) (-329.423) (-322.951) [-322.206] * (-323.188) (-324.912) (-323.686) [-322.338] -- 0:00:33
261500 -- (-321.932) (-321.756) (-320.539) [-321.671] * (-328.455) [-324.738] (-324.237) (-324.462) -- 0:00:33
262000 -- (-321.780) [-323.331] (-321.685) (-322.432) * (-323.289) (-327.354) [-320.658] (-322.864) -- 0:00:33
262500 -- (-322.054) (-326.722) [-323.674] (-321.750) * [-321.499] (-322.941) (-321.024) (-322.848) -- 0:00:33
263000 -- (-323.651) (-321.978) [-323.951] (-325.097) * (-328.103) (-328.801) [-323.364] (-328.719) -- 0:00:33
263500 -- (-321.224) [-321.853] (-325.043) (-322.313) * (-326.270) (-324.634) [-322.730] (-328.618) -- 0:00:33
264000 -- (-323.133) (-322.728) [-323.219] (-321.716) * (-324.602) (-320.908) (-321.384) [-323.004] -- 0:00:33
264500 -- (-323.684) (-321.267) (-323.832) [-322.065] * (-322.647) (-321.524) (-322.772) [-322.845] -- 0:00:33
265000 -- (-324.150) [-324.545] (-325.373) (-322.061) * [-323.640] (-322.577) (-321.368) (-322.579) -- 0:00:33
Average standard deviation of split frequencies: 0.022448
265500 -- (-323.436) (-322.380) (-322.822) [-322.857] * (-321.330) (-327.670) [-323.153] (-321.820) -- 0:00:33
266000 -- (-324.668) [-323.971] (-320.917) (-323.359) * (-323.795) [-328.474] (-321.805) (-324.853) -- 0:00:33
266500 -- [-321.875] (-323.708) (-323.198) (-323.358) * (-322.766) (-322.611) (-326.964) [-325.820] -- 0:00:33
267000 -- [-322.011] (-321.529) (-322.594) (-322.699) * (-328.058) (-327.059) [-321.739] (-321.250) -- 0:00:32
267500 -- (-323.108) (-323.352) (-324.242) [-320.580] * (-323.039) [-324.943] (-322.579) (-324.734) -- 0:00:32
268000 -- [-323.023] (-324.132) (-323.603) (-324.583) * (-323.204) [-323.297] (-322.393) (-323.323) -- 0:00:32
268500 -- (-325.163) (-321.964) (-324.825) [-321.239] * (-322.271) (-324.882) (-322.658) [-321.352] -- 0:00:32
269000 -- (-327.146) (-323.609) [-325.913] (-322.487) * (-321.951) (-323.351) (-321.465) [-322.330] -- 0:00:32
269500 -- (-321.737) (-323.474) [-321.884] (-324.309) * [-321.798] (-324.226) (-324.571) (-327.077) -- 0:00:32
270000 -- (-324.132) (-325.457) [-322.826] (-323.169) * [-323.233] (-322.263) (-326.092) (-321.728) -- 0:00:35
Average standard deviation of split frequencies: 0.015094
270500 -- [-323.743] (-326.990) (-325.056) (-323.967) * (-322.146) (-324.549) [-324.044] (-326.481) -- 0:00:35
271000 -- (-322.995) (-325.617) (-327.130) [-326.763] * [-325.809] (-322.075) (-322.642) (-320.889) -- 0:00:34
271500 -- (-324.639) (-323.679) (-320.483) [-322.622] * [-324.599] (-323.405) (-323.739) (-328.856) -- 0:00:34
272000 -- (-322.923) (-325.020) [-323.179] (-324.114) * (-322.539) (-323.574) [-324.940] (-324.438) -- 0:00:34
272500 -- [-321.788] (-327.783) (-321.242) (-322.787) * (-321.271) (-325.859) [-322.212] (-323.309) -- 0:00:34
273000 -- (-325.446) [-323.850] (-324.760) (-321.392) * (-323.908) (-322.392) [-324.996] (-322.102) -- 0:00:34
273500 -- (-321.777) (-321.328) (-325.476) [-322.855] * (-324.835) [-323.343] (-323.937) (-327.266) -- 0:00:34
274000 -- [-323.536] (-324.875) (-327.396) (-323.319) * (-321.065) (-321.639) (-326.216) [-324.971] -- 0:00:34
274500 -- (-322.366) (-322.890) (-327.187) [-322.129] * [-322.448] (-323.316) (-323.433) (-323.167) -- 0:00:34
275000 -- (-320.666) (-321.111) (-326.338) [-321.547] * (-327.128) (-322.540) [-322.102] (-322.936) -- 0:00:34
Average standard deviation of split frequencies: 0.017080
275500 -- (-321.949) [-323.711] (-321.817) (-323.714) * (-324.963) (-329.046) (-330.408) [-321.486] -- 0:00:34
276000 -- [-321.025] (-324.610) (-325.790) (-323.338) * (-323.982) (-324.298) [-322.669] (-321.586) -- 0:00:34
276500 -- (-321.054) (-323.181) [-322.182] (-324.713) * [-323.841] (-322.461) (-323.847) (-321.849) -- 0:00:34
277000 -- (-323.906) (-327.924) (-323.062) [-324.102] * (-321.024) (-321.200) (-322.277) [-322.606] -- 0:00:33
277500 -- (-327.335) (-322.919) (-323.185) [-323.739] * (-320.954) (-323.781) (-320.694) [-323.557] -- 0:00:33
278000 -- [-322.631] (-322.388) (-321.107) (-325.448) * (-325.059) (-321.318) (-324.617) [-323.221] -- 0:00:33
278500 -- (-322.004) (-324.654) (-323.811) [-325.652] * (-321.921) (-325.239) (-320.696) [-322.564] -- 0:00:33
279000 -- (-323.119) [-324.624] (-326.955) (-321.720) * (-322.750) [-321.546] (-321.816) (-324.323) -- 0:00:33
279500 -- [-322.931] (-322.669) (-322.153) (-321.817) * (-321.969) [-322.285] (-322.582) (-323.482) -- 0:00:33
280000 -- (-325.078) (-324.244) (-320.851) [-321.741] * [-323.188] (-323.067) (-323.189) (-321.963) -- 0:00:33
Average standard deviation of split frequencies: 0.013437
280500 -- [-322.564] (-321.401) (-322.288) (-321.629) * [-325.416] (-323.906) (-322.458) (-322.487) -- 0:00:33
281000 -- (-325.158) [-321.455] (-325.064) (-322.716) * (-327.718) [-323.066] (-325.348) (-322.556) -- 0:00:33
281500 -- (-322.742) (-324.993) (-325.307) [-320.952] * (-326.019) (-323.700) (-324.357) [-322.182] -- 0:00:33
282000 -- [-321.870] (-321.799) (-324.158) (-324.436) * [-322.753] (-321.833) (-322.443) (-324.200) -- 0:00:33
282500 -- (-323.131) [-322.350] (-327.081) (-321.069) * (-327.775) [-321.812] (-322.898) (-321.704) -- 0:00:33
283000 -- (-321.854) [-326.251] (-324.433) (-322.974) * (-328.168) (-320.782) (-322.567) [-321.195] -- 0:00:32
283500 -- [-322.195] (-327.074) (-322.840) (-323.784) * [-324.779] (-321.709) (-321.784) (-323.903) -- 0:00:32
284000 -- [-321.376] (-324.378) (-322.921) (-320.560) * (-320.588) (-321.652) (-324.530) [-322.563] -- 0:00:32
284500 -- (-321.899) (-325.555) (-323.761) [-321.801] * [-321.146] (-321.630) (-329.290) (-321.412) -- 0:00:32
285000 -- (-321.036) [-321.778] (-322.917) (-322.628) * (-321.010) (-321.946) [-326.615] (-321.204) -- 0:00:32
Average standard deviation of split frequencies: 0.012087
285500 -- (-323.163) [-321.753] (-323.044) (-325.223) * [-323.849] (-323.733) (-328.189) (-325.537) -- 0:00:32
286000 -- [-321.432] (-324.962) (-326.692) (-327.515) * (-324.117) [-320.728] (-324.093) (-324.377) -- 0:00:32
286500 -- [-320.637] (-322.212) (-323.881) (-322.783) * [-323.367] (-323.155) (-323.876) (-320.653) -- 0:00:32
287000 -- (-321.523) (-321.395) [-322.847] (-322.723) * [-322.193] (-324.213) (-322.118) (-322.929) -- 0:00:32
287500 -- (-322.416) [-322.910] (-323.854) (-321.323) * (-321.261) [-321.197] (-323.978) (-325.213) -- 0:00:32
288000 -- (-322.863) (-322.738) [-322.334] (-322.054) * (-324.432) (-320.918) [-325.758] (-322.269) -- 0:00:32
288500 -- (-322.486) (-326.298) [-322.432] (-321.451) * (-323.446) [-321.857] (-322.009) (-322.100) -- 0:00:32
289000 -- [-322.963] (-323.079) (-324.080) (-321.158) * (-322.855) (-322.434) (-325.437) [-320.464] -- 0:00:31
289500 -- (-324.246) (-321.613) [-321.897] (-324.249) * (-320.926) (-326.934) (-322.418) [-321.727] -- 0:00:31
290000 -- (-322.044) (-326.334) (-323.010) [-322.441] * (-322.254) (-322.835) [-321.917] (-324.950) -- 0:00:31
Average standard deviation of split frequencies: 0.010812
290500 -- [-324.489] (-325.527) (-322.257) (-321.430) * (-320.633) (-320.983) [-321.941] (-326.186) -- 0:00:31
291000 -- (-332.053) (-324.452) (-321.666) [-323.997] * (-321.488) (-324.637) [-322.530] (-325.806) -- 0:00:31
291500 -- [-324.317] (-325.760) (-322.783) (-328.303) * (-324.269) (-326.720) [-322.062] (-323.179) -- 0:00:31
292000 -- (-324.199) (-329.165) (-325.684) [-322.615] * (-323.835) (-323.084) (-321.017) [-322.421] -- 0:00:31
292500 -- (-324.798) (-323.549) [-323.869] (-325.883) * (-321.309) [-324.081] (-322.432) (-321.817) -- 0:00:33
293000 -- (-323.932) [-330.667] (-321.410) (-322.158) * [-322.886] (-324.011) (-321.931) (-324.820) -- 0:00:33
293500 -- [-320.906] (-321.245) (-321.324) (-325.604) * (-322.242) [-325.118] (-321.576) (-321.922) -- 0:00:33
294000 -- (-322.391) (-322.746) (-321.749) [-323.925] * [-320.570] (-324.247) (-322.493) (-325.525) -- 0:00:33
294500 -- [-321.394] (-321.766) (-323.720) (-324.489) * [-322.066] (-321.004) (-322.113) (-321.558) -- 0:00:33
295000 -- (-321.148) (-326.598) [-322.105] (-324.062) * (-322.198) (-320.598) [-324.699] (-323.182) -- 0:00:33
Average standard deviation of split frequencies: 0.007432
295500 -- (-323.760) (-324.219) (-325.996) [-322.615] * [-325.342] (-321.590) (-321.395) (-320.472) -- 0:00:33
296000 -- [-323.718] (-320.487) (-323.000) (-323.925) * (-322.691) [-321.250] (-322.484) (-322.247) -- 0:00:33
296500 -- [-322.463] (-324.292) (-323.705) (-325.142) * (-322.178) (-323.361) (-323.816) [-323.046] -- 0:00:33
297000 -- (-321.063) (-323.077) [-323.618] (-326.346) * (-327.753) [-323.150] (-323.355) (-323.451) -- 0:00:33
297500 -- (-324.351) (-321.809) [-328.599] (-321.672) * (-323.147) (-322.436) (-323.202) [-321.805] -- 0:00:33
298000 -- (-323.356) [-324.386] (-322.224) (-322.828) * (-326.841) [-322.731] (-321.095) (-322.882) -- 0:00:32
298500 -- (-325.858) (-323.152) [-325.840] (-323.086) * [-321.284] (-329.609) (-325.175) (-324.033) -- 0:00:32
299000 -- (-324.978) (-325.059) (-322.118) [-325.666] * (-322.968) (-323.793) [-323.207] (-323.237) -- 0:00:32
299500 -- [-323.902] (-322.658) (-325.103) (-322.841) * (-324.521) [-321.688] (-327.090) (-323.027) -- 0:00:32
300000 -- [-323.072] (-326.368) (-324.536) (-322.839) * (-320.589) (-324.362) [-323.293] (-324.931) -- 0:00:32
Average standard deviation of split frequencies: 0.012543
300500 -- (-323.081) [-321.259] (-326.849) (-329.992) * [-322.450] (-323.642) (-324.597) (-330.793) -- 0:00:32
301000 -- (-321.424) (-323.346) (-323.745) [-324.340] * (-321.100) [-322.084] (-326.253) (-321.393) -- 0:00:32
301500 -- (-321.863) (-324.245) [-321.391] (-321.983) * (-321.863) (-324.541) [-326.297] (-322.834) -- 0:00:32
302000 -- (-320.921) (-321.200) (-321.981) [-323.840] * (-322.294) (-327.997) (-321.732) [-322.455] -- 0:00:32
302500 -- (-325.660) (-321.306) [-322.107] (-321.237) * (-320.977) [-324.800] (-322.495) (-320.968) -- 0:00:32
303000 -- [-322.360] (-324.184) (-324.101) (-321.743) * (-325.606) (-324.589) (-323.126) [-321.068] -- 0:00:32
303500 -- (-322.951) [-322.357] (-321.101) (-327.176) * [-322.789] (-324.598) (-321.853) (-322.657) -- 0:00:32
304000 -- [-324.800] (-323.463) (-324.595) (-321.188) * (-324.094) (-321.279) [-325.608] (-322.999) -- 0:00:32
304500 -- (-321.575) (-321.747) (-325.585) [-323.671] * (-324.270) (-323.216) (-325.501) [-324.099] -- 0:00:31
305000 -- [-322.853] (-322.892) (-321.960) (-322.102) * (-322.804) (-327.509) [-322.003] (-322.876) -- 0:00:31
Average standard deviation of split frequencies: 0.012324
305500 -- (-326.846) (-325.027) [-321.212] (-322.148) * [-324.309] (-325.840) (-322.122) (-321.337) -- 0:00:31
306000 -- [-325.933] (-321.864) (-325.983) (-321.785) * (-325.251) (-324.241) [-322.421] (-321.356) -- 0:00:31
306500 -- [-322.694] (-323.826) (-321.975) (-321.053) * (-323.707) (-323.431) (-323.333) [-322.028] -- 0:00:31
307000 -- [-321.643] (-322.900) (-323.674) (-325.934) * (-322.065) (-329.954) [-321.273] (-324.290) -- 0:00:31
307500 -- (-326.849) (-321.118) (-322.781) [-322.356] * (-323.261) [-322.427] (-322.837) (-323.285) -- 0:00:31
308000 -- (-324.779) (-325.077) (-322.079) [-324.284] * (-323.711) (-321.549) [-326.940] (-323.418) -- 0:00:31
308500 -- (-321.259) (-320.910) (-321.154) [-325.470] * (-322.547) (-322.927) [-323.043] (-323.404) -- 0:00:31
309000 -- [-322.433] (-321.140) (-322.872) (-322.504) * (-322.973) [-321.514] (-322.525) (-320.937) -- 0:00:31
309500 -- (-323.523) (-322.502) [-322.158] (-323.118) * (-321.606) (-323.059) [-321.596] (-323.366) -- 0:00:31
310000 -- (-325.282) (-325.777) [-321.896] (-322.944) * [-321.074] (-324.358) (-322.282) (-323.165) -- 0:00:31
Average standard deviation of split frequencies: 0.014162
310500 -- [-321.882] (-324.212) (-324.605) (-322.739) * (-323.769) [-323.067] (-322.507) (-322.634) -- 0:00:31
311000 -- [-322.246] (-326.961) (-322.691) (-322.345) * (-324.917) (-323.239) (-321.802) [-324.639] -- 0:00:31
311500 -- (-323.923) [-324.930] (-321.480) (-322.832) * (-325.747) (-321.253) (-324.757) [-325.369] -- 0:00:30
312000 -- (-321.984) [-323.959] (-322.505) (-322.493) * (-326.022) (-323.220) (-324.381) [-324.555] -- 0:00:30
312500 -- (-323.077) (-323.626) [-324.424] (-323.043) * [-323.611] (-321.131) (-324.611) (-321.461) -- 0:00:30
313000 -- [-322.765] (-323.113) (-323.139) (-325.745) * [-320.737] (-325.778) (-324.867) (-321.285) -- 0:00:30
313500 -- (-321.252) (-321.222) (-322.011) [-323.864] * (-323.519) (-323.352) (-325.173) [-322.533] -- 0:00:30
314000 -- [-321.152] (-322.869) (-321.029) (-324.040) * (-324.688) (-325.832) (-322.003) [-321.839] -- 0:00:30
314500 -- [-321.138] (-323.532) (-321.708) (-323.891) * (-325.946) (-323.155) (-321.270) [-322.763] -- 0:00:30
315000 -- [-321.328] (-322.533) (-323.830) (-324.728) * (-323.105) (-320.611) [-324.480] (-325.942) -- 0:00:30
Average standard deviation of split frequencies: 0.012929
315500 -- [-320.775] (-321.236) (-320.873) (-323.301) * (-322.287) (-324.779) (-323.796) [-322.937] -- 0:00:32
316000 -- [-321.704] (-324.534) (-325.056) (-321.777) * [-324.424] (-322.764) (-320.823) (-322.755) -- 0:00:32
316500 -- (-323.096) [-325.408] (-327.395) (-323.588) * (-325.346) [-322.921] (-322.020) (-327.842) -- 0:00:32
317000 -- (-324.820) (-322.574) [-321.364] (-322.750) * (-320.483) [-320.861] (-322.350) (-327.950) -- 0:00:32
317500 -- (-324.021) (-324.354) [-320.828] (-323.533) * (-323.820) [-322.365] (-323.175) (-323.780) -- 0:00:32
318000 -- (-322.028) [-325.219] (-321.809) (-321.535) * (-324.660) (-325.944) (-324.200) [-325.034] -- 0:00:32
318500 -- (-321.316) (-323.205) [-321.708] (-323.076) * (-324.147) [-321.560] (-323.204) (-320.739) -- 0:00:32
319000 -- (-326.336) (-322.771) [-323.031] (-324.070) * (-324.934) (-323.115) (-322.772) [-322.645] -- 0:00:32
319500 -- (-322.695) (-323.330) [-322.179] (-321.314) * (-322.662) (-321.466) [-324.572] (-322.118) -- 0:00:31
320000 -- [-322.480] (-325.472) (-325.656) (-321.607) * [-322.558] (-322.085) (-321.940) (-324.446) -- 0:00:31
Average standard deviation of split frequencies: 0.014701
320500 -- (-323.387) [-324.608] (-321.621) (-322.421) * (-323.496) [-324.117] (-323.314) (-322.747) -- 0:00:31
321000 -- (-323.718) [-322.128] (-321.059) (-323.698) * [-320.629] (-322.908) (-321.955) (-324.431) -- 0:00:31
321500 -- (-321.332) (-321.035) (-322.538) [-327.119] * (-321.007) (-325.948) [-322.825] (-324.667) -- 0:00:31
322000 -- (-323.141) (-323.232) (-322.805) [-322.947] * (-322.083) (-321.498) (-321.605) [-321.358] -- 0:00:31
322500 -- (-324.877) [-322.426] (-323.802) (-321.714) * (-325.721) [-323.631] (-322.682) (-323.285) -- 0:00:31
323000 -- (-326.078) (-321.984) (-323.565) [-321.153] * (-323.924) (-321.960) [-321.369] (-322.453) -- 0:00:31
323500 -- (-323.204) (-323.223) (-327.891) [-322.829] * [-321.760] (-324.051) (-324.243) (-324.963) -- 0:00:31
324000 -- [-321.842] (-322.097) (-328.248) (-321.084) * [-324.012] (-321.124) (-322.620) (-322.983) -- 0:00:31
324500 -- (-323.456) (-321.402) (-322.989) [-321.102] * (-322.421) (-322.979) [-326.748] (-322.012) -- 0:00:31
325000 -- [-322.197] (-327.211) (-321.071) (-324.403) * (-321.505) [-321.951] (-321.948) (-325.589) -- 0:00:31
Average standard deviation of split frequencies: 0.015424
325500 -- (-325.542) (-322.677) (-322.112) [-324.866] * (-329.523) [-325.132] (-324.209) (-325.356) -- 0:00:31
326000 -- [-321.135] (-325.291) (-321.345) (-322.451) * (-322.493) (-320.455) [-327.682] (-323.233) -- 0:00:31
326500 -- (-322.143) (-323.891) [-321.903] (-322.318) * (-325.221) (-320.918) (-322.018) [-323.786] -- 0:00:30
327000 -- (-321.797) [-322.046] (-322.453) (-323.511) * (-322.301) (-320.680) [-322.172] (-323.188) -- 0:00:30
327500 -- (-323.775) [-321.241] (-321.730) (-326.481) * (-324.371) (-325.383) (-323.000) [-323.293] -- 0:00:30
328000 -- [-322.426] (-322.564) (-321.597) (-322.977) * (-324.428) (-324.128) (-322.722) [-322.217] -- 0:00:30
328500 -- (-323.037) (-323.440) [-322.186] (-322.423) * [-322.328] (-322.617) (-321.160) (-322.114) -- 0:00:30
329000 -- (-320.875) (-324.623) [-323.730] (-325.817) * (-323.155) [-321.527] (-326.823) (-321.357) -- 0:00:30
329500 -- (-322.560) (-321.567) [-321.390] (-322.378) * (-321.133) [-322.223] (-321.118) (-321.789) -- 0:00:30
330000 -- (-324.318) [-327.221] (-322.194) (-321.556) * [-323.021] (-322.324) (-321.252) (-322.740) -- 0:00:30
Average standard deviation of split frequencies: 0.018058
330500 -- (-322.624) (-322.803) [-323.418] (-321.928) * (-322.484) (-328.375) [-323.017] (-324.284) -- 0:00:30
331000 -- [-323.215] (-321.244) (-322.371) (-324.392) * (-322.713) (-320.982) (-328.426) [-320.823] -- 0:00:30
331500 -- (-321.834) [-320.405] (-323.015) (-324.853) * (-326.570) (-325.952) [-322.937] (-322.435) -- 0:00:30
332000 -- (-324.608) [-321.814] (-324.574) (-323.651) * (-323.166) [-321.368] (-322.490) (-323.060) -- 0:00:30
332500 -- (-321.047) (-325.858) [-321.601] (-320.753) * (-324.386) (-323.357) (-322.918) [-327.778] -- 0:00:30
333000 -- (-320.962) (-325.814) (-322.796) [-323.554] * [-321.223] (-325.902) (-326.923) (-328.027) -- 0:00:30
333500 -- (-322.687) (-323.221) (-326.466) [-326.123] * (-321.293) (-322.836) (-327.118) [-326.390] -- 0:00:29
334000 -- (-321.478) (-321.640) [-322.490] (-320.968) * (-322.385) (-321.841) (-327.561) [-321.371] -- 0:00:29
334500 -- (-321.312) [-324.023] (-323.412) (-322.160) * (-323.971) (-322.143) (-321.725) [-322.168] -- 0:00:29
335000 -- (-325.481) (-322.469) (-321.859) [-321.433] * (-322.234) [-322.294] (-324.289) (-322.240) -- 0:00:29
Average standard deviation of split frequencies: 0.017771
335500 -- (-326.524) [-322.287] (-325.251) (-321.605) * [-323.336] (-329.164) (-322.844) (-322.473) -- 0:00:29
336000 -- [-325.733] (-325.313) (-321.080) (-323.094) * [-321.805] (-321.266) (-321.522) (-326.296) -- 0:00:29
336500 -- (-324.419) [-321.415] (-322.007) (-321.712) * (-325.496) (-322.226) [-322.954] (-324.516) -- 0:00:29
337000 -- (-325.640) (-322.615) [-321.699] (-321.452) * (-322.925) (-322.528) [-320.564] (-321.283) -- 0:00:29
337500 -- (-325.225) [-322.622] (-324.863) (-323.152) * [-323.194] (-323.967) (-324.073) (-320.713) -- 0:00:29
338000 -- [-324.706] (-328.163) (-322.356) (-322.210) * [-321.297] (-324.972) (-323.112) (-321.148) -- 0:00:31
338500 -- [-321.721] (-326.666) (-322.264) (-322.597) * [-325.696] (-325.033) (-323.033) (-321.839) -- 0:00:31
339000 -- [-321.783] (-325.464) (-324.477) (-324.583) * [-324.188] (-321.179) (-326.332) (-321.937) -- 0:00:31
339500 -- (-322.341) (-327.239) [-322.938] (-323.707) * (-321.995) (-322.073) (-323.421) [-327.719] -- 0:00:31
340000 -- (-323.493) (-323.590) [-322.743] (-324.553) * (-320.897) (-321.761) (-325.886) [-324.499] -- 0:00:31
Average standard deviation of split frequencies: 0.016605
340500 -- [-323.568] (-326.322) (-323.228) (-323.620) * (-322.617) [-322.790] (-323.871) (-323.096) -- 0:00:30
341000 -- (-321.863) (-321.887) (-321.441) [-322.204] * (-326.258) (-323.344) [-325.081] (-323.615) -- 0:00:30
341500 -- (-320.695) (-322.692) [-323.030] (-325.487) * (-321.650) (-322.242) (-325.901) [-323.307] -- 0:00:30
342000 -- (-321.127) (-326.276) (-323.203) [-324.104] * [-320.826] (-323.041) (-324.521) (-325.262) -- 0:00:30
342500 -- [-321.932] (-325.892) (-322.302) (-322.758) * [-323.720] (-321.550) (-325.485) (-324.418) -- 0:00:30
343000 -- (-323.635) (-321.181) (-322.504) [-328.189] * (-324.238) (-321.578) [-320.982] (-323.238) -- 0:00:30
343500 -- [-321.705] (-323.985) (-321.575) (-325.037) * (-320.820) (-321.363) [-320.787] (-322.834) -- 0:00:30
344000 -- (-325.413) (-327.104) (-324.765) [-323.923] * (-321.940) (-323.170) (-325.500) [-326.730] -- 0:00:30
344500 -- (-323.235) (-324.236) (-321.970) [-321.318] * (-322.163) (-323.670) (-321.789) [-322.958] -- 0:00:30
345000 -- (-323.321) (-323.430) (-321.303) [-322.081] * (-322.280) [-321.736] (-324.161) (-323.058) -- 0:00:30
Average standard deviation of split frequencies: 0.015441
345500 -- (-321.039) [-322.188] (-321.806) (-321.466) * (-321.375) (-321.990) (-322.864) [-324.371] -- 0:00:30
346000 -- (-320.508) (-322.348) (-325.868) [-324.269] * [-322.500] (-322.426) (-322.062) (-322.605) -- 0:00:30
346500 -- [-320.426] (-322.225) (-320.874) (-323.792) * [-325.516] (-322.405) (-323.505) (-323.460) -- 0:00:30
347000 -- [-321.562] (-322.801) (-321.412) (-323.935) * (-325.942) (-320.991) (-322.924) [-321.891] -- 0:00:30
347500 -- (-320.672) [-322.578] (-321.085) (-321.015) * [-322.125] (-323.067) (-325.040) (-323.354) -- 0:00:30
348000 -- (-322.220) (-326.018) [-321.899] (-320.931) * (-320.808) (-323.969) (-321.240) [-321.092] -- 0:00:29
348500 -- (-322.916) [-321.479] (-325.192) (-325.357) * (-323.556) (-321.733) (-323.131) [-323.304] -- 0:00:29
349000 -- [-322.196] (-322.204) (-324.089) (-321.628) * (-322.776) (-320.721) (-321.300) [-321.969] -- 0:00:29
349500 -- (-321.146) [-320.971] (-321.382) (-321.862) * (-323.751) (-322.813) (-321.042) [-320.715] -- 0:00:29
350000 -- (-320.853) (-324.151) (-324.913) [-323.551] * [-327.342] (-327.497) (-326.045) (-320.580) -- 0:00:29
Average standard deviation of split frequencies: 0.016132
350500 -- (-325.794) [-322.033] (-323.059) (-322.554) * (-326.868) (-328.817) (-321.350) [-322.368] -- 0:00:29
351000 -- [-321.750] (-320.967) (-325.838) (-321.751) * [-322.321] (-322.128) (-325.531) (-324.600) -- 0:00:29
351500 -- [-322.689] (-321.835) (-328.912) (-321.221) * (-324.483) (-323.759) (-324.039) [-322.224] -- 0:00:29
352000 -- (-323.866) (-321.760) (-323.342) [-323.794] * (-320.900) [-321.791] (-321.476) (-322.917) -- 0:00:29
352500 -- (-321.008) [-324.333] (-324.356) (-322.309) * [-323.174] (-321.395) (-324.268) (-325.383) -- 0:00:29
353000 -- [-321.619] (-322.219) (-326.448) (-322.846) * [-321.612] (-323.686) (-323.981) (-323.414) -- 0:00:29
353500 -- (-327.129) [-320.914] (-328.631) (-321.739) * (-323.461) (-324.138) [-321.621] (-326.137) -- 0:00:29
354000 -- (-326.649) [-323.591] (-322.250) (-322.927) * (-321.064) (-322.628) (-325.267) [-321.835] -- 0:00:29
354500 -- (-321.462) (-322.765) [-322.877] (-322.693) * (-323.563) (-322.193) [-324.389] (-323.268) -- 0:00:29
355000 -- (-320.906) (-324.504) (-326.800) [-321.363] * (-322.682) (-321.096) [-322.591] (-321.222) -- 0:00:29
Average standard deviation of split frequencies: 0.016773
355500 -- (-326.299) (-323.998) (-324.204) [-321.855] * [-321.638] (-322.198) (-321.602) (-324.941) -- 0:00:29
356000 -- (-324.548) (-324.850) [-323.875] (-323.343) * (-322.697) (-328.492) [-323.197] (-322.317) -- 0:00:28
356500 -- (-321.041) (-324.291) [-324.775] (-325.030) * [-322.125] (-326.116) (-321.494) (-323.846) -- 0:00:28
357000 -- [-321.801] (-321.111) (-323.640) (-323.524) * (-321.750) (-323.925) [-322.068] (-326.042) -- 0:00:28
357500 -- [-322.808] (-320.905) (-324.236) (-322.152) * (-326.623) (-321.222) [-321.937] (-322.892) -- 0:00:28
358000 -- [-322.875] (-321.667) (-324.551) (-322.017) * (-322.915) [-322.513] (-321.469) (-322.182) -- 0:00:28
358500 -- [-324.459] (-325.059) (-320.940) (-324.258) * (-321.278) (-324.412) (-321.421) [-324.120] -- 0:00:28
359000 -- [-322.097] (-322.707) (-322.561) (-322.801) * (-322.393) (-325.119) (-321.954) [-322.619] -- 0:00:28
359500 -- (-320.998) (-321.825) [-322.577] (-321.221) * (-320.935) (-331.776) [-323.288] (-322.028) -- 0:00:28
360000 -- [-320.824] (-324.876) (-323.454) (-323.731) * (-322.082) [-324.668] (-322.934) (-323.304) -- 0:00:28
Average standard deviation of split frequencies: 0.016556
360500 -- (-328.498) (-320.556) (-321.214) [-325.334] * (-321.277) [-326.332] (-321.016) (-324.519) -- 0:00:28
361000 -- (-323.917) (-336.661) (-323.348) [-321.602] * [-322.948] (-321.889) (-321.266) (-321.181) -- 0:00:30
361500 -- [-325.284] (-332.470) (-322.592) (-322.264) * (-323.178) [-322.661] (-327.005) (-323.204) -- 0:00:30
362000 -- (-322.544) (-325.222) [-324.351] (-322.739) * [-322.468] (-321.245) (-323.587) (-324.234) -- 0:00:29
362500 -- [-320.672] (-320.827) (-322.359) (-322.203) * (-322.538) [-322.440] (-322.809) (-323.175) -- 0:00:29
363000 -- (-322.168) [-323.344] (-321.582) (-324.310) * (-321.232) (-321.222) (-321.423) [-325.904] -- 0:00:29
363500 -- [-325.295] (-321.908) (-323.974) (-325.518) * (-323.346) (-322.895) (-322.134) [-322.715] -- 0:00:29
364000 -- (-322.084) (-323.853) (-323.818) [-321.482] * (-324.834) (-321.983) [-322.037] (-328.963) -- 0:00:29
364500 -- (-322.587) (-322.199) [-321.778] (-323.757) * (-325.101) [-322.233] (-321.015) (-322.352) -- 0:00:29
365000 -- (-324.837) (-324.974) (-323.174) [-321.535] * (-322.555) (-322.418) [-323.073] (-321.422) -- 0:00:29
Average standard deviation of split frequencies: 0.017173
365500 -- (-324.311) [-324.657] (-322.970) (-324.349) * (-324.228) (-322.157) [-321.518] (-325.747) -- 0:00:29
366000 -- (-323.289) [-322.038] (-324.028) (-325.650) * (-321.025) (-325.767) [-321.783] (-323.629) -- 0:00:29
366500 -- (-323.095) [-322.746] (-322.709) (-321.218) * (-324.694) [-324.879] (-322.415) (-322.427) -- 0:00:29
367000 -- (-324.710) (-322.793) (-321.773) [-325.696] * (-326.438) (-322.045) [-322.857] (-321.853) -- 0:00:29
367500 -- (-324.283) [-326.770] (-321.087) (-322.471) * [-323.928] (-323.557) (-321.402) (-325.352) -- 0:00:29
368000 -- (-323.283) [-323.506] (-326.270) (-321.492) * (-321.647) (-323.513) [-324.285] (-327.587) -- 0:00:29
368500 -- (-325.023) [-321.556] (-322.272) (-322.910) * (-330.543) (-323.736) [-322.655] (-323.659) -- 0:00:29
369000 -- [-322.463] (-321.637) (-321.402) (-322.049) * [-323.879] (-324.065) (-326.776) (-323.329) -- 0:00:29
369500 -- [-322.625] (-322.367) (-323.806) (-321.085) * (-321.311) (-328.620) (-323.919) [-321.633] -- 0:00:29
370000 -- (-324.755) (-322.743) (-321.493) [-321.079] * (-324.894) [-324.745] (-323.708) (-321.832) -- 0:00:28
Average standard deviation of split frequencies: 0.015261
370500 -- (-326.148) (-323.815) [-321.251] (-328.172) * (-323.837) [-324.277] (-323.038) (-321.465) -- 0:00:28
371000 -- [-320.512] (-324.062) (-322.391) (-329.757) * (-324.294) (-323.556) (-328.653) [-322.409] -- 0:00:28
371500 -- (-323.509) (-323.225) [-323.853] (-323.297) * [-323.190] (-328.918) (-321.410) (-321.867) -- 0:00:28
372000 -- [-322.618] (-325.792) (-323.805) (-323.890) * (-324.153) (-322.387) [-321.079] (-323.318) -- 0:00:28
372500 -- (-321.759) (-326.802) [-323.228] (-327.887) * [-322.550] (-322.322) (-321.830) (-324.081) -- 0:00:28
373000 -- (-321.579) (-321.122) (-322.631) [-322.335] * (-323.168) (-322.508) [-325.981] (-327.567) -- 0:00:28
373500 -- (-322.140) (-322.851) (-323.048) [-320.770] * (-320.954) [-322.038] (-321.254) (-324.568) -- 0:00:28
374000 -- [-321.866] (-326.873) (-324.201) (-321.407) * (-321.341) [-323.984] (-322.588) (-322.878) -- 0:00:28
374500 -- (-326.264) [-324.209] (-322.643) (-325.233) * (-328.094) (-331.038) [-324.014] (-322.393) -- 0:00:28
375000 -- (-324.683) [-322.191] (-325.861) (-323.121) * (-323.162) (-323.389) (-321.858) [-321.624] -- 0:00:28
Average standard deviation of split frequencies: 0.014209
375500 -- (-323.576) [-321.648] (-329.512) (-323.152) * [-322.318] (-323.104) (-325.829) (-323.385) -- 0:00:28
376000 -- (-325.330) [-321.283] (-328.610) (-324.114) * (-323.279) (-322.022) (-324.182) [-322.607] -- 0:00:28
376500 -- (-321.660) [-321.187] (-327.665) (-323.942) * [-320.730] (-320.695) (-325.070) (-320.767) -- 0:00:28
377000 -- (-322.290) (-322.820) [-321.019] (-326.734) * (-322.386) (-323.583) (-326.823) [-323.619] -- 0:00:28
377500 -- [-327.143] (-322.182) (-322.438) (-325.400) * (-325.320) (-324.692) [-323.801] (-321.069) -- 0:00:28
378000 -- (-325.108) (-323.930) (-323.089) [-322.442] * (-324.444) [-322.382] (-323.745) (-323.064) -- 0:00:27
378500 -- (-324.310) (-321.213) [-321.592] (-320.673) * [-322.072] (-324.901) (-320.964) (-322.121) -- 0:00:27
379000 -- (-321.690) (-323.090) (-323.449) [-323.133] * [-321.853] (-323.421) (-320.849) (-322.581) -- 0:00:27
379500 -- (-323.433) (-322.141) (-322.946) [-323.080] * (-325.639) (-324.105) [-321.219] (-326.773) -- 0:00:27
380000 -- (-323.601) (-321.532) (-321.765) [-321.220] * [-321.474] (-327.580) (-321.710) (-326.046) -- 0:00:27
Average standard deviation of split frequencies: 0.016512
380500 -- (-321.377) [-322.999] (-322.198) (-324.343) * (-322.495) (-323.766) [-321.582] (-324.090) -- 0:00:27
381000 -- (-323.508) (-324.041) (-322.428) [-322.585] * (-322.294) (-323.482) (-324.158) [-322.186] -- 0:00:27
381500 -- (-321.311) [-320.827] (-320.769) (-322.418) * (-322.487) (-325.457) (-320.890) [-325.082] -- 0:00:27
382000 -- (-324.567) [-324.358] (-323.010) (-326.373) * (-322.945) (-324.052) (-321.249) [-320.872] -- 0:00:27
382500 -- (-321.672) [-321.874] (-323.966) (-321.927) * (-322.953) [-321.948] (-323.210) (-326.149) -- 0:00:27
383000 -- [-323.563] (-327.175) (-321.004) (-322.436) * (-326.572) [-322.880] (-323.678) (-321.042) -- 0:00:27
383500 -- (-325.633) (-325.430) (-320.722) [-322.130] * (-324.332) (-324.236) (-322.132) [-325.182] -- 0:00:27
384000 -- (-325.090) [-322.770] (-321.909) (-322.586) * (-329.855) (-321.972) [-321.860] (-321.480) -- 0:00:28
384500 -- (-323.564) [-320.943] (-322.954) (-324.210) * (-323.598) (-321.447) [-323.763] (-329.226) -- 0:00:28
385000 -- (-321.076) [-321.698] (-324.892) (-321.138) * (-322.805) (-322.056) (-323.199) [-322.462] -- 0:00:28
Average standard deviation of split frequencies: 0.015469
385500 -- (-323.498) (-322.401) [-320.942] (-321.326) * [-322.115] (-322.659) (-325.288) (-324.099) -- 0:00:28
386000 -- (-320.951) (-327.134) (-322.435) [-321.069] * [-323.025] (-326.151) (-323.149) (-321.548) -- 0:00:28
386500 -- (-323.621) (-325.258) (-323.588) [-320.706] * (-322.099) (-326.535) [-325.314] (-322.742) -- 0:00:28
387000 -- (-325.413) (-324.126) [-321.671] (-324.912) * (-322.034) (-324.719) [-323.489] (-324.234) -- 0:00:28
387500 -- [-322.692] (-323.398) (-322.633) (-322.789) * (-321.036) (-320.539) (-322.386) [-323.153] -- 0:00:28
388000 -- (-322.642) (-323.558) [-322.401] (-323.032) * (-322.980) (-323.677) (-321.241) [-325.523] -- 0:00:28
388500 -- [-321.618] (-322.940) (-322.562) (-320.765) * (-324.207) (-322.899) (-322.063) [-323.046] -- 0:00:28
389000 -- [-324.542] (-324.086) (-324.095) (-323.148) * (-320.855) (-325.311) (-321.509) [-322.127] -- 0:00:28
389500 -- (-322.617) (-324.442) [-323.641] (-321.550) * (-324.799) (-322.342) (-323.235) [-327.674] -- 0:00:28
390000 -- (-324.983) (-322.657) [-321.317] (-322.763) * (-325.067) (-321.350) (-328.381) [-321.524] -- 0:00:28
Average standard deviation of split frequencies: 0.014480
390500 -- (-322.558) (-323.459) [-322.608] (-322.147) * (-320.994) [-322.621] (-324.866) (-327.931) -- 0:00:28
391000 -- [-324.025] (-325.843) (-325.070) (-324.186) * [-322.525] (-323.805) (-322.543) (-322.265) -- 0:00:28
391500 -- (-321.160) [-320.874] (-324.238) (-324.250) * (-321.587) (-325.326) [-323.154] (-322.859) -- 0:00:27
392000 -- (-323.859) (-322.834) [-323.569] (-321.918) * (-322.021) [-322.168] (-321.621) (-321.210) -- 0:00:27
392500 -- (-323.419) (-322.244) [-321.054] (-323.759) * (-324.423) (-323.302) [-324.892] (-323.686) -- 0:00:27
393000 -- [-321.795] (-322.345) (-325.246) (-323.392) * (-323.778) (-328.442) (-324.248) [-324.354] -- 0:00:27
393500 -- (-322.616) (-321.073) [-322.765] (-325.184) * (-325.817) (-323.075) [-323.558] (-323.924) -- 0:00:27
394000 -- (-322.180) (-323.629) [-321.734] (-322.053) * (-326.468) (-322.611) [-320.840] (-321.821) -- 0:00:27
394500 -- (-323.868) [-325.724] (-324.951) (-322.259) * [-322.983] (-322.885) (-322.814) (-321.013) -- 0:00:27
395000 -- [-324.136] (-327.815) (-326.020) (-322.443) * [-323.680] (-323.949) (-322.726) (-323.135) -- 0:00:27
Average standard deviation of split frequencies: 0.011904
395500 -- (-329.186) (-322.598) (-322.404) [-323.654] * (-322.335) (-321.800) (-324.163) [-323.395] -- 0:00:27
396000 -- (-323.829) [-321.272] (-324.142) (-320.758) * (-322.284) [-323.150] (-325.833) (-321.884) -- 0:00:27
396500 -- [-323.070] (-322.530) (-321.124) (-321.924) * (-321.673) (-326.078) [-322.684] (-322.676) -- 0:00:27
397000 -- (-322.844) [-322.929] (-321.501) (-325.348) * (-326.244) (-322.756) (-322.277) [-322.729] -- 0:00:27
397500 -- (-322.473) (-324.014) (-322.068) [-322.617] * [-322.715] (-324.284) (-324.198) (-323.345) -- 0:00:27
398000 -- (-325.472) (-323.649) [-321.485] (-324.630) * (-322.661) (-327.091) (-322.787) [-322.459] -- 0:00:27
398500 -- (-322.851) (-328.258) (-322.182) [-322.926] * (-323.667) (-323.647) (-323.029) [-323.556] -- 0:00:27
399000 -- (-324.510) (-329.899) (-324.388) [-322.515] * (-324.435) (-323.933) [-324.364] (-321.699) -- 0:00:27
399500 -- (-324.374) (-329.170) (-322.332) [-321.598] * (-323.849) [-323.592] (-328.353) (-320.970) -- 0:00:27
400000 -- (-325.672) (-324.222) [-326.297] (-324.951) * (-322.289) (-323.711) (-321.502) [-321.508] -- 0:00:27
Average standard deviation of split frequencies: 0.011766
400500 -- (-324.232) [-321.462] (-323.846) (-323.135) * (-322.468) [-322.500] (-324.998) (-321.623) -- 0:00:26
401000 -- (-327.557) (-324.004) [-321.799] (-321.088) * (-323.305) (-322.197) [-330.527] (-321.686) -- 0:00:26
401500 -- [-322.860] (-324.065) (-321.170) (-323.125) * (-324.038) (-325.347) (-330.795) [-322.654] -- 0:00:26
402000 -- (-323.021) (-322.931) [-323.048] (-324.467) * (-321.121) (-323.550) [-324.495] (-324.136) -- 0:00:26
402500 -- (-321.299) (-322.931) (-322.401) [-321.585] * [-321.198] (-323.862) (-320.547) (-328.488) -- 0:00:26
403000 -- (-322.577) (-322.018) (-322.380) [-321.620] * [-326.063] (-322.575) (-322.053) (-327.766) -- 0:00:26
403500 -- (-323.448) (-321.557) [-324.638] (-326.552) * (-322.524) (-324.634) [-322.601] (-323.791) -- 0:00:26
404000 -- (-324.655) [-321.346] (-326.109) (-323.335) * (-323.066) [-324.087] (-329.605) (-321.826) -- 0:00:26
404500 -- (-327.476) [-322.298] (-328.772) (-321.839) * [-323.066] (-321.803) (-321.932) (-321.745) -- 0:00:26
405000 -- (-324.118) [-328.340] (-326.170) (-320.877) * (-322.664) (-321.690) [-321.087] (-323.400) -- 0:00:26
Average standard deviation of split frequencies: 0.011611
405500 -- [-323.539] (-320.688) (-323.913) (-323.440) * [-322.670] (-325.411) (-321.757) (-323.500) -- 0:00:26
406000 -- (-321.720) [-321.943] (-326.631) (-321.868) * (-323.004) (-321.471) [-321.737] (-321.806) -- 0:00:27
406500 -- (-322.602) (-323.049) (-323.903) [-321.348] * [-328.751] (-322.575) (-322.268) (-322.292) -- 0:00:27
407000 -- (-320.770) (-324.082) (-329.468) [-321.022] * [-323.430] (-325.845) (-323.462) (-322.971) -- 0:00:27
407500 -- (-321.565) [-324.477] (-321.923) (-326.531) * (-323.762) (-328.296) [-323.457] (-323.820) -- 0:00:27
408000 -- (-320.506) (-322.771) (-320.814) [-323.328] * (-330.006) (-322.483) [-322.645] (-321.108) -- 0:00:27
408500 -- [-322.107] (-327.061) (-325.806) (-322.320) * (-324.252) [-320.658] (-320.480) (-321.145) -- 0:00:27
409000 -- (-322.241) (-323.742) (-325.748) [-327.759] * (-323.377) [-324.904] (-321.082) (-322.773) -- 0:00:27
409500 -- (-321.890) (-324.939) [-326.376] (-321.230) * (-321.787) (-321.640) [-323.387] (-323.948) -- 0:00:27
410000 -- (-325.204) (-323.975) [-325.478] (-328.536) * (-325.508) (-323.541) (-322.410) [-322.945] -- 0:00:27
Average standard deviation of split frequencies: 0.011479
410500 -- [-324.349] (-330.623) (-328.306) (-326.345) * (-321.061) [-322.840] (-322.591) (-323.550) -- 0:00:27
411000 -- (-322.640) [-327.008] (-329.822) (-324.073) * [-322.958] (-323.205) (-322.123) (-321.171) -- 0:00:27
411500 -- (-324.200) (-321.792) (-324.171) [-320.953] * [-322.515] (-325.914) (-321.488) (-323.333) -- 0:00:27
412000 -- [-323.950] (-324.218) (-322.251) (-327.452) * (-323.507) [-324.723] (-323.333) (-321.741) -- 0:00:27
412500 -- (-329.421) (-321.578) [-322.846] (-325.674) * (-326.842) [-322.336] (-324.687) (-322.788) -- 0:00:27
413000 -- (-323.013) (-322.314) [-321.230] (-321.597) * (-322.775) [-321.673] (-326.485) (-327.380) -- 0:00:27
413500 -- (-328.683) (-324.446) (-321.758) [-322.703] * [-320.552] (-323.388) (-323.849) (-321.734) -- 0:00:26
414000 -- [-325.341] (-321.183) (-321.400) (-322.139) * (-321.317) (-323.087) [-323.577] (-321.939) -- 0:00:26
414500 -- (-325.152) [-321.086] (-322.041) (-328.353) * (-322.952) (-322.084) [-323.436] (-322.373) -- 0:00:26
415000 -- [-325.237] (-323.800) (-324.090) (-324.424) * (-325.140) (-327.187) (-321.839) [-322.333] -- 0:00:26
Average standard deviation of split frequencies: 0.009065
415500 -- [-323.716] (-322.859) (-324.165) (-326.257) * (-322.897) (-323.231) (-321.777) [-323.208] -- 0:00:26
416000 -- (-322.037) (-331.882) [-324.364] (-322.528) * [-324.720] (-321.874) (-325.150) (-323.344) -- 0:00:26
416500 -- (-322.048) [-323.263] (-323.275) (-323.416) * (-323.484) (-321.247) (-324.408) [-321.126] -- 0:00:26
417000 -- (-321.913) (-325.764) (-325.997) [-322.795] * (-325.163) [-321.571] (-321.634) (-322.420) -- 0:00:26
417500 -- (-324.538) [-322.982] (-323.945) (-323.207) * [-322.290] (-321.365) (-322.619) (-320.728) -- 0:00:26
418000 -- [-321.499] (-322.720) (-322.679) (-321.808) * [-322.983] (-326.218) (-321.340) (-322.047) -- 0:00:26
418500 -- (-325.110) [-323.522] (-322.385) (-325.663) * (-322.859) [-322.277] (-322.352) (-323.551) -- 0:00:26
419000 -- (-327.165) [-326.905] (-322.551) (-321.208) * (-322.887) (-322.696) [-322.572] (-326.384) -- 0:00:26
419500 -- (-328.085) (-320.686) (-322.946) [-321.647] * (-327.032) (-326.419) [-321.913] (-322.050) -- 0:00:26
420000 -- [-323.751] (-322.022) (-325.922) (-329.995) * (-320.941) [-322.631] (-322.125) (-321.384) -- 0:00:26
Average standard deviation of split frequencies: 0.007471
420500 -- (-322.057) (-321.109) [-327.445] (-323.778) * (-321.252) (-321.516) [-322.487] (-325.690) -- 0:00:26
421000 -- (-322.733) [-321.109] (-320.888) (-325.186) * (-324.420) [-324.190] (-320.768) (-321.303) -- 0:00:26
421500 -- (-321.723) (-322.000) (-322.351) [-321.068] * (-323.851) [-324.438] (-321.780) (-324.387) -- 0:00:26
422000 -- [-321.180] (-322.470) (-320.982) (-321.942) * (-322.973) (-325.511) [-321.706] (-322.121) -- 0:00:26
422500 -- [-322.017] (-322.891) (-323.912) (-322.018) * (-321.322) [-322.213] (-322.067) (-322.846) -- 0:00:25
423000 -- [-324.376] (-324.042) (-323.200) (-321.837) * [-323.781] (-324.404) (-321.456) (-322.986) -- 0:00:25
423500 -- [-321.917] (-322.352) (-325.057) (-323.863) * (-322.034) (-327.776) [-321.541] (-321.220) -- 0:00:25
424000 -- (-321.395) [-321.390] (-322.791) (-326.405) * (-324.086) (-324.379) [-321.843] (-323.467) -- 0:00:25
424500 -- (-322.091) [-322.759] (-321.584) (-325.092) * (-324.744) (-321.744) (-322.700) [-322.603] -- 0:00:25
425000 -- (-324.278) (-321.470) (-326.311) [-321.715] * (-322.548) (-321.198) [-321.370] (-320.787) -- 0:00:25
Average standard deviation of split frequencies: 0.011804
425500 -- (-322.453) (-322.877) [-321.924] (-324.188) * (-321.264) [-326.230] (-321.294) (-323.171) -- 0:00:25
426000 -- (-322.940) (-322.850) (-322.097) [-324.757] * (-322.952) (-329.805) (-321.866) [-321.291] -- 0:00:25
426500 -- (-324.011) (-321.591) [-321.690] (-321.979) * (-325.521) [-320.524] (-321.501) (-322.741) -- 0:00:25
427000 -- (-322.333) (-323.652) (-321.048) [-321.709] * [-323.564] (-321.099) (-324.474) (-327.490) -- 0:00:25
427500 -- (-320.831) (-322.567) [-321.100] (-325.082) * [-320.959] (-320.691) (-323.123) (-323.218) -- 0:00:25
428000 -- (-323.131) (-323.864) [-327.479] (-323.671) * (-323.616) [-322.419] (-323.612) (-322.963) -- 0:00:25
428500 -- (-321.747) [-322.107] (-328.437) (-324.047) * (-321.731) [-322.296] (-322.452) (-322.779) -- 0:00:25
429000 -- (-321.241) [-322.694] (-322.146) (-324.230) * (-322.133) [-323.773] (-323.096) (-323.136) -- 0:00:26
429500 -- (-323.323) (-322.042) (-323.121) [-321.584] * (-325.581) (-325.258) [-322.772] (-324.952) -- 0:00:26
430000 -- (-323.722) (-323.651) (-321.561) [-322.832] * (-323.072) (-324.465) [-322.232] (-320.939) -- 0:00:26
Average standard deviation of split frequencies: 0.014595
430500 -- (-323.943) [-320.917] (-321.673) (-322.427) * (-323.886) (-323.844) [-323.358] (-321.924) -- 0:00:26
431000 -- (-325.876) (-325.758) [-323.344] (-322.063) * (-321.032) (-323.971) (-322.452) [-322.879] -- 0:00:26
431500 -- [-323.580] (-321.901) (-321.028) (-325.460) * [-323.422] (-322.150) (-322.064) (-324.384) -- 0:00:26
432000 -- (-323.345) [-321.385] (-321.490) (-321.300) * (-322.190) (-322.065) [-322.279] (-323.171) -- 0:00:26
432500 -- (-321.161) (-324.630) (-321.821) [-324.525] * (-320.927) (-321.293) [-321.603] (-322.874) -- 0:00:26
433000 -- (-326.295) [-322.963] (-322.574) (-323.621) * [-323.067] (-322.217) (-323.550) (-320.909) -- 0:00:26
433500 -- (-321.927) (-325.761) [-323.321] (-322.042) * (-322.322) (-325.605) (-322.276) [-321.138] -- 0:00:26
434000 -- [-329.156] (-323.114) (-324.771) (-322.163) * (-324.478) [-323.935] (-323.695) (-324.585) -- 0:00:26
434500 -- (-325.203) [-322.008] (-322.178) (-323.527) * (-322.840) [-325.407] (-323.453) (-325.546) -- 0:00:26
435000 -- (-325.014) (-320.872) [-323.849] (-323.793) * [-326.948] (-323.555) (-322.606) (-324.606) -- 0:00:25
Average standard deviation of split frequencies: 0.016578
435500 -- (-324.053) [-325.452] (-322.108) (-323.899) * (-331.229) (-324.252) (-322.039) [-321.779] -- 0:00:25
436000 -- (-323.282) (-321.472) [-323.284] (-323.760) * (-322.951) (-322.791) [-322.042] (-323.176) -- 0:00:25
436500 -- (-327.679) [-322.451] (-321.634) (-321.894) * (-324.783) [-321.009] (-321.744) (-322.053) -- 0:00:25
437000 -- (-323.010) (-324.603) [-321.738] (-321.815) * [-321.469] (-322.163) (-322.036) (-321.357) -- 0:00:25
437500 -- (-323.458) [-321.504] (-325.326) (-322.309) * (-322.673) [-321.773] (-321.719) (-322.302) -- 0:00:25
438000 -- (-323.614) (-321.475) (-321.720) [-324.335] * (-322.069) (-322.117) [-323.170] (-323.448) -- 0:00:25
438500 -- (-324.111) (-322.708) [-321.729] (-323.096) * [-321.168] (-325.493) (-322.995) (-322.144) -- 0:00:25
439000 -- (-323.714) (-325.636) (-324.669) [-326.162] * (-322.690) [-323.734] (-324.099) (-323.594) -- 0:00:25
439500 -- (-321.559) (-322.602) [-321.194] (-323.753) * (-325.495) (-324.245) (-324.202) [-323.409] -- 0:00:25
440000 -- (-322.028) (-322.177) [-324.821] (-321.250) * (-322.571) (-322.065) [-320.965] (-322.165) -- 0:00:25
Average standard deviation of split frequencies: 0.016403
440500 -- [-323.151] (-326.256) (-322.496) (-324.528) * (-321.350) (-321.139) (-326.205) [-320.537] -- 0:00:25
441000 -- (-324.865) (-323.616) (-321.487) [-325.145] * (-323.048) (-323.095) [-321.558] (-322.931) -- 0:00:25
441500 -- [-322.179] (-323.121) (-325.489) (-323.152) * [-320.804] (-324.075) (-321.595) (-321.039) -- 0:00:25
442000 -- (-322.512) (-324.045) (-323.954) [-324.300] * (-321.001) (-321.053) [-321.769] (-324.171) -- 0:00:25
442500 -- (-325.210) [-325.212] (-325.125) (-324.274) * (-322.091) [-321.471] (-322.812) (-325.231) -- 0:00:25
443000 -- (-324.858) [-321.781] (-323.325) (-324.785) * (-324.038) [-321.063] (-324.011) (-323.362) -- 0:00:25
443500 -- [-325.686] (-323.714) (-324.405) (-323.691) * (-325.966) [-321.120] (-323.599) (-324.022) -- 0:00:25
444000 -- (-324.513) (-322.927) [-323.131] (-332.095) * (-322.584) (-322.609) [-321.936] (-321.631) -- 0:00:25
444500 -- [-321.695] (-324.395) (-321.047) (-327.795) * (-321.106) (-321.593) [-322.874] (-321.896) -- 0:00:24
445000 -- (-322.892) (-325.217) [-322.378] (-326.224) * (-322.840) [-321.310] (-321.436) (-323.560) -- 0:00:24
Average standard deviation of split frequencies: 0.014797
445500 -- (-324.268) (-322.792) (-322.510) [-323.507] * (-321.729) [-324.960] (-324.458) (-324.541) -- 0:00:24
446000 -- (-322.704) [-324.811] (-324.680) (-323.725) * (-323.944) [-326.914] (-322.880) (-325.274) -- 0:00:24
446500 -- (-323.081) (-322.122) [-323.467] (-325.470) * (-326.344) [-321.783] (-321.378) (-321.368) -- 0:00:24
447000 -- (-322.666) (-322.829) (-321.052) [-321.722] * (-325.320) (-322.738) [-321.336] (-321.968) -- 0:00:24
447500 -- (-322.106) (-321.953) [-321.373] (-326.867) * [-323.928] (-325.105) (-322.353) (-321.147) -- 0:00:24
448000 -- [-322.199] (-324.998) (-322.333) (-324.281) * (-322.764) (-324.214) [-321.186] (-325.518) -- 0:00:24
448500 -- (-322.865) (-322.729) [-322.244] (-322.428) * (-323.808) (-321.740) (-324.678) [-324.249] -- 0:00:24
449000 -- (-322.774) (-322.830) (-324.209) [-320.939] * (-326.703) (-324.579) [-322.542] (-321.594) -- 0:00:24
449500 -- (-325.396) (-322.604) [-321.909] (-324.353) * (-321.558) (-322.122) [-322.303] (-323.591) -- 0:00:24
450000 -- (-323.389) (-321.706) [-321.206] (-322.668) * (-324.483) [-324.488] (-321.758) (-320.806) -- 0:00:24
Average standard deviation of split frequencies: 0.016039
450500 -- (-321.824) (-325.333) [-324.254] (-323.097) * (-322.910) (-324.022) [-321.277] (-321.879) -- 0:00:24
451000 -- (-323.176) (-323.022) [-321.364] (-325.240) * (-324.634) (-323.784) [-321.841] (-322.400) -- 0:00:24
451500 -- (-322.146) [-324.684] (-321.645) (-322.975) * (-320.989) (-322.068) (-321.154) [-323.483] -- 0:00:24
452000 -- (-327.428) (-325.543) [-324.076] (-323.364) * [-321.699] (-323.690) (-325.322) (-321.249) -- 0:00:25
452500 -- [-324.188] (-324.159) (-324.011) (-325.693) * (-321.787) (-323.015) (-324.377) [-321.532] -- 0:00:25
453000 -- [-327.208] (-322.416) (-325.351) (-323.646) * [-321.287] (-321.915) (-321.214) (-322.090) -- 0:00:25
453500 -- (-322.453) (-322.400) [-323.350] (-321.574) * (-325.365) (-323.176) (-321.413) [-321.311] -- 0:00:25
454000 -- (-321.520) [-322.799] (-324.559) (-321.085) * [-323.130] (-322.906) (-322.002) (-322.403) -- 0:00:25
454500 -- (-322.107) [-325.690] (-323.763) (-321.908) * (-321.136) (-323.315) (-322.904) [-323.643] -- 0:00:25
455000 -- (-320.493) [-322.693] (-322.015) (-326.661) * (-324.853) [-326.718] (-323.614) (-323.551) -- 0:00:25
Average standard deviation of split frequencies: 0.016541
455500 -- [-323.766] (-322.088) (-325.910) (-324.079) * [-321.768] (-324.583) (-323.626) (-321.786) -- 0:00:25
456000 -- [-323.853] (-321.589) (-323.832) (-327.106) * [-321.185] (-321.422) (-321.603) (-322.436) -- 0:00:25
456500 -- [-321.481] (-323.839) (-324.885) (-325.806) * (-327.181) (-320.573) (-323.712) [-324.710] -- 0:00:25
457000 -- [-322.292] (-321.990) (-323.330) (-325.259) * (-324.468) [-321.291] (-323.490) (-323.372) -- 0:00:24
457500 -- [-321.761] (-320.973) (-323.602) (-321.397) * (-321.314) (-321.526) [-321.536] (-324.920) -- 0:00:24
458000 -- (-325.229) [-320.942] (-321.295) (-324.446) * (-325.843) (-321.571) [-321.043] (-323.655) -- 0:00:24
458500 -- [-324.333] (-326.504) (-323.318) (-322.894) * (-322.401) (-322.619) (-323.225) [-321.249] -- 0:00:24
459000 -- (-322.725) (-322.532) [-323.131] (-323.240) * (-326.198) [-325.160] (-322.252) (-321.897) -- 0:00:24
459500 -- (-324.479) [-325.141] (-323.203) (-324.105) * (-324.166) [-322.755] (-324.484) (-322.963) -- 0:00:24
460000 -- (-322.890) (-324.204) [-321.645] (-323.713) * (-320.815) (-324.641) (-322.895) [-326.374] -- 0:00:24
Average standard deviation of split frequencies: 0.016373
460500 -- (-322.134) [-321.576] (-321.261) (-322.871) * (-322.019) (-329.400) (-326.223) [-325.918] -- 0:00:24
461000 -- (-322.620) [-321.397] (-323.786) (-324.287) * [-323.798] (-324.549) (-322.648) (-320.895) -- 0:00:24
461500 -- (-323.169) (-321.344) [-322.370] (-323.222) * (-327.761) [-321.023] (-320.690) (-322.033) -- 0:00:24
462000 -- (-321.227) (-322.544) [-323.009] (-323.579) * (-325.828) [-321.365] (-322.227) (-322.909) -- 0:00:24
462500 -- [-323.690] (-323.704) (-328.486) (-321.097) * (-321.726) (-320.906) (-321.552) [-326.052] -- 0:00:24
463000 -- (-322.474) [-321.195] (-324.929) (-326.434) * (-326.666) (-328.418) [-321.354] (-323.431) -- 0:00:24
463500 -- (-321.486) [-326.158] (-323.188) (-323.340) * (-327.207) [-324.966] (-322.759) (-321.610) -- 0:00:24
464000 -- (-324.325) (-321.896) (-326.217) [-321.744] * (-323.972) (-323.473) [-321.709] (-321.759) -- 0:00:24
464500 -- (-321.967) (-324.090) (-323.770) [-324.543] * (-322.836) (-321.542) (-322.760) [-324.774] -- 0:00:24
465000 -- (-321.439) (-323.300) [-321.331] (-328.684) * [-320.942] (-323.513) (-327.374) (-323.275) -- 0:00:24
Average standard deviation of split frequencies: 0.015511
465500 -- (-325.056) [-322.773] (-323.528) (-320.806) * (-323.459) [-322.203] (-321.374) (-323.518) -- 0:00:24
466000 -- [-326.041] (-323.802) (-323.589) (-320.637) * (-321.977) (-322.582) (-322.214) [-324.939] -- 0:00:24
466500 -- (-324.872) (-328.776) (-322.201) [-323.143] * [-323.650] (-322.955) (-323.907) (-322.612) -- 0:00:24
467000 -- [-321.334] (-326.842) (-323.153) (-323.181) * [-324.569] (-321.692) (-324.169) (-321.058) -- 0:00:23
467500 -- (-323.542) [-320.980] (-321.792) (-321.752) * [-322.553] (-321.773) (-324.296) (-320.909) -- 0:00:23
468000 -- [-327.157] (-322.367) (-323.172) (-324.638) * (-324.338) [-323.894] (-321.423) (-321.401) -- 0:00:23
468500 -- (-323.719) (-321.106) [-322.772] (-321.944) * (-325.862) (-323.721) [-323.404] (-321.848) -- 0:00:23
469000 -- (-321.760) [-325.143] (-323.158) (-323.084) * (-321.694) [-324.311] (-325.255) (-322.110) -- 0:00:23
469500 -- [-323.320] (-325.548) (-320.965) (-324.090) * [-323.244] (-322.648) (-323.562) (-321.390) -- 0:00:24
470000 -- (-324.720) (-321.001) [-322.879] (-324.195) * (-326.950) (-321.429) (-320.670) [-322.125] -- 0:00:24
Average standard deviation of split frequencies: 0.015357
470500 -- (-324.407) (-330.907) (-321.909) [-321.377] * (-323.206) (-324.878) [-320.921] (-324.119) -- 0:00:24
471000 -- (-326.588) (-321.803) (-321.086) [-324.376] * [-322.368] (-326.156) (-323.224) (-324.105) -- 0:00:24
471500 -- (-323.445) (-321.572) [-322.161] (-324.397) * (-322.231) [-321.824] (-322.704) (-321.546) -- 0:00:24
472000 -- (-324.221) (-324.257) (-322.989) [-320.804] * (-321.360) (-321.655) (-321.432) [-324.979] -- 0:00:24
472500 -- (-322.048) (-321.746) (-320.767) [-322.615] * (-325.077) (-321.653) [-324.381] (-324.823) -- 0:00:24
473000 -- [-320.805] (-321.959) (-325.596) (-323.738) * (-322.341) (-321.649) [-325.027] (-324.974) -- 0:00:24
473500 -- (-326.486) (-321.190) (-321.543) [-323.347] * (-322.403) (-322.879) (-321.409) [-321.477] -- 0:00:24
474000 -- [-321.883] (-326.158) (-320.801) (-323.166) * (-326.068) [-323.717] (-321.752) (-323.215) -- 0:00:24
474500 -- (-323.181) (-322.458) [-323.019] (-323.884) * (-323.241) (-324.122) [-322.899] (-324.236) -- 0:00:24
475000 -- (-321.674) (-321.750) [-323.447] (-323.159) * (-327.795) [-322.583] (-321.726) (-321.171) -- 0:00:24
Average standard deviation of split frequencies: 0.016506
475500 -- (-330.045) [-325.923] (-323.867) (-322.592) * [-328.338] (-322.256) (-320.911) (-323.302) -- 0:00:24
476000 -- (-325.745) (-323.350) [-328.616] (-322.355) * (-330.134) (-323.787) (-322.060) [-322.542] -- 0:00:24
476500 -- (-327.835) (-322.147) [-320.759] (-321.064) * (-324.590) [-322.147] (-326.364) (-322.757) -- 0:00:24
477000 -- (-321.346) [-320.661] (-323.528) (-321.860) * (-324.608) (-326.355) [-321.916] (-323.633) -- 0:00:24
477500 -- [-321.222] (-323.347) (-321.524) (-321.225) * (-325.816) (-325.215) (-323.999) [-322.423] -- 0:00:24
478000 -- (-324.126) (-321.204) (-326.416) [-321.652] * [-323.545] (-325.589) (-323.993) (-326.908) -- 0:00:24
478500 -- (-323.368) (-322.246) [-323.549] (-323.029) * (-322.412) (-324.054) [-323.328] (-323.502) -- 0:00:23
479000 -- (-322.300) [-321.433] (-325.766) (-323.492) * (-322.814) (-322.210) (-324.150) [-321.895] -- 0:00:23
479500 -- (-326.879) (-320.877) [-320.689] (-322.088) * [-324.859] (-326.271) (-322.378) (-323.672) -- 0:00:23
480000 -- (-324.645) (-323.137) [-321.857] (-325.846) * (-325.446) [-322.348] (-323.222) (-324.393) -- 0:00:23
Average standard deviation of split frequencies: 0.016346
480500 -- (-322.313) (-325.548) (-324.772) [-324.606] * (-323.536) (-321.815) (-327.759) [-322.532] -- 0:00:23
481000 -- (-323.207) (-323.877) (-322.855) [-321.160] * [-323.622] (-321.239) (-322.863) (-321.634) -- 0:00:23
481500 -- [-324.866] (-322.463) (-323.651) (-324.303) * (-321.020) [-321.235] (-321.066) (-322.101) -- 0:00:23
482000 -- (-324.204) (-324.234) [-324.569] (-321.097) * [-321.931] (-328.902) (-323.207) (-322.391) -- 0:00:23
482500 -- (-322.520) [-321.868] (-325.021) (-322.600) * [-321.584] (-324.440) (-321.741) (-330.639) -- 0:00:23
483000 -- (-324.714) [-322.496] (-331.870) (-321.816) * (-323.174) (-321.551) [-321.175] (-321.310) -- 0:00:23
483500 -- (-328.416) (-321.876) [-324.204] (-324.023) * [-327.974] (-323.354) (-321.305) (-321.526) -- 0:00:23
484000 -- (-323.782) [-321.880] (-324.855) (-323.664) * (-323.784) (-322.377) [-322.483] (-325.952) -- 0:00:23
484500 -- (-323.327) [-323.709] (-327.454) (-323.500) * (-323.519) (-322.020) [-323.569] (-321.831) -- 0:00:23
485000 -- (-321.673) (-322.623) [-325.850] (-326.526) * (-321.277) (-323.501) [-323.714] (-323.305) -- 0:00:23
Average standard deviation of split frequencies: 0.014873
485500 -- [-320.829] (-323.480) (-323.013) (-324.714) * (-324.227) [-321.176] (-322.753) (-321.182) -- 0:00:23
486000 -- [-323.532] (-322.730) (-322.458) (-323.043) * [-325.132] (-327.040) (-321.920) (-320.983) -- 0:00:23
486500 -- [-322.278] (-326.883) (-320.994) (-324.924) * (-320.899) (-321.460) (-321.741) [-324.852] -- 0:00:23
487000 -- (-323.825) [-326.832] (-321.750) (-322.584) * (-322.113) (-322.537) (-321.642) [-325.217] -- 0:00:23
487500 -- [-326.483] (-324.051) (-324.237) (-324.540) * [-321.812] (-322.636) (-321.298) (-326.793) -- 0:00:23
488000 -- [-323.835] (-324.227) (-323.728) (-323.537) * (-323.411) [-322.124] (-323.983) (-321.347) -- 0:00:23
488500 -- [-322.994] (-324.799) (-324.785) (-321.154) * [-324.121] (-323.877) (-320.920) (-323.037) -- 0:00:24
489000 -- (-323.568) (-325.119) (-323.975) [-321.920] * [-324.180] (-322.002) (-321.167) (-322.651) -- 0:00:24
489500 -- [-322.081] (-323.657) (-322.846) (-323.567) * [-323.383] (-322.248) (-322.250) (-321.281) -- 0:00:23
490000 -- (-321.505) (-322.461) (-323.964) [-320.734] * (-321.607) (-322.812) (-322.374) [-323.109] -- 0:00:23
Average standard deviation of split frequencies: 0.014091
490500 -- (-322.461) (-321.094) [-321.648] (-322.169) * (-322.403) (-321.535) [-321.405] (-322.251) -- 0:00:23
491000 -- (-323.271) (-322.679) [-325.445] (-321.535) * [-321.189] (-320.776) (-320.869) (-321.949) -- 0:00:23
491500 -- (-320.750) (-322.020) (-320.601) [-321.424] * (-322.127) (-321.770) (-320.819) [-322.222] -- 0:00:23
492000 -- (-322.591) [-321.345] (-323.172) (-323.221) * (-324.595) [-321.776] (-328.535) (-321.259) -- 0:00:23
492500 -- (-322.037) [-322.966] (-323.949) (-321.646) * (-321.820) [-323.984] (-324.793) (-322.073) -- 0:00:23
493000 -- (-323.127) [-322.775] (-325.922) (-321.889) * (-322.531) (-322.594) (-325.731) [-323.045] -- 0:00:23
493500 -- (-322.934) (-326.139) (-324.767) [-321.961] * (-322.218) (-323.145) (-321.889) [-322.294] -- 0:00:23
494000 -- [-321.195] (-323.742) (-323.500) (-324.509) * [-321.603] (-321.472) (-323.414) (-321.634) -- 0:00:23
494500 -- (-323.724) (-324.026) [-321.895] (-326.376) * (-329.005) [-321.883] (-322.861) (-322.890) -- 0:00:23
495000 -- (-321.546) (-322.671) (-321.417) [-322.512] * (-322.242) [-322.242] (-323.196) (-321.835) -- 0:00:23
Average standard deviation of split frequencies: 0.015207
495500 -- [-323.284] (-321.845) (-321.438) (-321.440) * (-321.694) (-323.258) [-322.868] (-323.186) -- 0:00:23
496000 -- (-322.354) [-320.887] (-323.869) (-324.243) * (-324.603) (-322.436) [-322.449] (-322.116) -- 0:00:23
496500 -- (-321.496) [-320.858] (-327.529) (-326.101) * [-322.064] (-323.468) (-321.256) (-324.005) -- 0:00:23
497000 -- (-321.141) (-325.425) (-324.302) [-323.355] * (-326.311) (-327.793) [-324.716] (-325.258) -- 0:00:23
497500 -- [-331.223] (-322.638) (-324.423) (-325.263) * [-322.538] (-322.893) (-324.766) (-326.910) -- 0:00:23
498000 -- (-323.818) (-321.796) (-323.151) [-324.994] * [-324.409] (-322.250) (-322.868) (-322.803) -- 0:00:23
498500 -- (-322.140) (-321.536) [-322.076] (-326.692) * (-324.699) (-321.528) [-321.556] (-323.333) -- 0:00:23
499000 -- (-321.682) (-320.994) [-324.501] (-324.009) * (-321.957) (-320.564) [-322.770] (-321.947) -- 0:00:23
499500 -- (-321.064) (-321.283) (-324.159) [-321.487] * (-324.375) [-323.213] (-324.186) (-324.439) -- 0:00:23
500000 -- (-321.225) [-321.953] (-324.044) (-323.620) * (-321.050) (-326.613) (-323.920) [-322.040] -- 0:00:23
Average standard deviation of split frequencies: 0.013182
500500 -- (-322.072) (-322.078) (-323.876) [-321.673] * [-322.140] (-322.163) (-322.427) (-322.173) -- 0:00:22
501000 -- (-323.276) [-325.471] (-320.946) (-326.693) * (-323.371) [-322.264] (-321.652) (-321.212) -- 0:00:22
501500 -- [-321.758] (-326.408) (-322.246) (-321.388) * (-323.145) (-322.683) (-322.888) [-322.090] -- 0:00:22
502000 -- [-322.276] (-325.482) (-323.191) (-321.817) * (-321.581) (-321.296) (-323.782) [-322.137] -- 0:00:22
502500 -- (-323.068) (-322.881) (-324.923) [-331.319] * (-322.210) (-325.897) (-323.410) [-321.912] -- 0:00:22
503000 -- (-324.009) [-324.946] (-322.198) (-323.149) * [-322.878] (-331.016) (-323.512) (-322.093) -- 0:00:22
503500 -- (-323.217) [-321.207] (-320.597) (-321.828) * [-323.161] (-322.162) (-320.801) (-333.616) -- 0:00:22
504000 -- (-320.671) (-321.950) (-323.184) [-320.907] * (-324.476) (-324.532) (-322.375) [-321.276] -- 0:00:22
504500 -- (-323.037) [-322.822] (-326.082) (-321.922) * (-322.478) (-322.284) [-320.944] (-323.334) -- 0:00:22
505000 -- (-321.946) (-323.409) [-322.071] (-323.373) * (-322.923) (-321.428) [-320.879] (-323.035) -- 0:00:22
Average standard deviation of split frequencies: 0.014906
505500 -- (-321.607) (-323.157) [-321.916] (-323.381) * (-320.702) (-328.079) (-321.754) [-321.370] -- 0:00:22
506000 -- [-320.700] (-325.790) (-324.095) (-323.225) * (-323.945) (-322.941) (-321.394) [-322.361] -- 0:00:22
506500 -- (-322.099) (-325.896) [-321.698] (-322.399) * [-321.125] (-323.597) (-321.971) (-323.370) -- 0:00:22
507000 -- (-321.275) (-324.132) [-322.751] (-321.231) * [-321.284] (-322.438) (-322.190) (-323.124) -- 0:00:22
507500 -- [-321.804] (-324.401) (-321.078) (-322.460) * [-321.753] (-325.229) (-325.119) (-323.633) -- 0:00:22
508000 -- (-321.471) (-322.946) [-322.109] (-321.965) * (-323.758) (-323.886) [-321.554] (-321.792) -- 0:00:22
508500 -- [-325.380] (-324.747) (-320.964) (-322.235) * (-322.219) (-323.331) [-321.452] (-324.075) -- 0:00:22
509000 -- [-320.699] (-323.231) (-323.022) (-325.669) * (-324.492) (-322.587) [-320.770] (-323.801) -- 0:00:22
509500 -- (-322.034) (-326.324) (-324.592) [-320.923] * [-324.268] (-321.494) (-323.224) (-324.542) -- 0:00:22
510000 -- [-321.258] (-326.092) (-322.339) (-323.320) * [-323.078] (-322.891) (-324.781) (-321.891) -- 0:00:22
Average standard deviation of split frequencies: 0.016001
510500 -- (-321.660) (-321.045) [-323.553] (-323.144) * (-323.051) (-325.703) (-325.436) [-321.449] -- 0:00:23
511000 -- (-324.469) (-321.753) (-321.723) [-322.086] * [-323.408] (-325.251) (-322.799) (-321.807) -- 0:00:22
511500 -- (-324.088) (-321.390) (-322.698) [-321.096] * (-324.178) [-323.015] (-325.874) (-320.922) -- 0:00:22
512000 -- (-321.545) (-321.007) [-322.711] (-322.994) * (-324.083) [-322.943] (-324.027) (-324.970) -- 0:00:22
512500 -- (-323.091) (-323.938) (-324.761) [-325.176] * (-324.725) (-321.770) (-324.100) [-322.748] -- 0:00:22
513000 -- (-330.447) (-322.663) (-323.562) [-321.886] * (-322.611) [-323.741] (-323.431) (-323.658) -- 0:00:22
513500 -- (-322.403) [-322.964] (-322.892) (-322.766) * [-322.463] (-320.749) (-322.545) (-324.160) -- 0:00:22
514000 -- (-323.496) (-322.000) (-321.910) [-323.770] * (-322.408) (-322.431) [-321.302] (-320.862) -- 0:00:22
514500 -- (-321.332) [-322.696] (-322.226) (-322.303) * (-323.062) [-320.702] (-324.543) (-324.776) -- 0:00:22
515000 -- (-322.164) [-322.889] (-322.451) (-321.450) * [-321.513] (-322.187) (-323.243) (-324.848) -- 0:00:22
Average standard deviation of split frequencies: 0.016444
515500 -- (-322.794) [-321.052] (-323.820) (-322.033) * (-324.102) (-323.694) [-321.154] (-322.844) -- 0:00:22
516000 -- (-321.969) (-321.024) (-325.523) [-321.556] * (-323.267) (-322.655) (-323.403) [-324.049] -- 0:00:22
516500 -- [-322.727] (-320.376) (-322.435) (-331.362) * (-321.563) (-323.791) (-323.899) [-321.281] -- 0:00:22
517000 -- [-320.874] (-323.645) (-325.046) (-329.880) * (-322.874) (-326.609) (-321.792) [-321.245] -- 0:00:22
517500 -- [-324.170] (-325.659) (-321.026) (-327.374) * (-323.488) [-322.536] (-321.021) (-325.503) -- 0:00:22
518000 -- [-323.430] (-330.851) (-323.791) (-325.343) * [-322.625] (-325.963) (-322.494) (-325.841) -- 0:00:22
518500 -- [-322.304] (-323.906) (-328.445) (-325.910) * (-326.808) (-321.003) (-323.628) [-323.268] -- 0:00:22
519000 -- (-322.179) (-325.231) (-321.612) [-324.158] * (-321.852) (-328.001) [-322.209] (-322.973) -- 0:00:22
519500 -- (-322.295) (-322.307) (-325.231) [-326.022] * (-321.322) (-323.525) [-324.272] (-324.428) -- 0:00:22
520000 -- [-322.244] (-328.184) (-323.118) (-324.733) * (-321.914) (-322.409) [-323.866] (-322.288) -- 0:00:22
Average standard deviation of split frequencies: 0.016297
520500 -- (-325.273) (-322.119) (-321.418) [-322.130] * (-323.518) (-323.629) (-323.007) [-322.061] -- 0:00:22
521000 -- (-323.526) (-324.950) (-323.154) [-323.160] * (-324.867) [-320.836] (-326.611) (-322.615) -- 0:00:22
521500 -- (-322.675) (-329.179) [-320.764] (-322.307) * [-322.117] (-322.858) (-322.612) (-321.275) -- 0:00:22
522000 -- (-323.674) [-329.901] (-321.745) (-322.106) * (-321.883) (-321.682) (-322.012) [-323.282] -- 0:00:21
522500 -- (-328.023) (-322.023) [-321.784] (-320.942) * [-321.224] (-324.866) (-322.945) (-320.626) -- 0:00:21
523000 -- (-324.035) (-322.822) (-320.697) [-321.299] * (-323.581) [-326.477] (-324.350) (-327.144) -- 0:00:21
523500 -- [-322.689] (-328.182) (-322.590) (-321.829) * (-326.888) [-322.507] (-322.480) (-332.768) -- 0:00:21
524000 -- (-324.640) (-326.153) (-320.726) [-323.109] * (-327.757) [-323.726] (-323.457) (-327.241) -- 0:00:21
524500 -- (-321.478) [-322.838] (-321.792) (-327.566) * (-320.646) (-326.031) (-326.715) [-325.516] -- 0:00:21
525000 -- (-323.021) (-322.823) [-324.025] (-325.704) * (-321.425) (-325.924) (-322.889) [-323.774] -- 0:00:21
Average standard deviation of split frequencies: 0.018522
525500 -- (-323.907) [-321.171] (-323.315) (-325.663) * [-321.834] (-328.457) (-323.961) (-321.059) -- 0:00:21
526000 -- (-324.673) (-322.456) (-324.089) [-323.262] * (-323.725) (-323.160) [-323.232] (-326.162) -- 0:00:21
526500 -- [-323.900] (-322.787) (-323.610) (-322.473) * [-322.742] (-321.454) (-322.427) (-323.131) -- 0:00:21
527000 -- (-323.049) (-321.500) [-322.087] (-323.020) * (-322.745) [-321.526] (-321.501) (-321.238) -- 0:00:21
527500 -- (-321.167) [-321.209] (-322.411) (-324.488) * (-324.921) [-322.949] (-322.119) (-323.500) -- 0:00:21
528000 -- [-321.657] (-325.466) (-322.061) (-323.110) * [-323.092] (-324.986) (-326.236) (-327.014) -- 0:00:21
528500 -- (-323.903) (-323.611) (-321.281) [-323.360] * (-322.112) (-324.566) (-320.899) [-324.465] -- 0:00:21
529000 -- (-324.508) [-322.720] (-326.896) (-321.157) * [-322.838] (-321.811) (-320.988) (-322.274) -- 0:00:21
529500 -- (-323.365) (-320.759) (-324.039) [-322.639] * (-321.876) [-321.700] (-322.030) (-321.869) -- 0:00:21
530000 -- [-321.842] (-323.777) (-323.608) (-325.445) * [-327.026] (-321.942) (-322.652) (-322.865) -- 0:00:21
Average standard deviation of split frequencies: 0.018359
530500 -- (-324.113) (-325.059) (-321.415) [-322.389] * (-321.064) (-322.790) [-321.190] (-331.657) -- 0:00:21
531000 -- (-322.133) [-321.733] (-320.747) (-324.643) * (-320.831) (-323.150) (-323.143) [-323.220] -- 0:00:21
531500 -- [-320.456] (-322.963) (-322.727) (-321.907) * [-326.276] (-327.927) (-322.205) (-321.411) -- 0:00:21
532000 -- (-322.077) (-322.364) (-321.878) [-320.734] * (-321.005) (-328.296) [-320.930] (-320.796) -- 0:00:21
532500 -- (-322.089) (-323.091) [-321.142] (-321.556) * (-323.447) [-324.825] (-322.153) (-322.409) -- 0:00:21
533000 -- [-322.806] (-325.896) (-322.452) (-323.577) * [-321.678] (-324.659) (-322.718) (-322.475) -- 0:00:21
533500 -- (-325.301) [-321.814] (-324.618) (-321.094) * (-323.287) (-323.493) (-321.300) [-322.592] -- 0:00:21
534000 -- (-321.185) (-322.414) (-322.391) [-321.291] * [-323.153] (-322.841) (-327.649) (-324.690) -- 0:00:21
534500 -- (-323.650) [-322.124] (-323.501) (-321.481) * (-326.678) [-321.651] (-323.779) (-320.967) -- 0:00:21
535000 -- (-326.110) (-322.780) [-323.975] (-321.899) * [-322.769] (-321.870) (-323.282) (-329.724) -- 0:00:21
Average standard deviation of split frequencies: 0.017590
535500 -- (-324.201) (-324.221) (-326.793) [-323.880] * [-322.249] (-321.896) (-322.823) (-321.994) -- 0:00:21
536000 -- (-322.784) (-322.857) (-323.289) [-322.739] * [-322.773] (-321.580) (-322.178) (-323.475) -- 0:00:21
536500 -- (-330.583) [-324.977] (-324.621) (-321.759) * (-322.848) (-326.433) (-323.596) [-323.215] -- 0:00:21
537000 -- [-323.043] (-323.625) (-327.538) (-324.954) * (-322.715) (-322.302) (-321.643) [-322.085] -- 0:00:21
537500 -- (-323.017) [-321.698] (-324.689) (-328.614) * (-321.352) (-326.294) [-322.423] (-320.879) -- 0:00:21
538000 -- [-321.848] (-326.001) (-324.924) (-321.177) * (-323.697) (-322.005) [-321.927] (-320.827) -- 0:00:21
538500 -- (-323.981) (-324.776) (-322.776) [-322.580] * (-326.210) [-324.442] (-322.155) (-321.847) -- 0:00:21
539000 -- (-322.492) (-321.481) (-323.873) [-320.976] * (-321.254) [-321.322] (-323.394) (-323.313) -- 0:00:21
539500 -- [-322.459] (-324.424) (-322.520) (-321.125) * (-325.125) [-321.118] (-323.820) (-320.915) -- 0:00:21
540000 -- [-321.784] (-325.708) (-322.607) (-322.075) * [-327.542] (-322.638) (-323.352) (-321.324) -- 0:00:21
Average standard deviation of split frequencies: 0.018600
540500 -- (-323.505) (-320.983) (-324.366) [-320.967] * (-322.890) [-324.699] (-321.389) (-328.618) -- 0:00:21
541000 -- (-322.876) (-322.371) [-322.564] (-322.327) * (-322.388) (-323.750) [-320.977] (-324.383) -- 0:00:21
541500 -- [-326.073] (-322.286) (-321.093) (-326.380) * [-324.280] (-322.067) (-321.329) (-322.363) -- 0:00:21
542000 -- (-326.691) (-322.664) [-321.984] (-322.229) * (-323.451) [-323.693] (-325.084) (-323.882) -- 0:00:21
542500 -- (-323.311) [-322.201] (-323.021) (-322.720) * (-326.062) (-321.129) [-321.862] (-321.503) -- 0:00:21
543000 -- (-324.625) (-328.428) [-327.670] (-322.858) * [-322.518] (-321.649) (-321.337) (-322.020) -- 0:00:21
543500 -- (-322.435) (-323.588) [-322.659] (-322.924) * [-325.631] (-323.084) (-322.185) (-323.339) -- 0:00:20
544000 -- [-324.046] (-326.812) (-321.924) (-321.581) * (-327.826) [-321.309] (-322.427) (-322.754) -- 0:00:20
544500 -- (-321.489) (-321.990) (-321.015) [-322.147] * (-321.632) (-322.559) [-323.055] (-322.759) -- 0:00:20
545000 -- (-321.587) [-320.880] (-320.990) (-324.474) * [-331.062] (-320.673) (-321.473) (-322.963) -- 0:00:20
Average standard deviation of split frequencies: 0.020145
545500 -- (-321.705) [-321.413] (-321.274) (-324.163) * (-324.950) (-326.598) (-325.447) [-322.879] -- 0:00:20
546000 -- [-323.555] (-322.703) (-322.413) (-323.196) * (-322.129) [-324.520] (-321.952) (-324.093) -- 0:00:20
546500 -- (-322.022) [-320.771] (-322.835) (-321.967) * (-321.203) (-323.756) (-322.661) [-321.866] -- 0:00:20
547000 -- (-323.539) (-322.269) [-321.482] (-321.438) * (-320.781) (-322.288) (-323.185) [-320.878] -- 0:00:20
547500 -- (-326.074) [-321.766] (-324.742) (-323.621) * (-321.998) (-321.381) [-322.267] (-322.213) -- 0:00:20
548000 -- (-325.155) (-322.639) [-322.608] (-321.816) * (-322.414) [-321.682] (-322.035) (-321.795) -- 0:00:20
548500 -- (-322.992) (-326.043) (-324.015) [-321.915] * (-322.658) [-324.339] (-323.515) (-321.779) -- 0:00:20
549000 -- (-322.449) [-321.643] (-321.265) (-328.064) * (-321.799) [-321.102] (-325.110) (-322.008) -- 0:00:20
549500 -- (-323.035) [-322.819] (-320.803) (-328.050) * [-325.764] (-323.793) (-323.592) (-321.853) -- 0:00:20
550000 -- (-321.813) (-322.697) [-321.116] (-323.251) * (-325.340) (-321.812) (-322.339) [-324.084] -- 0:00:20
Average standard deviation of split frequencies: 0.018263
550500 -- [-323.720] (-325.639) (-324.654) (-325.047) * [-320.845] (-320.749) (-322.746) (-324.332) -- 0:00:20
551000 -- [-323.101] (-323.354) (-323.027) (-323.004) * (-323.502) (-321.981) [-321.462] (-322.347) -- 0:00:20
551500 -- (-322.058) (-321.881) [-322.618] (-323.566) * [-323.699] (-321.674) (-321.183) (-324.395) -- 0:00:20
552000 -- [-322.205] (-323.771) (-323.285) (-322.087) * (-322.668) (-320.679) (-323.751) [-326.754] -- 0:00:20
552500 -- (-322.328) (-322.409) [-321.931] (-321.801) * (-323.364) (-321.871) [-323.803] (-322.023) -- 0:00:20
553000 -- (-322.869) [-322.441] (-325.313) (-322.957) * (-322.257) (-325.949) (-326.211) [-321.694] -- 0:00:20
553500 -- [-324.786] (-325.974) (-321.548) (-322.292) * (-321.138) (-325.339) (-325.003) [-324.608] -- 0:00:20
554000 -- (-322.751) (-326.321) (-321.635) [-322.665] * (-323.067) [-324.599] (-321.975) (-322.891) -- 0:00:20
554500 -- (-323.896) (-322.257) (-322.901) [-323.696] * (-323.924) (-324.618) (-322.388) [-322.398] -- 0:00:20
555000 -- (-323.525) [-320.662] (-321.660) (-321.279) * (-322.674) [-322.245] (-325.777) (-321.919) -- 0:00:20
Average standard deviation of split frequencies: 0.015827
555500 -- (-321.748) [-320.711] (-321.566) (-321.295) * [-321.890] (-323.004) (-321.204) (-324.045) -- 0:00:20
556000 -- (-325.920) (-323.889) (-324.514) [-322.125] * [-321.147] (-327.592) (-321.081) (-322.057) -- 0:00:20
556500 -- (-322.322) (-322.413) (-324.754) [-321.892] * (-322.400) (-322.216) [-322.461] (-322.832) -- 0:00:20
557000 -- [-326.263] (-322.938) (-321.559) (-321.309) * (-326.694) (-321.930) [-322.573] (-322.336) -- 0:00:20
557500 -- (-325.604) (-324.808) [-323.652] (-322.640) * (-325.460) [-322.526] (-322.275) (-322.984) -- 0:00:20
558000 -- (-321.864) [-323.803] (-322.927) (-326.677) * (-320.902) (-325.111) [-323.751] (-330.642) -- 0:00:20
558500 -- (-322.090) [-322.501] (-324.172) (-323.092) * (-321.228) (-322.232) (-322.833) [-321.830] -- 0:00:20
559000 -- (-322.183) [-322.394] (-325.873) (-324.612) * (-327.067) [-321.307] (-322.713) (-321.759) -- 0:00:20
559500 -- (-321.884) (-321.951) (-325.924) [-322.833] * (-325.925) (-322.784) (-323.123) [-320.462] -- 0:00:20
560000 -- (-327.188) (-320.892) [-324.088] (-323.303) * (-322.193) (-324.326) (-322.149) [-324.829] -- 0:00:20
Average standard deviation of split frequencies: 0.013453
560500 -- [-325.295] (-324.333) (-331.392) (-321.705) * (-322.604) (-321.764) [-320.788] (-324.560) -- 0:00:20
561000 -- (-325.962) [-322.690] (-323.554) (-321.741) * (-321.576) (-326.811) (-323.916) [-321.536] -- 0:00:20
561500 -- (-326.979) (-326.536) [-322.764] (-323.998) * (-323.325) (-324.432) [-321.362] (-322.839) -- 0:00:20
562000 -- (-323.209) (-333.197) (-326.109) [-322.448] * [-320.996] (-321.696) (-320.524) (-323.613) -- 0:00:20
562500 -- (-324.402) [-327.000] (-326.779) (-323.618) * [-322.899] (-321.744) (-321.959) (-323.408) -- 0:00:20
563000 -- [-321.541] (-326.701) (-325.991) (-324.170) * [-323.117] (-324.290) (-327.354) (-325.248) -- 0:00:20
563500 -- (-323.593) (-326.253) (-323.033) [-320.752] * (-323.083) (-323.507) [-324.927] (-324.938) -- 0:00:20
564000 -- (-329.398) (-324.641) [-324.668] (-325.315) * [-323.053] (-322.685) (-325.448) (-322.951) -- 0:00:20
564500 -- (-324.557) (-321.679) (-323.046) [-321.637] * (-321.868) (-324.373) [-321.485] (-321.596) -- 0:00:20
565000 -- (-321.497) (-323.832) [-321.518] (-326.961) * [-321.394] (-323.973) (-322.001) (-323.095) -- 0:00:20
Average standard deviation of split frequencies: 0.012771
565500 -- [-324.092] (-322.185) (-320.841) (-328.183) * (-324.607) [-328.909] (-321.244) (-322.788) -- 0:00:19
566000 -- [-321.864] (-323.539) (-322.502) (-322.146) * (-324.367) (-326.865) [-321.576] (-321.473) -- 0:00:19
566500 -- (-321.936) (-322.830) [-322.535] (-322.448) * (-321.825) (-328.378) (-326.877) [-322.155] -- 0:00:19
567000 -- (-321.295) [-322.787] (-323.633) (-325.122) * (-322.491) (-321.844) (-322.971) [-321.292] -- 0:00:19
567500 -- [-327.799] (-321.667) (-322.851) (-322.905) * (-325.049) (-322.509) (-321.322) [-321.409] -- 0:00:19
568000 -- (-323.945) (-325.558) (-321.137) [-321.835] * (-320.874) [-321.998] (-325.556) (-322.829) -- 0:00:19
568500 -- (-325.936) (-324.370) (-323.171) [-322.055] * (-324.296) (-320.706) (-323.727) [-322.785] -- 0:00:19
569000 -- (-323.167) (-322.289) (-320.779) [-322.346] * (-323.399) (-320.953) [-321.776] (-324.790) -- 0:00:19
569500 -- (-323.096) [-322.674] (-322.608) (-321.348) * (-322.084) (-330.738) (-324.891) [-322.725] -- 0:00:19
570000 -- (-321.659) [-321.495] (-322.514) (-321.349) * [-322.760] (-325.153) (-324.937) (-321.393) -- 0:00:19
Average standard deviation of split frequencies: 0.012116
570500 -- (-323.703) [-322.192] (-323.391) (-325.730) * (-323.706) (-322.947) [-320.869] (-323.918) -- 0:00:19
571000 -- (-321.136) (-324.714) [-322.609] (-322.888) * (-325.361) (-323.844) (-322.695) [-324.305] -- 0:00:19
571500 -- [-322.179] (-320.815) (-322.474) (-324.551) * (-322.748) (-324.313) [-321.899] (-325.294) -- 0:00:19
572000 -- [-321.960] (-321.987) (-322.377) (-324.730) * (-326.791) [-323.309] (-320.857) (-325.205) -- 0:00:19
572500 -- (-321.176) (-323.157) (-322.235) [-323.136] * [-321.227] (-325.926) (-323.730) (-326.462) -- 0:00:19
573000 -- (-324.761) [-325.199] (-321.641) (-322.313) * (-321.892) (-323.593) [-324.589] (-323.560) -- 0:00:19
573500 -- (-325.551) (-323.467) [-321.925] (-323.578) * (-322.859) (-321.908) [-325.437] (-322.302) -- 0:00:19
574000 -- (-322.093) (-322.226) (-324.630) [-324.112] * (-323.992) (-322.521) (-322.819) [-324.312] -- 0:00:19
574500 -- [-322.348] (-325.731) (-326.146) (-321.019) * [-323.694] (-323.335) (-323.274) (-323.372) -- 0:00:19
575000 -- (-320.956) (-322.587) (-324.613) [-322.289] * (-323.402) [-321.183] (-323.138) (-322.856) -- 0:00:19
Average standard deviation of split frequencies: 0.011458
575500 -- (-322.642) (-322.663) (-322.305) [-322.172] * (-322.412) (-321.870) [-324.189] (-322.846) -- 0:00:19
576000 -- (-322.896) (-323.659) (-322.521) [-324.135] * (-323.509) [-321.645] (-321.403) (-320.894) -- 0:00:19
576500 -- [-323.864] (-320.913) (-321.109) (-323.205) * (-321.460) (-324.852) [-324.234] (-320.901) -- 0:00:19
577000 -- [-323.771] (-325.604) (-324.707) (-323.421) * (-323.148) [-322.691] (-322.259) (-322.751) -- 0:00:19
577500 -- (-327.133) (-322.345) [-323.428] (-321.717) * (-323.312) [-321.385] (-323.129) (-324.003) -- 0:00:19
578000 -- [-325.322] (-321.410) (-325.182) (-323.343) * (-321.629) (-322.118) (-322.787) [-322.352] -- 0:00:18
578500 -- (-323.102) (-324.784) (-323.762) [-322.813] * (-325.251) [-322.308] (-322.897) (-323.879) -- 0:00:18
579000 -- (-323.667) (-325.950) (-321.581) [-322.596] * (-322.430) (-322.858) (-321.539) [-323.228] -- 0:00:19
579500 -- (-321.447) (-322.583) (-322.030) [-323.853] * (-325.020) (-323.276) [-322.505] (-321.536) -- 0:00:19
580000 -- (-326.201) [-321.473] (-323.168) (-321.609) * (-321.701) (-322.912) (-325.004) [-323.332] -- 0:00:19
Average standard deviation of split frequencies: 0.012448
580500 -- (-323.185) (-330.857) (-327.040) [-322.422] * [-320.743] (-320.890) (-323.172) (-322.622) -- 0:00:19
581000 -- (-323.196) (-325.341) [-326.190] (-325.612) * (-322.032) [-321.186] (-321.730) (-326.423) -- 0:00:19
581500 -- [-322.044] (-321.415) (-320.775) (-321.020) * (-324.896) (-324.433) [-323.867] (-323.232) -- 0:00:19
582000 -- (-324.707) (-322.989) [-321.329] (-323.192) * (-323.827) [-322.806] (-326.830) (-322.488) -- 0:00:19
582500 -- (-327.395) [-324.889] (-322.891) (-332.333) * (-322.503) [-323.762] (-320.607) (-320.978) -- 0:00:19
583000 -- (-323.192) (-322.585) [-326.288] (-321.754) * (-322.174) (-322.599) (-322.444) [-323.485] -- 0:00:19
583500 -- (-322.451) (-321.507) [-323.085] (-323.523) * (-328.335) [-322.542] (-326.089) (-321.982) -- 0:00:19
584000 -- (-326.895) (-322.151) (-323.906) [-322.485] * (-328.688) [-322.465] (-321.656) (-322.375) -- 0:00:19
584500 -- (-321.690) [-322.364] (-322.361) (-321.190) * (-322.308) [-325.920] (-322.149) (-322.047) -- 0:00:19
585000 -- (-322.228) (-323.587) (-324.521) [-323.329] * (-322.836) [-321.545] (-322.978) (-321.598) -- 0:00:19
Average standard deviation of split frequencies: 0.011262
585500 -- (-322.340) (-325.640) (-323.076) [-323.505] * (-322.575) (-326.178) (-325.346) [-322.126] -- 0:00:19
586000 -- (-324.271) (-324.271) [-321.743] (-321.695) * (-327.028) [-324.065] (-324.035) (-323.243) -- 0:00:19
586500 -- (-322.089) [-321.851] (-322.407) (-323.310) * [-323.756] (-322.099) (-329.405) (-322.231) -- 0:00:19
587000 -- (-322.057) (-325.061) (-322.832) [-321.043] * [-325.603] (-325.746) (-329.375) (-322.629) -- 0:00:18
587500 -- (-324.701) [-322.167] (-322.883) (-322.168) * (-323.536) [-324.243] (-321.242) (-323.010) -- 0:00:18
588000 -- [-322.233] (-320.969) (-323.327) (-321.406) * (-321.242) (-322.938) (-322.750) [-322.466] -- 0:00:18
588500 -- (-322.645) (-321.597) (-321.847) [-327.184] * (-321.611) [-322.018] (-324.414) (-323.317) -- 0:00:18
589000 -- [-320.499] (-323.622) (-322.540) (-321.807) * [-321.332] (-323.893) (-324.357) (-323.923) -- 0:00:18
589500 -- [-321.502] (-323.138) (-321.487) (-320.652) * [-321.748] (-323.494) (-322.705) (-325.856) -- 0:00:18
590000 -- (-322.366) (-324.381) [-324.917] (-324.803) * (-325.049) [-323.587] (-325.428) (-324.228) -- 0:00:18
Average standard deviation of split frequencies: 0.011173
590500 -- [-323.245] (-321.395) (-322.481) (-322.262) * (-322.651) (-323.468) (-325.150) [-320.643] -- 0:00:18
591000 -- (-324.174) (-322.454) [-321.870] (-322.337) * (-321.382) (-323.986) (-323.896) [-323.609] -- 0:00:18
591500 -- (-323.428) (-322.220) [-322.992] (-322.955) * (-322.969) [-323.021] (-322.273) (-322.222) -- 0:00:18
592000 -- (-323.996) [-322.020] (-322.142) (-322.534) * (-323.380) (-326.970) (-326.307) [-321.999] -- 0:00:18
592500 -- (-321.379) (-321.252) [-323.206] (-322.014) * [-324.212] (-324.934) (-321.567) (-321.066) -- 0:00:18
593000 -- (-324.225) (-322.529) (-322.207) [-321.376] * [-324.462] (-321.749) (-322.829) (-324.071) -- 0:00:18
593500 -- (-324.113) [-325.067] (-321.695) (-321.520) * (-324.215) (-323.053) (-322.006) [-324.752] -- 0:00:18
594000 -- [-325.426] (-322.849) (-322.833) (-323.902) * (-322.597) (-324.987) [-324.959] (-329.206) -- 0:00:18
594500 -- (-321.555) [-322.339] (-321.103) (-321.664) * (-328.103) (-332.417) [-324.784] (-326.607) -- 0:00:18
595000 -- (-322.770) (-322.067) [-322.813] (-324.538) * (-320.565) [-322.430] (-322.910) (-320.805) -- 0:00:18
Average standard deviation of split frequencies: 0.012655
595500 -- (-322.761) (-321.519) (-321.440) [-323.205] * (-321.690) (-324.670) (-321.310) [-322.080] -- 0:00:18
596000 -- (-322.678) [-322.192] (-324.622) (-324.177) * (-321.269) [-322.389] (-324.236) (-321.339) -- 0:00:18
596500 -- (-322.184) (-324.834) (-321.137) [-321.871] * (-325.241) [-326.949] (-323.049) (-324.324) -- 0:00:18
597000 -- (-322.744) (-322.191) (-321.875) [-323.541] * [-323.557] (-326.999) (-321.427) (-322.783) -- 0:00:18
597500 -- (-324.100) (-322.555) (-326.061) [-320.549] * [-321.044] (-326.790) (-322.929) (-324.964) -- 0:00:18
598000 -- (-324.011) (-322.111) (-321.921) [-321.185] * (-325.825) (-322.923) [-323.570] (-324.191) -- 0:00:18
598500 -- [-321.652] (-323.114) (-321.819) (-322.114) * (-325.626) [-323.662] (-322.002) (-322.992) -- 0:00:18
599000 -- (-321.488) [-321.029] (-322.036) (-322.787) * (-323.844) [-323.732] (-323.385) (-322.264) -- 0:00:18
599500 -- (-322.106) [-323.190] (-321.396) (-324.198) * (-322.282) (-322.150) [-321.678] (-322.154) -- 0:00:18
600000 -- (-320.878) (-321.778) (-321.368) [-323.942] * (-322.781) [-321.832] (-322.739) (-324.372) -- 0:00:18
Average standard deviation of split frequencies: 0.012034
600500 -- (-321.682) (-324.346) (-323.367) [-322.756] * (-322.017) [-321.491] (-323.791) (-321.771) -- 0:00:17
601000 -- (-321.421) (-323.957) [-322.440] (-322.482) * [-325.043] (-327.340) (-324.459) (-323.236) -- 0:00:17
601500 -- [-321.804] (-327.007) (-321.923) (-322.992) * [-321.122] (-327.527) (-325.141) (-321.441) -- 0:00:18
602000 -- [-323.484] (-324.411) (-321.736) (-321.631) * (-323.865) (-323.814) [-326.645] (-323.832) -- 0:00:18
602500 -- (-322.744) (-326.188) [-321.244] (-324.697) * (-323.411) (-323.992) (-325.122) [-323.155] -- 0:00:18
603000 -- (-323.179) (-324.834) (-320.867) [-326.030] * (-321.028) (-327.704) [-321.065] (-322.000) -- 0:00:18
603500 -- (-322.944) [-322.350] (-320.991) (-322.378) * (-321.651) (-326.178) [-320.821] (-325.044) -- 0:00:18
604000 -- (-323.050) (-321.627) (-322.791) [-321.838] * (-321.828) (-321.692) [-321.833] (-323.667) -- 0:00:18
604500 -- (-320.980) (-324.830) [-323.864] (-322.155) * (-326.353) [-321.798] (-323.285) (-326.323) -- 0:00:18
605000 -- (-324.476) (-321.673) (-325.097) [-320.942] * (-326.521) (-322.090) [-324.717] (-323.624) -- 0:00:18
Average standard deviation of split frequencies: 0.012446
605500 -- (-321.189) (-325.008) (-324.367) [-323.041] * (-321.250) [-321.231] (-325.775) (-322.734) -- 0:00:18
606000 -- (-323.913) (-322.229) [-323.355] (-323.432) * (-321.365) (-322.382) (-324.558) [-322.117] -- 0:00:18
606500 -- (-323.757) (-320.559) [-322.641] (-320.698) * (-326.944) (-322.100) [-322.230] (-323.335) -- 0:00:18
607000 -- (-324.795) (-321.956) [-321.832] (-323.261) * [-327.172] (-323.021) (-323.222) (-321.618) -- 0:00:18
607500 -- (-326.832) (-322.190) [-323.563] (-326.399) * (-321.211) (-325.663) [-323.520] (-325.718) -- 0:00:18
608000 -- (-323.783) (-322.420) [-324.088] (-321.451) * (-323.620) [-323.905] (-323.127) (-323.531) -- 0:00:18
608500 -- (-323.273) (-322.377) [-320.761] (-321.246) * (-323.086) (-324.233) (-322.508) [-322.258] -- 0:00:18
609000 -- (-324.476) (-323.997) (-327.054) [-321.297] * [-323.399] (-321.827) (-320.931) (-321.243) -- 0:00:17
609500 -- [-325.076] (-321.824) (-323.422) (-321.741) * (-325.009) (-324.865) (-323.207) [-322.219] -- 0:00:17
610000 -- (-323.857) (-322.677) (-330.725) [-325.211] * [-323.248] (-321.345) (-323.535) (-328.337) -- 0:00:17
Average standard deviation of split frequencies: 0.012351
610500 -- (-323.251) (-322.087) [-326.147] (-321.482) * (-323.788) [-322.715] (-322.144) (-325.859) -- 0:00:17
611000 -- [-321.507] (-321.786) (-324.308) (-325.064) * (-324.672) [-321.332] (-325.432) (-327.077) -- 0:00:17
611500 -- (-322.127) (-323.013) (-321.437) [-326.449] * (-322.266) [-321.145] (-323.980) (-321.679) -- 0:00:17
612000 -- (-323.579) [-322.849] (-322.983) (-323.364) * (-325.075) (-321.581) [-323.658] (-321.989) -- 0:00:17
612500 -- [-322.938] (-322.791) (-321.722) (-322.252) * [-324.545] (-322.613) (-325.184) (-322.231) -- 0:00:17
613000 -- (-323.214) [-324.904] (-322.270) (-322.286) * (-323.725) (-321.579) (-321.115) [-323.256] -- 0:00:17
613500 -- (-323.458) (-321.786) (-323.787) [-321.844] * (-322.723) (-320.840) [-322.266] (-322.973) -- 0:00:17
614000 -- (-323.711) [-321.870] (-322.796) (-323.312) * (-320.763) (-321.561) [-323.016] (-322.963) -- 0:00:17
614500 -- (-320.655) (-326.003) [-322.491] (-325.554) * (-320.855) (-322.067) [-321.280] (-321.669) -- 0:00:17
615000 -- (-322.904) (-326.955) (-324.275) [-327.782] * (-324.602) [-323.405] (-322.451) (-322.934) -- 0:00:17
Average standard deviation of split frequencies: 0.011734
615500 -- (-321.427) (-325.899) (-323.495) [-321.867] * (-322.552) (-324.265) (-323.551) [-321.740] -- 0:00:17
616000 -- (-322.554) (-326.130) (-322.844) [-326.219] * [-322.380] (-324.052) (-322.965) (-320.656) -- 0:00:17
616500 -- (-324.915) [-325.827] (-323.009) (-325.167) * (-327.079) (-322.290) (-323.010) [-322.489] -- 0:00:17
617000 -- (-322.155) (-322.950) (-320.744) [-320.851] * (-323.609) (-323.914) (-322.880) [-323.330] -- 0:00:17
617500 -- [-320.765] (-322.997) (-320.786) (-320.923) * [-324.698] (-324.775) (-323.650) (-323.404) -- 0:00:17
618000 -- (-322.714) [-322.584] (-322.873) (-323.957) * (-323.864) (-321.342) [-322.293] (-321.626) -- 0:00:17
618500 -- [-321.590] (-325.141) (-321.859) (-322.624) * (-322.915) [-322.309] (-324.629) (-321.186) -- 0:00:17
619000 -- (-320.999) (-320.918) (-321.238) [-322.206] * [-324.316] (-322.393) (-326.936) (-323.750) -- 0:00:17
619500 -- (-320.848) [-321.551] (-321.695) (-329.378) * (-322.509) (-322.787) (-322.995) [-322.404] -- 0:00:17
620000 -- (-321.686) [-323.872] (-323.931) (-323.589) * [-321.678] (-326.318) (-321.236) (-324.099) -- 0:00:17
Average standard deviation of split frequencies: 0.012659
620500 -- (-323.612) (-326.965) [-321.116] (-327.075) * (-322.738) [-322.694] (-320.928) (-321.342) -- 0:00:17
621000 -- [-322.158] (-320.939) (-321.527) (-321.266) * [-323.329] (-322.799) (-324.775) (-321.261) -- 0:00:17
621500 -- (-324.241) (-322.928) [-320.851] (-323.563) * (-321.482) (-321.636) (-320.877) [-326.505] -- 0:00:17
622000 -- [-327.327] (-321.322) (-321.070) (-322.038) * (-322.568) (-321.165) (-322.074) [-321.710] -- 0:00:17
622500 -- (-324.327) (-322.523) [-321.403] (-321.918) * (-323.789) (-323.387) (-323.064) [-323.407] -- 0:00:16
623000 -- (-321.125) [-322.648] (-322.685) (-323.904) * [-325.004] (-321.918) (-321.897) (-323.992) -- 0:00:16
623500 -- (-323.779) (-321.242) (-322.455) [-325.032] * [-320.766] (-323.111) (-321.393) (-324.074) -- 0:00:16
624000 -- (-321.618) (-323.822) [-321.275] (-324.676) * (-326.798) [-321.016] (-323.221) (-320.898) -- 0:00:16
624500 -- (-321.130) [-323.630] (-324.508) (-320.789) * (-325.459) (-323.499) (-320.929) [-321.746] -- 0:00:17
625000 -- [-323.876] (-326.225) (-322.262) (-321.603) * [-323.591] (-322.743) (-324.765) (-324.787) -- 0:00:17
Average standard deviation of split frequencies: 0.013555
625500 -- (-320.989) (-323.400) (-324.398) [-321.524] * [-322.566] (-325.050) (-322.405) (-323.242) -- 0:00:17
626000 -- (-327.482) [-322.274] (-324.001) (-322.712) * (-320.537) [-321.658] (-321.194) (-323.182) -- 0:00:17
626500 -- [-321.632] (-323.548) (-322.224) (-321.542) * (-322.967) (-326.369) (-322.748) [-325.384] -- 0:00:17
627000 -- (-324.027) [-324.391] (-321.354) (-322.284) * (-322.916) (-325.117) (-324.018) [-322.275] -- 0:00:17
627500 -- (-324.467) (-322.046) [-321.558] (-322.561) * (-323.122) (-323.647) (-324.799) [-323.545] -- 0:00:17
628000 -- (-324.824) [-321.642] (-322.901) (-330.138) * (-321.122) (-322.646) [-323.684] (-323.455) -- 0:00:17
628500 -- (-322.510) (-323.243) (-321.109) [-321.614] * (-323.205) [-320.807] (-324.144) (-327.526) -- 0:00:17
629000 -- [-323.114] (-321.655) (-323.633) (-321.082) * [-321.502] (-321.793) (-321.317) (-323.845) -- 0:00:17
629500 -- (-321.524) [-321.093] (-325.254) (-322.490) * (-322.225) (-321.320) (-324.261) [-323.254] -- 0:00:17
630000 -- (-320.585) (-322.034) (-323.308) [-322.202] * (-322.414) (-321.957) (-322.250) [-322.680] -- 0:00:17
Average standard deviation of split frequencies: 0.012956
630500 -- (-322.438) (-322.321) (-326.489) [-321.336] * (-321.464) [-321.675] (-325.991) (-323.408) -- 0:00:16
631000 -- (-323.961) [-321.497] (-324.726) (-323.658) * (-322.251) [-322.441] (-324.251) (-322.276) -- 0:00:16
631500 -- (-323.647) (-324.869) (-324.854) [-322.047] * (-322.943) (-321.709) [-326.052] (-322.752) -- 0:00:16
632000 -- [-324.327] (-322.909) (-321.580) (-323.019) * [-327.344] (-321.441) (-322.196) (-321.750) -- 0:00:16
632500 -- (-324.117) (-324.856) (-321.315) [-322.680] * (-325.737) (-324.068) [-323.567] (-321.730) -- 0:00:16
633000 -- [-324.089] (-323.733) (-321.446) (-322.085) * (-323.662) (-322.510) (-325.387) [-325.919] -- 0:00:16
633500 -- [-321.856] (-322.898) (-321.277) (-324.595) * (-323.672) (-322.373) [-323.757] (-323.251) -- 0:00:16
634000 -- [-321.674] (-326.214) (-322.303) (-321.627) * (-324.328) [-321.374] (-323.336) (-322.042) -- 0:00:16
634500 -- [-321.914] (-323.368) (-321.995) (-323.265) * (-323.289) [-321.718] (-322.765) (-322.654) -- 0:00:16
635000 -- (-324.217) (-321.723) (-324.061) [-322.906] * (-325.083) (-324.463) (-326.703) [-320.931] -- 0:00:16
Average standard deviation of split frequencies: 0.011859
635500 -- (-322.280) (-322.239) [-325.056] (-324.265) * [-324.587] (-321.873) (-324.197) (-321.895) -- 0:00:16
636000 -- (-325.820) [-322.263] (-321.893) (-329.380) * (-322.776) (-321.272) [-321.899] (-321.676) -- 0:00:16
636500 -- (-323.065) (-322.527) (-321.409) [-325.214] * (-323.719) [-322.061] (-321.233) (-323.555) -- 0:00:16
637000 -- (-323.945) [-322.175] (-326.199) (-321.183) * (-324.879) (-326.074) (-322.980) [-326.118] -- 0:00:16
637500 -- (-321.349) [-321.655] (-327.677) (-321.556) * (-322.164) [-321.709] (-321.783) (-324.499) -- 0:00:16
638000 -- [-321.115] (-324.088) (-328.380) (-322.535) * (-322.116) (-321.535) (-322.980) [-324.682] -- 0:00:16
638500 -- (-322.390) (-324.769) (-323.087) [-322.625] * (-323.194) [-321.924] (-324.506) (-323.633) -- 0:00:16
639000 -- (-320.853) (-328.913) (-326.383) [-321.832] * (-322.766) (-321.212) (-324.590) [-329.797] -- 0:00:16
639500 -- [-322.463] (-321.749) (-323.800) (-322.504) * (-321.218) (-323.439) [-321.446] (-324.547) -- 0:00:16
640000 -- (-321.330) (-322.295) [-323.573] (-321.860) * (-322.432) (-322.659) (-321.426) [-324.208] -- 0:00:16
Average standard deviation of split frequencies: 0.011282
640500 -- [-320.768] (-321.268) (-328.172) (-321.581) * (-321.815) (-327.571) (-321.362) [-320.771] -- 0:00:16
641000 -- (-320.760) (-322.962) (-323.400) [-320.811] * (-322.285) [-323.094] (-322.127) (-323.569) -- 0:00:16
641500 -- [-320.577] (-321.450) (-324.033) (-324.572) * [-323.998] (-322.946) (-320.796) (-322.247) -- 0:00:16
642000 -- (-322.363) (-322.398) (-321.783) [-324.278] * (-321.782) [-321.643] (-324.325) (-324.528) -- 0:00:16
642500 -- (-321.423) (-324.312) (-324.046) [-322.670] * (-323.451) [-323.584] (-322.562) (-323.769) -- 0:00:16
643000 -- (-320.475) (-321.319) [-321.357] (-322.824) * [-321.927] (-320.981) (-321.969) (-321.483) -- 0:00:16
643500 -- (-323.791) (-323.721) [-320.602] (-323.078) * [-323.529] (-322.247) (-321.539) (-320.833) -- 0:00:16
644000 -- (-333.255) (-322.135) [-321.268] (-322.812) * (-321.966) [-321.582] (-321.725) (-321.864) -- 0:00:16
644500 -- [-325.131] (-322.526) (-321.991) (-322.020) * (-325.897) (-328.295) (-322.670) [-321.674] -- 0:00:15
645000 -- (-324.502) (-323.830) [-322.290] (-322.230) * [-324.878] (-325.368) (-328.392) (-322.906) -- 0:00:15
Average standard deviation of split frequencies: 0.012162
645500 -- (-322.042) (-324.697) (-321.819) [-325.538] * (-328.186) (-323.798) [-321.404] (-325.108) -- 0:00:15
646000 -- [-321.996] (-326.049) (-324.457) (-327.754) * (-323.611) (-322.094) [-321.699] (-325.666) -- 0:00:15
646500 -- (-325.640) (-324.247) [-324.907] (-327.843) * (-323.325) [-323.280] (-321.742) (-322.427) -- 0:00:15
647000 -- (-322.958) [-321.752] (-328.097) (-320.560) * (-321.572) [-322.215] (-324.466) (-322.578) -- 0:00:15
647500 -- (-323.080) (-322.971) [-322.607] (-328.480) * (-322.578) [-323.213] (-322.868) (-322.345) -- 0:00:16
648000 -- (-321.132) (-322.111) [-323.956] (-323.878) * (-323.939) [-323.774] (-322.825) (-323.050) -- 0:00:16
648500 -- (-326.226) [-322.922] (-322.926) (-322.153) * (-323.875) [-320.991] (-325.123) (-323.072) -- 0:00:16
649000 -- (-323.466) [-322.223] (-323.580) (-322.511) * (-322.001) (-320.890) (-324.053) [-322.341] -- 0:00:16
649500 -- (-324.789) [-321.932] (-323.903) (-321.455) * (-323.865) (-321.398) [-323.772] (-320.755) -- 0:00:16
650000 -- (-323.717) [-321.026] (-323.639) (-323.522) * [-321.632] (-322.925) (-321.693) (-322.397) -- 0:00:16
Average standard deviation of split frequencies: 0.014007
650500 -- (-323.536) [-321.931] (-322.027) (-323.984) * [-321.587] (-322.760) (-322.457) (-324.465) -- 0:00:16
651000 -- (-321.786) (-322.696) [-321.210] (-323.864) * (-321.252) (-324.316) [-322.046] (-322.540) -- 0:00:16
651500 -- (-324.608) (-322.979) [-321.759] (-321.485) * [-321.784] (-321.818) (-323.022) (-323.065) -- 0:00:16
652000 -- [-326.846] (-321.275) (-323.173) (-322.279) * (-323.990) [-320.989] (-325.211) (-321.398) -- 0:00:16
652500 -- [-322.265] (-320.908) (-321.199) (-326.208) * (-324.863) [-322.774] (-321.395) (-322.505) -- 0:00:15
653000 -- (-323.216) [-324.947] (-323.797) (-321.437) * (-322.878) (-326.975) [-322.685] (-321.278) -- 0:00:15
653500 -- (-323.837) (-323.706) (-326.505) [-320.844] * (-324.570) (-322.185) [-323.078] (-324.342) -- 0:00:15
654000 -- (-324.414) (-323.122) (-326.823) [-323.387] * (-322.207) (-322.206) [-322.390] (-320.836) -- 0:00:15
654500 -- (-323.039) (-323.625) (-322.535) [-323.181] * (-321.835) [-322.596] (-322.414) (-323.687) -- 0:00:15
655000 -- [-322.635] (-324.200) (-323.103) (-321.845) * [-320.939] (-321.757) (-325.383) (-321.744) -- 0:00:15
Average standard deviation of split frequencies: 0.012456
655500 -- (-324.106) [-323.472] (-326.870) (-323.803) * (-323.085) [-322.363] (-325.574) (-327.899) -- 0:00:15
656000 -- (-322.989) (-323.416) (-323.512) [-325.512] * [-324.358] (-320.574) (-321.289) (-326.626) -- 0:00:15
656500 -- [-323.374] (-321.596) (-323.313) (-324.139) * (-321.323) (-323.914) [-321.568] (-323.185) -- 0:00:15
657000 -- (-321.242) (-324.371) [-326.585] (-322.437) * [-322.093] (-321.476) (-321.777) (-322.009) -- 0:00:15
657500 -- (-323.015) (-321.868) (-322.676) [-324.798] * [-322.454] (-324.772) (-321.852) (-321.882) -- 0:00:15
658000 -- (-323.143) [-325.313] (-321.162) (-325.335) * (-323.797) (-322.979) (-321.387) [-320.844] -- 0:00:15
658500 -- (-323.244) [-322.802] (-323.213) (-324.500) * (-322.452) (-326.012) (-324.469) [-321.181] -- 0:00:15
659000 -- (-325.249) (-324.070) (-323.628) [-321.361] * (-324.704) [-321.416] (-323.213) (-321.381) -- 0:00:15
659500 -- (-324.410) (-326.524) (-324.901) [-325.325] * (-324.091) [-325.259] (-322.643) (-322.422) -- 0:00:15
660000 -- (-326.124) (-322.693) (-321.401) [-322.703] * (-325.044) (-321.105) (-323.339) [-321.778] -- 0:00:15
Average standard deviation of split frequencies: 0.011892
660500 -- (-323.755) [-324.585] (-323.587) (-322.971) * (-322.872) (-321.857) [-321.550] (-321.627) -- 0:00:15
661000 -- (-322.777) (-322.846) [-324.656] (-327.648) * (-322.462) (-324.150) (-323.258) [-323.200] -- 0:00:15
661500 -- (-321.897) (-322.950) (-321.920) [-322.551] * (-322.454) (-320.719) [-321.964] (-320.986) -- 0:00:15
662000 -- [-322.011] (-333.151) (-326.534) (-322.288) * [-321.124] (-321.811) (-322.275) (-326.201) -- 0:00:15
662500 -- (-321.790) (-322.874) (-322.428) [-321.297] * [-321.979] (-321.874) (-323.367) (-326.517) -- 0:00:15
663000 -- (-325.062) [-321.490] (-326.828) (-322.750) * [-322.544] (-321.383) (-321.640) (-321.877) -- 0:00:15
663500 -- (-327.243) (-322.736) [-325.875] (-322.718) * (-323.955) [-323.066] (-320.845) (-321.313) -- 0:00:15
664000 -- [-323.824] (-326.843) (-323.811) (-321.349) * [-326.194] (-325.039) (-325.166) (-322.244) -- 0:00:15
664500 -- (-323.583) [-324.778] (-320.761) (-321.274) * (-321.840) [-322.896] (-323.096) (-325.109) -- 0:00:15
665000 -- (-327.310) (-324.210) [-324.909] (-323.605) * (-325.966) (-324.151) [-326.949] (-325.921) -- 0:00:15
Average standard deviation of split frequencies: 0.011797
665500 -- (-322.487) [-321.381] (-321.414) (-323.222) * (-323.393) (-321.483) [-321.227] (-326.460) -- 0:00:15
666000 -- (-323.457) (-322.909) (-321.351) [-321.752] * (-322.544) (-320.507) [-325.186] (-325.003) -- 0:00:15
666500 -- (-325.002) [-321.665] (-321.805) (-321.733) * [-320.572] (-324.962) (-321.232) (-323.826) -- 0:00:15
667000 -- (-325.113) (-322.508) [-320.911] (-325.582) * [-322.521] (-320.912) (-321.204) (-326.327) -- 0:00:14
667500 -- (-322.371) (-321.686) [-321.507] (-325.766) * (-322.704) (-322.204) [-323.394] (-322.578) -- 0:00:14
668000 -- (-322.390) [-326.443] (-321.633) (-323.854) * [-322.442] (-324.893) (-321.374) (-323.591) -- 0:00:14
668500 -- (-322.254) (-326.671) (-323.955) [-325.325] * (-323.449) [-321.770] (-320.983) (-324.200) -- 0:00:14
669000 -- (-327.591) (-323.654) [-323.616] (-326.556) * [-321.950] (-320.406) (-326.900) (-322.303) -- 0:00:14
669500 -- (-321.350) (-324.480) [-322.320] (-324.494) * (-322.202) (-321.387) [-321.327] (-322.175) -- 0:00:14
670000 -- (-322.789) [-322.250] (-321.585) (-320.749) * (-321.098) (-322.751) (-325.261) [-325.513] -- 0:00:14
Average standard deviation of split frequencies: 0.010309
670500 -- (-321.642) (-321.750) (-324.220) [-322.933] * (-321.205) [-320.973] (-325.391) (-321.216) -- 0:00:15
671000 -- [-322.110] (-323.344) (-325.630) (-322.727) * (-324.516) (-322.634) (-323.512) [-322.076] -- 0:00:15
671500 -- [-322.403] (-325.484) (-321.147) (-324.177) * [-324.495] (-321.674) (-322.021) (-328.439) -- 0:00:15
672000 -- (-322.551) [-321.038] (-321.955) (-322.585) * [-324.405] (-322.459) (-326.540) (-322.872) -- 0:00:15
672500 -- (-324.809) [-322.070] (-325.647) (-323.869) * (-321.806) [-324.356] (-321.995) (-327.690) -- 0:00:15
673000 -- (-323.686) (-323.588) [-321.188] (-326.635) * (-326.939) (-324.077) [-322.315] (-323.313) -- 0:00:15
673500 -- (-321.186) [-332.704] (-325.918) (-326.519) * (-322.726) [-321.458] (-322.067) (-322.302) -- 0:00:15
674000 -- [-321.841] (-323.693) (-322.066) (-324.184) * (-325.166) (-324.812) (-320.967) [-326.937] -- 0:00:14
674500 -- (-324.279) (-321.537) (-324.521) [-323.932] * (-327.248) (-324.799) [-322.091] (-321.820) -- 0:00:14
675000 -- (-323.355) (-322.301) [-321.456] (-323.943) * (-324.407) [-324.029] (-324.571) (-321.322) -- 0:00:14
Average standard deviation of split frequencies: 0.010693
675500 -- (-323.141) [-324.412] (-322.866) (-323.739) * (-320.508) (-321.346) (-321.442) [-322.154] -- 0:00:14
676000 -- [-322.622] (-321.479) (-321.779) (-324.575) * (-323.162) (-323.008) (-321.610) [-321.642] -- 0:00:14
676500 -- (-320.994) [-321.602] (-324.694) (-322.646) * (-324.386) (-322.446) (-321.995) [-321.486] -- 0:00:14
677000 -- (-320.809) [-320.553] (-322.030) (-322.435) * (-321.552) (-321.497) (-324.027) [-323.350] -- 0:00:14
677500 -- (-320.629) (-323.905) (-323.935) [-321.957] * (-323.116) (-321.833) [-324.878] (-321.942) -- 0:00:14
678000 -- (-321.679) (-324.744) (-322.698) [-322.262] * (-321.416) (-321.937) (-325.609) [-321.502] -- 0:00:14
678500 -- (-321.468) (-328.416) (-321.976) [-323.027] * [-322.268] (-321.838) (-322.279) (-321.254) -- 0:00:14
679000 -- (-324.531) (-323.488) [-321.258] (-325.543) * [-321.535] (-322.173) (-320.944) (-320.803) -- 0:00:14
679500 -- [-322.495] (-321.052) (-333.020) (-325.073) * [-322.283] (-323.638) (-321.210) (-321.173) -- 0:00:14
680000 -- [-321.233] (-320.694) (-322.775) (-323.065) * (-322.945) [-321.705] (-321.198) (-322.226) -- 0:00:14
Average standard deviation of split frequencies: 0.010619
680500 -- (-325.680) (-320.905) (-321.432) [-322.512] * (-324.447) (-322.308) (-322.083) [-328.170] -- 0:00:14
681000 -- (-324.506) (-321.857) [-322.549] (-323.294) * (-323.190) (-323.164) (-324.534) [-321.709] -- 0:00:14
681500 -- (-327.540) [-322.139] (-322.750) (-325.500) * (-323.976) (-325.928) [-323.664] (-321.704) -- 0:00:14
682000 -- (-321.425) (-322.613) [-321.777] (-321.950) * (-321.656) (-322.655) [-324.961] (-321.222) -- 0:00:14
682500 -- (-321.387) (-324.468) (-325.550) [-327.225] * (-320.711) [-325.090] (-322.951) (-326.548) -- 0:00:14
683000 -- [-322.230] (-321.513) (-327.113) (-327.195) * [-321.867] (-323.177) (-322.780) (-326.333) -- 0:00:14
683500 -- (-321.570) (-321.687) [-321.052] (-322.382) * (-322.014) (-322.589) [-322.351] (-327.052) -- 0:00:14
684000 -- (-326.631) (-321.587) [-322.840] (-322.325) * (-324.407) [-325.418] (-321.750) (-325.175) -- 0:00:14
684500 -- (-324.151) [-322.451] (-322.060) (-322.481) * [-321.780] (-322.912) (-322.666) (-327.127) -- 0:00:14
685000 -- (-325.284) (-321.851) [-321.333] (-324.034) * (-323.380) [-325.141] (-324.956) (-326.158) -- 0:00:14
Average standard deviation of split frequencies: 0.009621
685500 -- (-325.165) [-325.961] (-321.922) (-322.788) * (-324.434) (-323.997) [-320.959] (-320.489) -- 0:00:14
686000 -- [-323.176] (-327.586) (-320.807) (-322.201) * [-321.096] (-329.085) (-322.584) (-320.503) -- 0:00:14
686500 -- (-323.400) [-323.948] (-322.337) (-323.660) * [-323.199] (-325.467) (-323.381) (-323.656) -- 0:00:14
687000 -- [-323.760] (-322.225) (-324.562) (-322.107) * (-321.868) [-321.787] (-322.369) (-325.223) -- 0:00:14
687500 -- (-322.236) (-322.505) (-323.116) [-322.321] * [-324.136] (-325.564) (-321.171) (-322.038) -- 0:00:14
688000 -- (-323.106) (-321.238) (-325.452) [-321.724] * (-323.883) [-322.082] (-322.799) (-321.607) -- 0:00:14
688500 -- (-322.437) [-321.983] (-321.119) (-323.083) * (-325.449) (-321.970) (-324.913) [-322.001] -- 0:00:14
689000 -- (-322.876) [-323.400] (-321.957) (-325.222) * (-324.637) (-322.841) [-324.380] (-322.215) -- 0:00:13
689500 -- (-321.494) [-322.307] (-321.607) (-323.649) * (-322.876) (-321.305) (-324.834) [-321.400] -- 0:00:13
690000 -- [-321.161] (-322.776) (-322.926) (-320.736) * (-329.447) (-321.494) (-320.594) [-320.872] -- 0:00:13
Average standard deviation of split frequencies: 0.007280
690500 -- (-321.076) (-323.078) (-322.662) [-324.366] * (-326.547) (-321.415) [-321.703] (-323.941) -- 0:00:13
691000 -- [-321.400] (-321.944) (-322.986) (-322.031) * (-324.270) (-323.328) (-323.565) [-322.545] -- 0:00:13
691500 -- [-321.719] (-322.743) (-320.769) (-322.344) * (-322.969) (-322.880) [-323.165] (-322.786) -- 0:00:13
692000 -- (-322.156) (-325.714) [-323.574] (-322.449) * (-324.450) (-327.621) [-321.061] (-323.455) -- 0:00:13
692500 -- (-323.682) (-323.276) (-321.692) [-322.922] * (-326.860) [-325.478] (-321.328) (-321.732) -- 0:00:13
693000 -- [-324.028] (-321.465) (-322.505) (-320.827) * (-321.964) (-324.421) (-325.489) [-322.802] -- 0:00:14
693500 -- (-325.757) (-324.052) [-326.450] (-324.591) * [-322.017] (-326.466) (-324.257) (-322.021) -- 0:00:14
694000 -- (-323.599) (-325.227) [-324.414] (-323.899) * (-320.864) [-323.701] (-326.889) (-322.515) -- 0:00:14
694500 -- (-324.196) [-327.750] (-321.731) (-325.352) * [-321.390] (-321.513) (-322.503) (-321.237) -- 0:00:14
695000 -- (-322.199) [-321.220] (-323.728) (-323.647) * (-323.786) [-323.807] (-321.910) (-321.586) -- 0:00:14
Average standard deviation of split frequencies: 0.006773
695500 -- (-325.186) (-322.487) [-325.598] (-322.597) * [-321.729] (-325.561) (-323.207) (-323.381) -- 0:00:14
696000 -- [-322.648] (-322.428) (-321.430) (-321.939) * (-324.793) [-323.788] (-325.484) (-322.131) -- 0:00:13
696500 -- (-322.475) (-321.949) (-329.749) [-320.908] * [-322.845] (-323.434) (-321.004) (-321.556) -- 0:00:13
697000 -- (-321.471) (-324.451) [-320.722] (-323.016) * [-322.907] (-325.042) (-320.697) (-325.259) -- 0:00:13
697500 -- (-320.954) [-325.237] (-324.668) (-324.691) * (-323.031) (-323.427) [-320.827] (-323.170) -- 0:00:13
698000 -- (-321.788) [-323.281] (-323.827) (-322.266) * (-328.693) (-322.118) (-321.034) [-322.172] -- 0:00:13
698500 -- [-321.513] (-321.270) (-321.958) (-322.446) * (-322.763) (-320.782) [-321.483] (-322.589) -- 0:00:13
699000 -- (-322.603) (-324.211) (-324.432) [-324.012] * [-322.454] (-324.845) (-321.287) (-324.193) -- 0:00:13
699500 -- [-323.796] (-321.060) (-322.213) (-322.250) * [-323.610] (-327.120) (-323.315) (-321.852) -- 0:00:13
700000 -- [-322.573] (-321.981) (-327.173) (-323.173) * [-322.022] (-329.759) (-321.937) (-324.408) -- 0:00:13
Average standard deviation of split frequencies: 0.006728
700500 -- [-321.937] (-322.383) (-322.640) (-322.933) * [-324.190] (-326.108) (-321.102) (-325.961) -- 0:00:13
701000 -- (-322.029) (-323.452) [-321.203] (-323.772) * (-320.729) (-323.600) [-323.541] (-323.625) -- 0:00:13
701500 -- (-322.248) (-324.150) [-322.594] (-326.690) * (-321.735) (-323.329) (-322.160) [-321.625] -- 0:00:13
702000 -- (-322.413) (-326.956) (-322.595) [-325.371] * [-320.643] (-322.399) (-321.391) (-331.944) -- 0:00:13
702500 -- (-323.228) (-322.821) (-322.178) [-321.171] * (-323.688) (-322.135) (-321.701) [-323.341] -- 0:00:13
703000 -- [-326.818] (-324.690) (-322.460) (-321.358) * (-321.673) (-323.368) (-321.303) [-323.310] -- 0:00:13
703500 -- (-323.337) [-329.230] (-323.571) (-323.852) * (-320.560) (-325.021) (-320.909) [-325.792] -- 0:00:13
704000 -- (-322.604) (-323.629) (-325.410) [-322.643] * [-322.724] (-321.652) (-325.053) (-321.741) -- 0:00:13
704500 -- (-323.639) (-327.166) [-322.173] (-323.315) * (-324.842) (-325.091) [-323.748] (-322.077) -- 0:00:13
705000 -- (-323.661) (-326.973) [-322.992] (-321.869) * [-321.853] (-322.624) (-322.719) (-322.903) -- 0:00:13
Average standard deviation of split frequencies: 0.008458
705500 -- (-323.021) [-322.176] (-322.975) (-322.739) * (-321.916) [-323.335] (-321.609) (-327.101) -- 0:00:13
706000 -- (-320.607) [-326.978] (-323.329) (-321.871) * [-322.503] (-321.834) (-322.097) (-321.311) -- 0:00:13
706500 -- (-324.954) (-326.142) (-321.751) [-322.373] * (-322.614) (-324.600) (-321.924) [-326.243] -- 0:00:13
707000 -- (-323.705) (-323.759) (-323.032) [-320.730] * (-324.382) (-324.314) (-321.820) [-326.303] -- 0:00:13
707500 -- (-323.714) (-325.300) (-322.598) [-323.412] * [-322.474] (-326.092) (-322.691) (-323.082) -- 0:00:13
708000 -- (-323.770) (-322.021) (-322.074) [-322.493] * (-324.767) [-325.388] (-323.405) (-322.835) -- 0:00:13
708500 -- (-321.263) (-321.666) (-327.111) [-321.881] * (-324.377) (-323.842) (-321.605) [-323.926] -- 0:00:13
709000 -- (-322.322) [-324.203] (-323.102) (-321.607) * (-325.280) [-323.550] (-322.000) (-323.696) -- 0:00:13
709500 -- (-324.865) (-322.684) (-326.096) [-322.050] * (-323.634) (-321.266) [-321.285] (-324.611) -- 0:00:13
710000 -- (-322.501) [-323.386] (-322.747) (-323.043) * [-324.098] (-323.065) (-323.740) (-326.553) -- 0:00:13
Average standard deviation of split frequencies: 0.007075
710500 -- (-322.526) [-321.135] (-320.647) (-321.133) * (-326.652) (-321.527) (-325.184) [-320.828] -- 0:00:13
711000 -- (-323.466) (-322.182) [-322.442] (-321.381) * (-323.884) (-321.076) [-320.743] (-320.914) -- 0:00:13
711500 -- (-323.826) (-322.035) [-321.074] (-321.335) * (-323.615) (-325.112) (-321.624) [-322.953] -- 0:00:12
712000 -- (-322.050) [-322.486] (-322.850) (-325.348) * (-323.907) (-322.434) (-324.429) [-324.310] -- 0:00:12
712500 -- (-326.569) [-323.289] (-322.486) (-328.985) * (-322.898) [-323.047] (-322.356) (-323.972) -- 0:00:12
713000 -- (-323.191) (-325.033) (-320.678) [-324.388] * (-321.313) (-322.841) [-321.776] (-323.830) -- 0:00:12
713500 -- (-321.265) (-323.795) [-321.456] (-322.296) * (-322.197) (-321.484) (-323.156) [-322.192] -- 0:00:12
714000 -- (-321.752) (-323.827) [-331.020] (-322.955) * [-321.742] (-323.247) (-321.768) (-325.575) -- 0:00:12
714500 -- (-322.255) [-322.455] (-328.205) (-321.135) * (-322.142) (-321.581) [-322.888] (-323.721) -- 0:00:12
715000 -- (-323.772) (-324.547) (-321.959) [-321.232] * [-322.408] (-323.111) (-326.214) (-322.998) -- 0:00:12
Average standard deviation of split frequencies: 0.006145
715500 -- (-323.223) [-323.420] (-321.552) (-320.905) * (-322.791) (-322.377) [-324.227] (-329.431) -- 0:00:13
716000 -- (-321.517) (-323.004) (-327.029) [-323.604] * [-322.138] (-322.772) (-324.570) (-321.008) -- 0:00:13
716500 -- (-322.576) (-324.942) [-321.086] (-324.643) * (-324.268) (-321.429) (-323.609) [-325.170] -- 0:00:13
717000 -- (-322.002) [-322.103] (-323.326) (-323.371) * [-322.238] (-323.885) (-321.981) (-324.008) -- 0:00:13
717500 -- (-322.387) (-322.714) [-324.013] (-324.378) * (-321.476) (-321.090) [-322.651] (-321.841) -- 0:00:12
718000 -- (-322.357) [-321.519] (-324.814) (-323.622) * [-321.864] (-322.661) (-323.244) (-323.185) -- 0:00:12
718500 -- [-320.992] (-321.815) (-322.651) (-322.064) * [-323.396] (-321.575) (-326.258) (-320.927) -- 0:00:12
719000 -- [-320.884] (-320.715) (-322.656) (-322.351) * [-322.636] (-322.369) (-325.687) (-321.935) -- 0:00:12
719500 -- (-323.954) (-322.769) [-324.804] (-321.029) * (-326.407) [-322.060] (-321.042) (-324.481) -- 0:00:12
720000 -- [-324.448] (-321.755) (-322.507) (-323.580) * (-323.392) (-323.519) (-323.411) [-323.151] -- 0:00:12
Average standard deviation of split frequencies: 0.007413
720500 -- (-323.419) [-324.346] (-324.517) (-325.092) * [-322.976] (-323.239) (-321.944) (-326.097) -- 0:00:12
721000 -- (-324.013) (-321.305) [-322.950] (-322.469) * (-321.596) (-324.224) [-322.181] (-323.620) -- 0:00:12
721500 -- (-324.535) [-321.420] (-323.130) (-324.133) * (-326.152) (-323.548) (-324.006) [-322.085] -- 0:00:12
722000 -- (-322.547) (-322.379) [-322.577] (-323.402) * (-325.757) (-329.210) [-322.365] (-322.993) -- 0:00:12
722500 -- (-326.044) (-324.082) [-327.117] (-322.694) * (-322.069) [-322.391] (-324.548) (-324.144) -- 0:00:12
723000 -- [-323.042] (-324.281) (-324.561) (-321.204) * [-321.188] (-323.259) (-322.005) (-323.360) -- 0:00:12
723500 -- (-325.751) [-323.812] (-323.289) (-331.821) * [-321.989] (-323.862) (-324.058) (-322.436) -- 0:00:12
724000 -- (-322.990) (-322.491) [-322.245] (-323.144) * (-321.537) (-325.004) [-322.663] (-322.173) -- 0:00:12
724500 -- (-327.937) (-327.635) (-321.426) [-321.464] * (-324.021) [-322.502] (-325.161) (-325.348) -- 0:00:12
725000 -- [-323.749] (-322.365) (-323.811) (-322.099) * (-320.980) (-327.542) (-322.057) [-322.094] -- 0:00:12
Average standard deviation of split frequencies: 0.007792
725500 -- (-321.947) (-321.190) (-322.178) [-322.422] * (-321.061) [-322.612] (-323.650) (-324.384) -- 0:00:12
726000 -- (-321.938) [-326.245] (-321.738) (-323.228) * (-322.141) (-327.632) (-324.574) [-323.746] -- 0:00:12
726500 -- [-325.565] (-325.150) (-325.806) (-324.808) * [-326.048] (-321.502) (-324.316) (-322.296) -- 0:00:12
727000 -- (-324.502) (-324.280) (-323.861) [-323.245] * (-322.938) (-323.978) (-325.123) [-321.563] -- 0:00:12
727500 -- (-324.173) (-322.955) (-322.693) [-320.610] * (-323.628) [-322.789] (-324.714) (-321.186) -- 0:00:12
728000 -- (-322.067) [-322.853] (-322.290) (-321.548) * (-320.408) [-322.370] (-322.110) (-323.974) -- 0:00:12
728500 -- (-320.418) (-322.328) (-324.359) [-320.881] * (-321.082) [-321.950] (-322.059) (-320.660) -- 0:00:12
729000 -- (-322.950) (-322.434) [-323.377] (-321.956) * (-321.864) (-321.521) [-321.411] (-326.479) -- 0:00:12
729500 -- [-324.335] (-323.186) (-328.882) (-321.148) * (-321.177) (-322.286) (-322.581) [-321.044] -- 0:00:12
730000 -- (-325.654) [-322.434] (-324.985) (-321.051) * (-324.860) (-322.306) (-324.280) [-326.622] -- 0:00:12
Average standard deviation of split frequencies: 0.006022
730500 -- [-325.492] (-323.527) (-325.741) (-321.158) * (-325.901) (-321.026) (-322.047) [-331.199] -- 0:00:12
731000 -- (-324.950) (-321.763) [-323.827] (-325.714) * (-322.601) [-321.429] (-326.577) (-324.431) -- 0:00:12
731500 -- [-322.660] (-322.852) (-322.976) (-324.713) * [-323.391] (-322.054) (-327.124) (-326.600) -- 0:00:12
732000 -- (-322.274) (-322.304) (-324.418) [-329.920] * (-321.079) [-325.772] (-322.257) (-323.481) -- 0:00:12
732500 -- (-323.082) (-323.817) (-326.205) [-324.254] * (-321.631) (-322.661) [-321.282] (-328.230) -- 0:00:12
733000 -- [-322.055] (-323.023) (-321.439) (-321.918) * (-321.633) (-323.103) (-323.778) [-322.117] -- 0:00:12
733500 -- (-323.100) [-322.003] (-323.657) (-320.894) * (-322.899) (-324.936) (-324.289) [-322.538] -- 0:00:11
734000 -- (-332.074) (-322.628) [-322.142] (-320.772) * (-324.090) (-327.742) (-323.339) [-324.214] -- 0:00:11
734500 -- [-323.803] (-321.989) (-324.818) (-320.789) * (-324.792) [-326.232] (-323.067) (-324.985) -- 0:00:11
735000 -- (-325.068) [-320.700] (-322.947) (-322.346) * (-321.256) (-325.128) [-321.581] (-322.407) -- 0:00:11
Average standard deviation of split frequencies: 0.004697
735500 -- [-320.760] (-321.947) (-327.738) (-323.472) * (-322.310) (-322.937) [-321.851] (-320.370) -- 0:00:11
736000 -- (-321.090) (-320.750) (-325.841) [-326.498] * [-321.014] (-321.842) (-322.166) (-321.254) -- 0:00:11
736500 -- (-321.594) [-320.995] (-322.627) (-323.376) * [-320.710] (-325.245) (-320.777) (-322.411) -- 0:00:11
737000 -- (-320.871) [-321.713] (-322.551) (-323.426) * (-320.874) (-322.449) [-321.029] (-322.997) -- 0:00:11
737500 -- (-322.259) (-326.520) [-324.333] (-322.210) * (-323.662) (-322.862) [-321.156] (-324.613) -- 0:00:11
738000 -- (-323.531) (-324.242) [-324.342] (-321.839) * (-325.215) [-322.962] (-321.967) (-325.987) -- 0:00:11
738500 -- (-322.321) [-320.990] (-321.727) (-324.256) * [-322.238] (-323.199) (-323.818) (-322.972) -- 0:00:12
739000 -- (-321.372) (-320.887) (-323.992) [-322.724] * (-321.521) (-325.766) (-323.955) [-321.568] -- 0:00:12
739500 -- (-322.286) (-325.563) [-323.461] (-322.617) * [-322.046] (-323.178) (-320.394) (-325.654) -- 0:00:11
740000 -- (-323.962) [-326.814] (-322.124) (-322.732) * [-323.448] (-320.951) (-323.793) (-323.071) -- 0:00:11
Average standard deviation of split frequencies: 0.004243
740500 -- (-321.662) (-324.968) [-322.536] (-322.625) * [-322.936] (-320.853) (-324.099) (-324.102) -- 0:00:11
741000 -- [-321.652] (-322.548) (-322.680) (-320.890) * (-323.434) [-321.878] (-321.635) (-326.302) -- 0:00:11
741500 -- (-325.012) [-322.184] (-323.031) (-321.726) * (-326.022) [-326.178] (-324.609) (-327.012) -- 0:00:11
742000 -- (-322.633) (-320.446) (-323.225) [-323.519] * (-322.969) (-328.394) (-323.091) [-330.852] -- 0:00:11
742500 -- [-321.202] (-324.248) (-322.372) (-323.792) * (-323.180) (-329.672) [-323.238] (-325.252) -- 0:00:11
743000 -- (-322.114) (-323.381) (-323.256) [-321.563] * (-322.478) [-325.288] (-325.953) (-324.749) -- 0:00:11
743500 -- (-324.621) (-324.855) [-322.980] (-320.774) * [-327.914] (-322.378) (-322.615) (-324.198) -- 0:00:11
744000 -- (-322.365) [-326.391] (-325.280) (-321.659) * (-323.257) (-325.533) [-321.486] (-325.145) -- 0:00:11
744500 -- (-321.730) [-326.578] (-325.171) (-322.916) * [-324.890] (-324.770) (-321.938) (-326.250) -- 0:00:11
745000 -- (-323.590) (-327.995) (-323.587) [-321.818] * (-327.676) (-321.365) [-322.380] (-325.826) -- 0:00:11
Average standard deviation of split frequencies: 0.004213
745500 -- (-322.487) (-324.226) (-326.227) [-325.915] * [-321.145] (-323.677) (-321.436) (-323.139) -- 0:00:11
746000 -- (-323.937) (-323.188) (-322.509) [-322.706] * (-323.563) (-321.490) (-325.779) [-321.897] -- 0:00:11
746500 -- [-322.134] (-321.698) (-325.366) (-324.251) * [-321.419] (-325.543) (-322.607) (-322.927) -- 0:00:11
747000 -- (-323.898) (-321.575) (-324.645) [-321.101] * (-323.678) [-321.889] (-322.677) (-322.470) -- 0:00:11
747500 -- [-320.969] (-324.876) (-323.601) (-321.954) * (-324.463) [-322.898] (-323.575) (-324.016) -- 0:00:11
748000 -- (-322.614) (-322.834) (-323.403) [-321.934] * (-326.289) [-325.509] (-323.157) (-321.915) -- 0:00:11
748500 -- (-323.137) (-322.601) [-321.618] (-322.208) * [-322.425] (-324.073) (-322.194) (-322.756) -- 0:00:11
749000 -- (-321.121) (-324.019) [-321.617] (-322.617) * (-321.798) (-323.668) (-322.123) [-325.204] -- 0:00:11
749500 -- (-322.262) [-320.599] (-322.390) (-322.308) * [-321.562] (-325.436) (-322.830) (-321.430) -- 0:00:11
750000 -- (-323.498) (-321.831) [-324.613] (-321.483) * (-323.626) (-322.747) [-322.199] (-320.895) -- 0:00:11
Average standard deviation of split frequencies: 0.004187
750500 -- (-323.411) (-324.462) [-324.778] (-323.410) * (-321.680) (-323.000) [-322.388] (-323.183) -- 0:00:11
751000 -- (-321.739) [-324.101] (-323.613) (-322.222) * (-322.876) [-323.174] (-320.856) (-321.117) -- 0:00:11
751500 -- [-324.940] (-327.187) (-322.937) (-322.122) * (-322.159) [-322.119] (-321.049) (-321.460) -- 0:00:11
752000 -- (-322.886) [-321.088] (-327.385) (-324.527) * (-321.847) [-321.641] (-321.407) (-322.419) -- 0:00:11
752500 -- (-324.360) [-324.439] (-325.547) (-323.915) * [-322.126] (-323.724) (-322.992) (-321.897) -- 0:00:11
753000 -- (-324.799) (-327.347) (-325.053) [-323.263] * (-323.089) [-322.326] (-327.460) (-320.708) -- 0:00:11
753500 -- (-322.156) [-322.719] (-322.456) (-322.927) * [-323.687] (-323.361) (-326.576) (-321.553) -- 0:00:11
754000 -- (-322.069) (-322.719) [-322.852] (-324.584) * [-323.541] (-324.813) (-321.873) (-321.516) -- 0:00:11
754500 -- (-323.738) (-323.234) [-321.593] (-321.705) * (-321.165) (-322.133) (-325.968) [-321.682] -- 0:00:11
755000 -- (-321.947) (-322.196) [-322.479] (-323.047) * (-321.734) (-320.852) [-323.115] (-324.697) -- 0:00:11
Average standard deviation of split frequencies: 0.004157
755500 -- [-324.660] (-321.904) (-320.651) (-328.157) * (-321.397) (-321.208) (-326.890) [-322.027] -- 0:00:11
756000 -- (-326.281) (-325.681) [-321.540] (-325.545) * (-322.051) (-321.749) (-321.486) [-326.732] -- 0:00:10
756500 -- (-327.276) (-322.012) [-321.104] (-323.043) * [-322.934] (-320.798) (-322.561) (-323.593) -- 0:00:10
757000 -- (-328.304) [-321.015] (-322.132) (-321.818) * [-324.188] (-321.899) (-322.090) (-324.252) -- 0:00:10
757500 -- (-323.816) (-321.818) (-322.622) [-321.597] * (-326.268) (-321.801) (-323.929) [-321.563] -- 0:00:10
758000 -- [-324.123] (-324.485) (-324.295) (-323.006) * (-322.153) (-321.382) (-322.028) [-324.360] -- 0:00:10
758500 -- (-323.472) (-323.369) (-326.792) [-324.492] * [-321.326] (-322.295) (-322.671) (-324.135) -- 0:00:10
759000 -- (-322.343) [-324.056] (-325.346) (-324.431) * (-320.634) (-324.669) (-325.821) [-321.011] -- 0:00:10
759500 -- (-321.497) (-320.925) [-321.672] (-321.455) * (-321.368) (-328.877) [-322.166] (-322.046) -- 0:00:10
760000 -- (-322.272) [-330.723] (-327.512) (-322.095) * (-325.453) (-320.970) [-321.608] (-322.514) -- 0:00:10
Average standard deviation of split frequencies: 0.004132
760500 -- [-322.842] (-322.339) (-326.848) (-324.545) * (-324.894) (-324.465) (-321.946) [-322.748] -- 0:00:10
761000 -- (-324.980) (-321.429) (-322.201) [-322.501] * [-321.097] (-327.175) (-323.840) (-325.924) -- 0:00:10
761500 -- [-322.158] (-321.308) (-325.732) (-324.556) * [-320.738] (-324.555) (-321.668) (-324.535) -- 0:00:10
762000 -- (-321.375) [-321.209] (-322.739) (-324.097) * (-324.309) (-324.158) [-322.346] (-324.455) -- 0:00:10
762500 -- (-322.995) [-321.790] (-321.156) (-321.908) * (-321.997) (-322.751) (-325.044) [-321.116] -- 0:00:10
763000 -- [-321.731] (-327.146) (-329.574) (-324.947) * (-323.550) (-322.287) (-322.248) [-325.181] -- 0:00:10
763500 -- (-322.207) [-320.942] (-325.547) (-327.015) * (-321.305) (-325.854) [-321.923] (-321.520) -- 0:00:10
764000 -- [-323.009] (-323.085) (-324.227) (-323.858) * (-322.899) (-321.029) (-322.225) [-321.803] -- 0:00:10
764500 -- [-321.656] (-321.872) (-321.097) (-324.315) * [-321.512] (-320.821) (-322.764) (-322.227) -- 0:00:10
765000 -- [-324.084] (-326.624) (-328.079) (-323.276) * [-324.218] (-321.320) (-323.599) (-321.705) -- 0:00:10
Average standard deviation of split frequencies: 0.004923
765500 -- (-327.138) (-326.068) (-326.058) [-322.523] * (-321.747) (-324.785) [-321.763] (-327.274) -- 0:00:10
766000 -- (-322.491) [-322.124] (-323.089) (-321.725) * [-322.564] (-321.393) (-326.456) (-323.665) -- 0:00:10
766500 -- [-325.006] (-321.647) (-322.848) (-321.491) * (-321.266) [-322.443] (-326.741) (-321.697) -- 0:00:10
767000 -- [-321.608] (-320.640) (-322.266) (-322.274) * (-320.944) [-321.146] (-320.868) (-322.272) -- 0:00:10
767500 -- [-323.966] (-321.526) (-321.849) (-321.643) * (-321.679) [-321.253] (-326.112) (-321.622) -- 0:00:10
768000 -- (-322.363) [-321.635] (-323.867) (-321.894) * [-322.866] (-323.418) (-323.126) (-324.501) -- 0:00:10
768500 -- [-321.561] (-323.411) (-322.046) (-324.511) * [-321.259] (-321.897) (-323.386) (-322.421) -- 0:00:10
769000 -- (-326.049) (-326.076) [-325.021] (-324.201) * (-322.480) [-323.708] (-323.681) (-325.412) -- 0:00:10
769500 -- [-323.415] (-321.348) (-322.095) (-321.773) * (-325.694) (-322.474) [-323.323] (-324.794) -- 0:00:10
770000 -- (-328.514) [-321.420] (-322.298) (-321.164) * (-323.405) (-325.204) (-322.814) [-325.135] -- 0:00:10
Average standard deviation of split frequencies: 0.003670
770500 -- [-323.780] (-320.824) (-323.595) (-322.735) * (-325.735) (-324.223) [-321.225] (-321.361) -- 0:00:10
771000 -- (-326.018) (-320.787) (-322.972) [-322.119] * (-323.434) [-323.415] (-324.996) (-322.310) -- 0:00:10
771500 -- (-322.720) (-321.675) [-323.195] (-321.062) * [-324.664] (-322.565) (-321.527) (-325.436) -- 0:00:10
772000 -- (-325.866) (-322.398) (-321.698) [-323.147] * (-324.658) (-322.492) [-320.933] (-322.780) -- 0:00:10
772500 -- [-321.956] (-329.243) (-321.656) (-323.854) * (-324.141) (-322.260) (-323.683) [-321.703] -- 0:00:10
773000 -- (-324.958) (-324.538) [-322.926] (-325.970) * [-323.707] (-324.355) (-321.488) (-322.617) -- 0:00:10
773500 -- (-321.461) (-322.450) (-321.867) [-321.923] * (-322.009) [-322.676] (-320.912) (-322.167) -- 0:00:10
774000 -- (-321.866) [-326.489] (-322.617) (-324.029) * (-326.817) [-321.889] (-321.344) (-324.981) -- 0:00:10
774500 -- (-323.747) [-323.959] (-322.440) (-322.215) * [-322.518] (-322.029) (-325.490) (-323.728) -- 0:00:10
775000 -- (-324.866) [-321.412] (-322.471) (-323.078) * (-325.019) (-324.373) [-321.760] (-322.757) -- 0:00:10
Average standard deviation of split frequencies: 0.003645
775500 -- (-321.259) (-323.057) (-321.912) [-321.108] * (-322.881) (-324.573) [-321.367] (-326.525) -- 0:00:10
776000 -- [-323.746] (-321.533) (-325.524) (-322.522) * (-321.727) (-325.766) (-325.343) [-323.254] -- 0:00:10
776500 -- [-323.018] (-321.355) (-321.767) (-322.897) * (-324.382) (-321.121) (-324.653) [-321.872] -- 0:00:10
777000 -- (-322.024) [-321.337] (-322.149) (-324.075) * (-323.553) [-323.614] (-323.624) (-322.510) -- 0:00:10
777500 -- (-320.755) (-327.852) [-324.713] (-326.335) * (-320.977) (-322.321) (-325.316) [-323.083] -- 0:00:10
778000 -- (-322.797) (-324.298) [-323.395] (-323.537) * (-321.487) (-323.427) (-322.492) [-321.955] -- 0:00:09
778500 -- (-321.889) [-327.152] (-321.385) (-324.285) * (-323.063) [-323.317] (-324.495) (-323.782) -- 0:00:09
779000 -- [-322.276] (-324.479) (-324.348) (-323.806) * [-321.311] (-325.879) (-326.488) (-322.695) -- 0:00:09
779500 -- (-320.752) [-325.654] (-326.194) (-323.426) * (-323.559) (-324.866) (-322.868) [-328.414] -- 0:00:09
780000 -- (-324.262) [-324.368] (-323.616) (-325.851) * (-328.701) (-325.622) (-320.478) [-323.068] -- 0:00:09
Average standard deviation of split frequencies: 0.004026
780500 -- (-322.746) [-324.228] (-324.514) (-323.949) * [-326.254] (-322.167) (-326.778) (-322.130) -- 0:00:09
781000 -- [-324.623] (-321.411) (-324.657) (-321.048) * (-321.037) (-326.496) (-329.653) [-322.818] -- 0:00:09
781500 -- (-324.749) (-324.138) [-321.080] (-322.655) * (-322.168) (-321.380) (-326.183) [-322.534] -- 0:00:09
782000 -- (-327.358) [-321.293] (-320.923) (-322.977) * [-321.710] (-323.437) (-326.596) (-321.984) -- 0:00:09
782500 -- (-324.763) (-324.753) (-321.712) [-322.403] * [-322.703] (-323.634) (-326.842) (-325.099) -- 0:00:09
783000 -- (-323.504) [-321.521] (-328.234) (-324.485) * (-321.975) (-328.190) [-322.664] (-321.307) -- 0:00:09
783500 -- (-324.297) (-321.726) [-322.631] (-323.101) * [-324.275] (-322.718) (-320.946) (-323.216) -- 0:00:09
784000 -- (-326.487) [-320.722] (-323.842) (-321.761) * [-323.001] (-322.372) (-321.282) (-323.013) -- 0:00:09
784500 -- (-322.680) [-321.638] (-322.576) (-322.274) * (-324.168) [-323.638] (-323.455) (-322.180) -- 0:00:09
785000 -- (-321.320) (-323.961) (-327.689) [-321.920] * [-327.700] (-321.713) (-322.921) (-325.197) -- 0:00:09
Average standard deviation of split frequencies: 0.003998
785500 -- [-324.023] (-320.733) (-321.758) (-323.223) * [-321.737] (-323.755) (-321.979) (-321.824) -- 0:00:09
786000 -- (-322.685) [-321.363] (-320.777) (-322.687) * (-323.168) (-322.795) (-325.042) [-324.901] -- 0:00:09
786500 -- (-326.788) [-321.663] (-321.565) (-321.279) * (-326.537) (-322.293) [-323.350] (-323.328) -- 0:00:09
787000 -- (-322.208) [-323.593] (-322.329) (-323.069) * (-323.972) (-326.132) (-323.309) [-325.561] -- 0:00:09
787500 -- [-323.255] (-323.205) (-323.641) (-323.136) * [-322.565] (-321.355) (-321.081) (-321.117) -- 0:00:09
788000 -- (-322.244) (-321.306) (-322.065) [-322.422] * (-323.188) (-320.706) (-321.605) [-320.796] -- 0:00:09
788500 -- (-325.418) (-323.418) [-322.141] (-321.397) * (-322.008) (-324.623) (-323.248) [-323.940] -- 0:00:09
789000 -- (-323.551) (-325.857) (-326.492) [-320.790] * (-323.567) (-321.703) (-322.385) [-327.076] -- 0:00:09
789500 -- [-323.268] (-322.398) (-323.631) (-323.618) * (-324.381) [-320.765] (-322.689) (-322.033) -- 0:00:09
790000 -- [-326.393] (-324.106) (-321.898) (-321.959) * [-326.351] (-322.212) (-321.533) (-323.320) -- 0:00:09
Average standard deviation of split frequencies: 0.005167
790500 -- (-322.683) (-322.525) [-322.667] (-326.307) * (-322.116) (-322.657) [-321.651] (-325.290) -- 0:00:09
791000 -- [-322.391] (-321.942) (-321.166) (-326.380) * (-321.229) [-324.599] (-322.486) (-320.909) -- 0:00:09
791500 -- (-324.963) (-322.794) [-321.706] (-322.773) * (-320.816) [-324.640] (-323.557) (-324.582) -- 0:00:09
792000 -- (-323.306) (-327.532) (-321.809) [-322.156] * (-322.892) (-323.479) (-321.809) [-320.966] -- 0:00:09
792500 -- (-325.243) (-325.858) [-321.501] (-320.912) * (-323.627) [-323.781] (-324.017) (-322.675) -- 0:00:09
793000 -- [-322.735] (-325.029) (-325.185) (-325.128) * (-323.963) (-322.955) (-323.519) [-322.859] -- 0:00:09
793500 -- (-321.649) (-320.704) [-323.768] (-322.192) * (-321.790) [-323.879] (-321.135) (-321.362) -- 0:00:09
794000 -- (-323.882) [-321.052] (-323.090) (-323.222) * (-328.194) (-322.613) [-324.021] (-320.785) -- 0:00:09
794500 -- (-325.185) [-321.903] (-321.359) (-321.597) * (-326.329) (-321.696) (-321.841) [-322.775] -- 0:00:09
795000 -- (-325.234) (-323.366) (-321.039) [-322.512] * (-322.201) [-321.821] (-327.576) (-322.204) -- 0:00:09
Average standard deviation of split frequencies: 0.005527
795500 -- [-323.223] (-323.499) (-320.828) (-321.436) * (-320.967) (-323.339) (-330.658) [-324.102] -- 0:00:09
796000 -- (-321.787) (-325.115) [-322.393] (-322.846) * (-321.273) (-322.104) [-324.299] (-325.444) -- 0:00:09
796500 -- (-321.615) (-321.259) (-325.411) [-323.466] * (-320.484) (-322.739) (-322.959) [-324.110] -- 0:00:09
797000 -- (-322.767) (-321.659) [-322.787] (-323.481) * (-321.951) (-322.877) (-327.881) [-322.426] -- 0:00:09
797500 -- (-324.066) [-321.964] (-325.641) (-324.755) * [-323.659] (-320.471) (-324.340) (-327.585) -- 0:00:09
798000 -- [-323.162] (-320.900) (-325.273) (-323.019) * (-323.146) (-321.078) [-324.282] (-323.431) -- 0:00:09
798500 -- [-329.289] (-322.450) (-327.105) (-325.426) * [-327.166] (-324.112) (-324.066) (-323.527) -- 0:00:09
799000 -- (-322.954) (-323.201) (-323.971) [-321.290] * (-331.096) (-320.452) (-325.066) [-325.544] -- 0:00:09
799500 -- [-323.945] (-322.551) (-321.806) (-324.413) * (-323.995) (-322.639) (-324.069) [-322.581] -- 0:00:09
800000 -- [-325.594] (-322.536) (-321.532) (-322.436) * [-321.371] (-323.976) (-321.860) (-321.632) -- 0:00:09
Average standard deviation of split frequencies: 0.005495
800500 -- (-324.820) [-321.655] (-321.376) (-321.612) * (-331.511) (-323.201) [-322.899] (-321.023) -- 0:00:08
801000 -- [-323.345] (-322.348) (-323.209) (-322.230) * (-324.264) [-322.876] (-321.965) (-322.902) -- 0:00:08
801500 -- (-322.808) [-322.802] (-323.953) (-322.912) * (-327.486) [-322.909] (-322.844) (-325.147) -- 0:00:08
802000 -- (-322.750) [-323.476] (-323.489) (-324.642) * (-323.803) (-322.098) (-322.426) [-321.482] -- 0:00:08
802500 -- [-323.532] (-322.117) (-322.364) (-322.798) * (-323.970) [-321.955] (-322.901) (-321.812) -- 0:00:08
803000 -- [-322.272] (-323.142) (-323.425) (-324.637) * [-324.276] (-324.296) (-320.940) (-324.568) -- 0:00:08
803500 -- [-321.712] (-325.062) (-322.008) (-326.636) * (-322.674) (-321.038) [-323.868] (-324.047) -- 0:00:08
804000 -- [-322.438] (-323.108) (-320.477) (-321.730) * (-322.903) (-326.150) [-324.484] (-321.247) -- 0:00:08
804500 -- (-323.156) (-321.075) [-322.664] (-322.730) * (-321.706) (-324.443) [-321.316] (-321.273) -- 0:00:08
805000 -- (-324.694) [-325.102] (-325.355) (-323.258) * (-326.158) (-322.605) (-321.087) [-322.709] -- 0:00:08
Average standard deviation of split frequencies: 0.005069
805500 -- (-321.489) [-321.896] (-323.486) (-323.014) * [-323.315] (-321.494) (-324.246) (-323.284) -- 0:00:08
806000 -- (-326.766) (-322.156) [-321.176] (-322.572) * (-323.409) (-322.431) [-321.680] (-322.164) -- 0:00:08
806500 -- (-325.301) [-320.465] (-322.229) (-325.712) * (-329.176) (-323.186) [-321.811] (-323.932) -- 0:00:08
807000 -- (-329.433) (-322.484) (-322.461) [-324.060] * (-322.891) [-323.199] (-321.873) (-326.433) -- 0:00:08
807500 -- (-326.136) (-323.571) [-321.100] (-323.955) * (-322.643) (-326.165) (-321.632) [-324.330] -- 0:00:08
808000 -- (-322.428) (-323.944) [-320.997] (-322.805) * (-322.644) (-321.524) [-322.875] (-322.514) -- 0:00:08
808500 -- [-321.712] (-322.185) (-322.369) (-323.196) * (-324.282) (-323.463) [-322.736] (-322.169) -- 0:00:08
809000 -- (-321.473) [-322.945] (-324.783) (-321.579) * [-321.391] (-322.405) (-321.809) (-321.624) -- 0:00:08
809500 -- (-322.144) [-322.414] (-327.425) (-321.480) * (-321.820) [-320.830] (-321.266) (-323.196) -- 0:00:08
810000 -- (-322.313) (-323.790) [-324.236] (-322.093) * (-322.741) (-322.477) (-327.694) [-323.036] -- 0:00:08
Average standard deviation of split frequencies: 0.004652
810500 -- (-322.640) (-323.916) [-323.574] (-321.540) * (-322.907) (-322.438) [-321.801] (-322.931) -- 0:00:08
811000 -- [-322.712] (-322.060) (-324.555) (-322.705) * [-322.446] (-324.556) (-324.598) (-325.033) -- 0:00:08
811500 -- [-323.242] (-323.692) (-322.244) (-323.258) * [-322.559] (-326.241) (-324.837) (-323.870) -- 0:00:08
812000 -- [-322.430] (-323.718) (-326.683) (-325.679) * (-323.144) [-325.008] (-324.949) (-332.523) -- 0:00:08
812500 -- (-321.810) (-322.007) (-323.605) [-322.976] * (-324.334) (-325.645) (-324.507) [-322.374] -- 0:00:08
813000 -- [-322.573] (-324.058) (-322.087) (-327.168) * (-322.853) (-325.619) (-322.740) [-322.110] -- 0:00:08
813500 -- (-322.249) (-328.351) (-321.843) [-323.480] * (-321.954) (-327.422) (-321.923) [-324.321] -- 0:00:08
814000 -- (-324.322) [-321.806] (-324.532) (-324.097) * (-323.243) (-325.165) [-321.412] (-323.953) -- 0:00:08
814500 -- (-321.901) (-324.767) [-321.926] (-321.720) * [-322.164] (-325.023) (-322.768) (-323.294) -- 0:00:08
815000 -- [-323.652] (-325.024) (-321.507) (-321.535) * (-321.136) (-325.123) [-323.714] (-322.828) -- 0:00:08
Average standard deviation of split frequencies: 0.003466
815500 -- (-323.292) [-323.566] (-323.822) (-322.392) * (-323.905) (-323.722) (-321.647) [-321.168] -- 0:00:08
816000 -- (-321.327) [-326.878] (-321.230) (-326.079) * (-325.320) (-324.494) [-321.018] (-324.376) -- 0:00:08
816500 -- (-323.605) [-323.173] (-321.812) (-325.997) * (-323.721) (-324.364) [-320.785] (-322.107) -- 0:00:08
817000 -- (-325.563) (-322.122) [-323.013] (-324.669) * (-325.858) (-320.993) [-324.115] (-324.318) -- 0:00:08
817500 -- [-328.177] (-324.945) (-323.281) (-324.543) * (-321.955) (-323.594) (-326.978) [-321.108] -- 0:00:08
818000 -- [-323.177] (-322.183) (-322.447) (-322.193) * (-323.022) (-325.363) (-321.278) [-326.041] -- 0:00:08
818500 -- (-322.480) (-323.019) (-322.530) [-320.826] * (-323.037) (-322.696) [-321.813] (-321.263) -- 0:00:08
819000 -- (-325.829) (-323.157) (-324.193) [-321.747] * [-323.464] (-323.714) (-320.948) (-326.020) -- 0:00:08
819500 -- [-323.102] (-324.737) (-323.344) (-322.618) * (-322.573) (-324.810) (-323.474) [-322.278] -- 0:00:08
820000 -- (-325.261) (-328.046) (-324.970) [-322.708] * (-325.529) (-321.869) (-324.167) [-322.949] -- 0:00:08
Average standard deviation of split frequencies: 0.003064
820500 -- (-321.477) (-322.491) [-322.033] (-321.411) * (-326.336) (-324.514) (-323.274) [-322.866] -- 0:00:08
821000 -- (-321.678) [-324.071] (-322.320) (-321.360) * (-321.623) (-323.178) [-327.491] (-321.864) -- 0:00:08
821500 -- [-325.571] (-322.373) (-322.128) (-321.152) * [-320.756] (-321.661) (-321.821) (-324.581) -- 0:00:08
822000 -- (-321.407) (-322.462) (-323.093) [-321.264] * (-325.101) (-321.617) [-322.754] (-325.664) -- 0:00:08
822500 -- (-326.778) [-323.159] (-321.783) (-321.749) * (-322.744) (-325.849) (-324.465) [-325.806] -- 0:00:07
823000 -- [-322.690] (-325.974) (-322.854) (-322.571) * (-323.355) (-325.381) (-323.145) [-322.689] -- 0:00:07
823500 -- (-321.998) (-323.984) (-324.251) [-322.215] * [-322.740] (-322.976) (-324.584) (-322.802) -- 0:00:07
824000 -- (-322.102) [-320.740] (-322.873) (-323.349) * (-320.418) (-321.223) [-321.398] (-321.754) -- 0:00:07
824500 -- [-321.065] (-323.365) (-327.673) (-322.350) * [-322.354] (-322.859) (-322.982) (-325.177) -- 0:00:07
825000 -- (-325.381) (-326.271) [-321.640] (-324.582) * [-320.876] (-322.295) (-323.377) (-324.035) -- 0:00:07
Average standard deviation of split frequencies: 0.003805
825500 -- (-321.743) (-321.003) (-326.584) [-322.330] * (-325.762) (-325.522) [-322.303] (-327.535) -- 0:00:07
826000 -- [-322.185] (-324.361) (-325.154) (-325.827) * (-322.477) (-322.254) [-323.611] (-327.549) -- 0:00:07
826500 -- [-322.112] (-322.281) (-323.245) (-325.205) * (-321.964) (-324.123) [-322.874] (-325.975) -- 0:00:07
827000 -- (-322.217) (-322.941) (-322.025) [-324.060] * (-323.074) (-323.661) (-324.617) [-323.970] -- 0:00:07
827500 -- (-327.709) (-321.160) (-321.322) [-328.356] * [-322.960] (-322.651) (-326.530) (-324.347) -- 0:00:07
828000 -- (-322.639) (-322.122) [-322.404] (-321.554) * (-323.056) (-322.633) [-321.295] (-321.741) -- 0:00:07
828500 -- (-323.568) [-320.914] (-321.093) (-322.653) * (-322.489) (-326.400) [-321.831] (-327.696) -- 0:00:07
829000 -- (-322.227) (-321.778) (-321.725) [-322.126] * [-322.974] (-321.702) (-321.895) (-321.690) -- 0:00:07
829500 -- (-322.402) (-322.188) (-321.238) [-320.919] * (-320.960) [-321.274] (-322.770) (-326.575) -- 0:00:07
830000 -- (-320.635) (-322.334) [-322.531] (-329.148) * (-322.430) (-321.285) (-322.374) [-321.669] -- 0:00:07
Average standard deviation of split frequencies: 0.003027
830500 -- (-321.081) [-323.411] (-323.497) (-328.790) * (-320.788) (-323.287) [-327.043] (-321.006) -- 0:00:07
831000 -- (-320.737) (-323.322) (-321.516) [-320.906] * [-322.715] (-323.656) (-324.778) (-322.877) -- 0:00:07
831500 -- (-321.222) [-322.613] (-324.385) (-321.434) * (-323.288) [-321.654] (-324.891) (-323.373) -- 0:00:07
832000 -- (-322.551) [-323.513] (-324.340) (-320.922) * (-321.118) (-321.268) [-325.438] (-326.719) -- 0:00:07
832500 -- (-324.098) [-324.207] (-323.021) (-321.511) * (-322.136) (-320.957) [-322.344] (-321.947) -- 0:00:07
833000 -- (-320.459) [-323.696] (-323.212) (-321.503) * (-322.462) (-320.795) [-323.971] (-322.231) -- 0:00:07
833500 -- (-326.488) (-323.861) (-321.609) [-322.271] * [-325.671] (-325.042) (-326.874) (-326.051) -- 0:00:07
834000 -- (-322.217) [-323.367] (-323.643) (-322.716) * (-322.425) (-326.634) [-322.207] (-323.222) -- 0:00:07
834500 -- (-328.791) [-322.549] (-322.181) (-322.405) * [-322.792] (-326.019) (-323.745) (-325.229) -- 0:00:07
835000 -- [-322.792] (-322.436) (-325.794) (-323.715) * (-323.656) (-324.025) (-322.533) [-322.932] -- 0:00:07
Average standard deviation of split frequencies: 0.001880
835500 -- [-323.651] (-327.320) (-323.493) (-323.489) * [-321.169] (-325.609) (-323.000) (-326.510) -- 0:00:07
836000 -- (-321.372) (-324.078) [-322.567] (-323.725) * (-325.608) (-322.253) [-322.038] (-323.999) -- 0:00:07
836500 -- (-320.834) (-322.441) [-322.989] (-323.096) * [-324.652] (-323.533) (-323.498) (-321.998) -- 0:00:07
837000 -- (-323.010) [-326.488] (-321.919) (-324.993) * (-325.122) [-326.350] (-322.803) (-325.045) -- 0:00:07
837500 -- (-321.030) [-323.282] (-320.945) (-322.292) * (-320.963) (-328.310) (-320.993) [-324.429] -- 0:00:07
838000 -- [-321.166] (-323.702) (-320.890) (-321.431) * (-321.951) (-323.601) (-321.007) [-321.132] -- 0:00:07
838500 -- (-324.748) [-324.481] (-323.659) (-323.920) * (-321.656) (-324.271) (-321.148) [-322.453] -- 0:00:07
839000 -- [-322.646] (-323.942) (-321.378) (-323.930) * (-321.589) (-325.260) (-326.830) [-325.541] -- 0:00:07
839500 -- [-320.809] (-323.231) (-320.920) (-322.320) * (-325.201) [-321.902] (-329.773) (-323.424) -- 0:00:07
840000 -- (-324.516) (-323.558) [-320.666] (-324.424) * (-322.852) [-321.723] (-326.034) (-323.123) -- 0:00:07
Average standard deviation of split frequencies: 0.002243
840500 -- (-325.941) (-323.605) [-321.263] (-327.513) * (-322.300) [-324.426] (-322.727) (-328.093) -- 0:00:07
841000 -- (-322.282) (-325.711) (-325.817) [-321.204] * (-321.462) (-323.639) (-322.102) [-320.643] -- 0:00:07
841500 -- (-321.252) (-326.690) [-323.722] (-326.442) * (-324.856) (-321.100) [-322.205] (-321.141) -- 0:00:07
842000 -- [-323.674] (-327.034) (-321.386) (-322.054) * [-322.412] (-322.412) (-320.917) (-323.474) -- 0:00:07
842500 -- (-324.644) (-322.651) (-325.082) [-321.577] * [-326.104] (-322.361) (-322.204) (-322.369) -- 0:00:07
843000 -- [-326.452] (-322.132) (-324.583) (-321.957) * [-324.725] (-325.414) (-320.708) (-321.228) -- 0:00:07
843500 -- (-326.953) (-322.600) [-323.057] (-322.239) * [-321.641] (-322.665) (-320.683) (-322.940) -- 0:00:07
844000 -- (-322.276) (-323.042) [-322.996] (-326.573) * [-328.459] (-323.615) (-321.740) (-323.808) -- 0:00:07
844500 -- (-323.357) (-330.301) [-321.876] (-321.521) * (-322.329) [-321.440] (-322.102) (-323.462) -- 0:00:06
845000 -- (-322.449) (-321.711) (-326.322) [-322.731] * [-323.308] (-321.566) (-325.329) (-329.732) -- 0:00:06
Average standard deviation of split frequencies: 0.002600
845500 -- (-322.871) (-322.069) [-321.949] (-320.956) * (-322.390) (-322.571) [-322.095] (-323.795) -- 0:00:06
846000 -- (-322.425) (-324.629) (-322.982) [-322.378] * (-321.525) [-321.121] (-325.803) (-323.987) -- 0:00:06
846500 -- (-322.930) [-320.823] (-321.063) (-321.490) * (-321.348) [-326.074] (-320.661) (-322.149) -- 0:00:06
847000 -- (-322.622) [-320.851] (-324.531) (-325.177) * (-322.418) (-324.019) [-320.817] (-323.401) -- 0:00:06
847500 -- (-322.860) [-322.141] (-321.442) (-323.502) * [-320.419] (-322.029) (-321.405) (-326.816) -- 0:00:06
848000 -- (-326.781) (-322.890) [-324.906] (-320.667) * (-320.768) (-323.882) [-321.571] (-322.437) -- 0:00:06
848500 -- [-321.544] (-322.930) (-321.934) (-323.920) * (-321.948) [-322.152] (-323.676) (-323.528) -- 0:00:06
849000 -- (-326.175) [-321.223] (-325.648) (-323.706) * (-322.999) [-321.719] (-322.593) (-325.175) -- 0:00:06
849500 -- [-323.503] (-322.862) (-326.094) (-327.090) * (-326.964) (-320.889) [-321.708] (-322.222) -- 0:00:06
850000 -- (-327.474) (-320.778) (-326.908) [-328.068] * [-321.820] (-324.215) (-325.366) (-324.473) -- 0:00:06
Average standard deviation of split frequencies: 0.002586
850500 -- (-324.931) (-321.751) (-322.596) [-320.751] * (-324.451) (-323.163) [-320.525] (-323.581) -- 0:00:06
851000 -- (-324.319) [-322.393] (-321.849) (-321.584) * [-323.636] (-321.898) (-321.285) (-320.803) -- 0:00:06
851500 -- (-325.379) [-322.534] (-324.164) (-321.823) * (-325.415) [-321.926] (-322.191) (-322.307) -- 0:00:06
852000 -- (-325.792) (-322.452) [-322.637] (-322.740) * (-325.519) [-320.907] (-322.815) (-323.617) -- 0:00:06
852500 -- (-322.729) (-324.178) [-320.867] (-322.471) * (-323.650) (-321.641) [-322.454] (-326.198) -- 0:00:06
853000 -- (-324.177) [-323.349] (-324.552) (-322.653) * (-321.898) (-321.635) (-322.978) [-322.498] -- 0:00:06
853500 -- (-321.245) [-322.114] (-321.639) (-320.812) * [-321.917] (-321.472) (-322.010) (-327.452) -- 0:00:06
854000 -- [-320.706] (-322.678) (-321.424) (-322.735) * (-330.633) (-323.524) (-321.540) [-324.376] -- 0:00:06
854500 -- [-321.395] (-321.708) (-321.279) (-323.732) * (-323.514) (-323.729) (-322.476) [-321.135] -- 0:00:06
855000 -- (-324.852) [-322.714] (-324.513) (-324.581) * (-325.185) (-324.078) [-323.640] (-321.879) -- 0:00:06
Average standard deviation of split frequencies: 0.002570
855500 -- (-322.656) [-324.611] (-321.038) (-323.964) * (-325.319) (-323.053) (-321.059) [-324.486] -- 0:00:06
856000 -- [-321.726] (-322.865) (-325.070) (-323.787) * (-325.128) (-322.806) (-327.894) [-326.470] -- 0:00:06
856500 -- [-324.101] (-321.157) (-323.848) (-322.908) * (-322.087) (-324.477) (-325.378) [-322.686] -- 0:00:06
857000 -- [-321.668] (-321.248) (-322.315) (-323.185) * [-322.966] (-324.200) (-320.761) (-326.180) -- 0:00:06
857500 -- [-321.134] (-322.562) (-321.515) (-324.886) * [-321.831] (-322.920) (-322.654) (-324.183) -- 0:00:06
858000 -- (-323.418) (-323.876) (-321.996) [-324.666] * [-321.182] (-320.752) (-320.874) (-326.405) -- 0:00:06
858500 -- [-322.326] (-323.704) (-323.185) (-322.245) * (-322.192) [-322.890] (-321.974) (-324.293) -- 0:00:06
859000 -- (-324.202) [-320.713] (-323.490) (-322.565) * (-323.679) [-321.131] (-323.746) (-325.784) -- 0:00:06
859500 -- [-321.222] (-321.244) (-321.379) (-327.043) * (-324.138) [-320.586] (-323.462) (-321.489) -- 0:00:06
860000 -- [-321.085] (-322.757) (-322.865) (-321.221) * (-322.490) [-322.353] (-324.408) (-323.272) -- 0:00:06
Average standard deviation of split frequencies: 0.002921
860500 -- (-322.832) (-321.720) [-320.873] (-323.096) * (-321.767) (-325.345) (-325.742) [-325.762] -- 0:00:06
861000 -- (-325.112) [-323.397] (-320.872) (-322.309) * (-324.795) (-329.403) (-327.743) [-322.292] -- 0:00:06
861500 -- (-321.776) (-324.681) (-321.899) [-325.123] * [-322.922] (-326.897) (-324.078) (-326.257) -- 0:00:06
862000 -- (-325.702) (-323.129) [-321.121] (-325.471) * (-323.576) (-324.214) (-323.949) [-324.354] -- 0:00:06
862500 -- (-325.371) [-321.225] (-323.336) (-323.584) * (-321.494) (-324.554) [-320.950] (-321.657) -- 0:00:06
863000 -- (-323.358) (-322.828) [-324.872] (-324.054) * (-322.439) [-325.145] (-321.482) (-324.110) -- 0:00:06
863500 -- [-321.595] (-323.910) (-322.304) (-322.246) * (-326.738) (-325.723) (-324.035) [-325.471] -- 0:00:06
864000 -- (-320.822) (-321.355) [-322.256] (-324.216) * (-323.524) [-321.725] (-321.716) (-322.184) -- 0:00:06
864500 -- [-321.775] (-323.871) (-324.999) (-322.538) * (-321.899) (-324.013) (-322.276) [-323.215] -- 0:00:06
865000 -- (-321.617) (-324.762) (-323.626) [-321.683] * (-322.103) (-322.592) (-324.115) [-323.003] -- 0:00:06
Average standard deviation of split frequencies: 0.002540
865500 -- (-322.492) (-326.467) [-321.148] (-324.078) * (-322.715) (-322.652) (-321.151) [-322.394] -- 0:00:06
866000 -- (-324.713) [-324.423] (-322.817) (-323.961) * (-324.392) (-321.393) (-323.692) [-322.599] -- 0:00:06
866500 -- (-324.609) (-320.957) (-321.950) [-322.351] * (-322.072) (-321.516) (-320.700) [-323.852] -- 0:00:06
867000 -- (-322.994) (-323.741) [-324.203] (-325.203) * (-323.131) [-324.345] (-321.626) (-324.958) -- 0:00:05
867500 -- (-323.701) (-324.859) [-323.274] (-322.439) * (-322.205) [-324.835] (-324.109) (-325.300) -- 0:00:05
868000 -- [-323.646] (-323.607) (-324.508) (-322.635) * (-322.018) (-324.773) (-323.746) [-321.545] -- 0:00:05
868500 -- (-326.345) (-320.630) [-322.180] (-325.560) * (-323.943) [-324.508] (-325.749) (-324.479) -- 0:00:05
869000 -- [-322.873] (-326.592) (-324.862) (-326.534) * [-322.980] (-323.945) (-325.126) (-321.416) -- 0:00:05
869500 -- (-323.260) [-321.351] (-327.639) (-326.551) * (-325.069) (-321.517) (-321.295) [-322.807] -- 0:00:05
870000 -- (-322.257) (-325.012) (-323.043) [-322.397] * (-323.102) (-321.284) [-321.482] (-322.089) -- 0:00:05
Average standard deviation of split frequencies: 0.001444
870500 -- [-322.592] (-326.565) (-321.409) (-321.396) * (-322.553) (-326.368) (-322.945) [-321.861] -- 0:00:05
871000 -- (-322.102) [-323.634] (-324.133) (-330.342) * (-324.203) (-322.363) (-324.099) [-323.800] -- 0:00:05
871500 -- [-322.119] (-325.409) (-328.990) (-322.028) * (-325.774) (-322.057) (-323.658) [-322.904] -- 0:00:05
872000 -- [-322.052] (-321.515) (-323.336) (-321.259) * (-323.488) (-323.542) (-327.879) [-320.488] -- 0:00:05
872500 -- (-323.255) (-321.504) [-323.313] (-324.264) * [-321.986] (-325.014) (-323.446) (-321.224) -- 0:00:05
873000 -- (-326.959) (-321.647) [-321.384] (-322.586) * (-325.965) (-324.320) (-322.154) [-320.946] -- 0:00:05
873500 -- [-320.955] (-327.341) (-320.815) (-324.923) * (-324.168) [-327.040] (-326.461) (-321.888) -- 0:00:05
874000 -- (-324.177) [-324.415] (-321.291) (-327.284) * [-324.425] (-323.840) (-324.367) (-323.102) -- 0:00:05
874500 -- (-321.686) (-323.735) (-321.480) [-320.840] * (-323.929) [-322.869] (-323.089) (-325.988) -- 0:00:05
875000 -- (-322.776) (-323.925) [-325.579] (-321.911) * (-322.803) (-322.485) (-321.927) [-322.054] -- 0:00:05
Average standard deviation of split frequencies: 0.002153
875500 -- (-322.940) (-321.605) (-322.089) [-321.237] * (-322.336) (-321.710) (-322.405) [-321.654] -- 0:00:05
876000 -- [-325.600] (-320.845) (-324.164) (-321.153) * (-323.053) (-320.717) (-322.596) [-323.842] -- 0:00:05
876500 -- [-324.344] (-320.902) (-325.117) (-324.694) * (-321.918) [-325.411] (-321.986) (-323.738) -- 0:00:05
877000 -- (-320.740) (-321.730) (-324.081) [-324.023] * [-321.269] (-323.911) (-321.328) (-324.014) -- 0:00:05
877500 -- (-321.807) (-323.820) (-326.151) [-325.943] * (-321.284) (-322.114) [-321.685] (-322.184) -- 0:00:05
878000 -- (-322.255) (-324.314) (-322.589) [-324.331] * (-325.500) (-323.939) [-322.022] (-320.859) -- 0:00:05
878500 -- [-321.267] (-324.519) (-321.848) (-321.127) * (-326.289) (-320.554) (-324.002) [-321.454] -- 0:00:05
879000 -- [-320.915] (-321.232) (-324.448) (-322.140) * (-326.458) [-322.582] (-323.782) (-323.645) -- 0:00:05
879500 -- (-322.824) [-321.723] (-323.229) (-322.510) * (-322.711) (-323.804) (-325.210) [-322.494] -- 0:00:05
880000 -- (-324.054) (-322.206) (-325.003) [-321.563] * (-322.922) [-322.477] (-320.634) (-326.072) -- 0:00:05
Average standard deviation of split frequencies: 0.002855
880500 -- (-323.120) (-321.311) (-323.665) [-322.371] * (-322.438) (-321.167) [-321.474] (-321.975) -- 0:00:05
881000 -- (-322.644) (-323.909) [-321.296] (-322.605) * (-323.024) [-321.369] (-321.170) (-323.405) -- 0:00:05
881500 -- [-320.746] (-324.513) (-320.807) (-325.010) * (-322.093) [-324.902] (-320.457) (-323.728) -- 0:00:05
882000 -- (-321.734) [-324.799] (-322.172) (-321.523) * (-323.093) (-321.391) [-320.521] (-321.359) -- 0:00:05
882500 -- (-320.719) (-322.665) [-321.083] (-324.290) * (-323.577) [-321.503] (-324.626) (-322.055) -- 0:00:05
883000 -- [-323.459] (-322.325) (-323.934) (-327.726) * (-322.985) (-322.059) (-322.111) [-321.693] -- 0:00:05
883500 -- (-322.207) (-323.593) [-323.072] (-321.926) * (-331.096) (-321.567) [-324.202] (-322.738) -- 0:00:05
884000 -- (-325.973) [-321.603] (-324.697) (-323.612) * (-327.497) (-326.009) (-324.679) [-322.573] -- 0:00:05
884500 -- (-321.808) [-321.528] (-321.610) (-322.473) * (-322.815) (-322.605) (-323.095) [-321.986] -- 0:00:05
885000 -- (-323.412) [-321.390] (-330.393) (-324.360) * (-323.739) (-322.623) (-322.423) [-321.232] -- 0:00:05
Average standard deviation of split frequencies: 0.002483
885500 -- [-323.357] (-323.782) (-324.236) (-323.221) * (-322.392) [-323.583] (-320.871) (-321.820) -- 0:00:05
886000 -- (-323.015) [-327.037] (-325.631) (-321.446) * (-322.459) (-325.136) [-321.536] (-324.483) -- 0:00:05
886500 -- [-324.153] (-328.213) (-325.348) (-324.338) * [-320.422] (-323.977) (-322.950) (-322.368) -- 0:00:05
887000 -- (-323.807) (-320.483) [-323.983] (-323.177) * (-325.271) (-322.799) [-321.190] (-322.236) -- 0:00:05
887500 -- (-325.100) (-324.695) (-322.205) [-321.672] * (-323.120) (-321.747) (-323.469) [-326.848] -- 0:00:05
888000 -- (-326.325) (-325.373) [-321.292] (-322.653) * (-325.182) (-321.600) (-327.300) [-322.625] -- 0:00:05
888500 -- [-323.580] (-322.591) (-323.867) (-322.038) * (-322.067) (-322.802) (-323.488) [-321.814] -- 0:00:05
889000 -- (-321.290) (-323.779) [-323.778] (-322.710) * (-321.539) [-324.591] (-321.778) (-325.349) -- 0:00:04
889500 -- [-321.912] (-322.700) (-321.346) (-323.715) * [-321.257] (-322.158) (-325.002) (-326.676) -- 0:00:04
890000 -- (-321.141) (-323.480) (-321.721) [-322.147] * (-323.595) [-325.780] (-321.275) (-321.783) -- 0:00:04
Average standard deviation of split frequencies: 0.002823
890500 -- [-324.190] (-321.740) (-321.501) (-322.445) * (-320.773) (-321.904) [-321.683] (-321.901) -- 0:00:04
891000 -- [-324.388] (-321.993) (-321.573) (-323.191) * (-323.123) (-323.706) (-324.214) [-328.161] -- 0:00:04
891500 -- (-324.914) [-324.642] (-321.370) (-325.056) * (-321.826) [-321.488] (-321.871) (-321.656) -- 0:00:04
892000 -- (-324.627) [-322.233] (-322.480) (-322.384) * [-321.143] (-324.365) (-321.892) (-322.297) -- 0:00:04
892500 -- (-323.151) [-322.726] (-322.065) (-321.186) * [-322.522] (-323.324) (-327.309) (-321.140) -- 0:00:04
893000 -- (-323.703) [-323.782] (-323.689) (-324.536) * (-324.965) (-322.163) (-327.058) [-325.946] -- 0:00:04
893500 -- (-322.766) [-321.251] (-323.222) (-325.487) * (-323.168) [-322.553] (-321.608) (-323.064) -- 0:00:04
894000 -- [-324.001] (-321.830) (-322.407) (-323.055) * (-322.913) (-324.521) [-321.768] (-321.107) -- 0:00:04
894500 -- (-321.524) (-323.645) (-321.667) [-326.948] * (-329.416) (-322.285) [-321.750] (-322.713) -- 0:00:04
895000 -- (-323.621) (-323.012) [-321.702] (-323.789) * (-326.632) [-323.383] (-324.704) (-322.034) -- 0:00:04
Average standard deviation of split frequencies: 0.002104
895500 -- [-324.090] (-322.376) (-322.562) (-325.646) * (-321.523) (-321.406) (-322.134) [-322.165] -- 0:00:04
896000 -- (-322.213) (-321.302) [-325.544] (-324.646) * (-321.419) (-322.209) (-321.450) [-321.363] -- 0:00:04
896500 -- (-321.932) (-321.651) (-324.571) [-320.588] * [-321.550] (-322.105) (-323.011) (-323.344) -- 0:00:04
897000 -- (-322.130) [-322.240] (-324.885) (-322.709) * [-322.422] (-322.953) (-323.350) (-322.322) -- 0:00:04
897500 -- (-320.974) [-322.906] (-324.051) (-321.066) * (-323.537) (-326.310) (-321.324) [-327.218] -- 0:00:04
898000 -- (-325.365) (-329.375) [-321.851] (-321.277) * (-323.970) [-320.854] (-322.653) (-321.668) -- 0:00:04
898500 -- [-321.382] (-324.747) (-324.611) (-320.667) * (-322.472) (-320.926) [-323.283] (-324.680) -- 0:00:04
899000 -- (-324.361) (-325.351) (-329.296) [-321.515] * [-327.542] (-324.460) (-322.194) (-324.803) -- 0:00:04
899500 -- (-323.147) [-323.644] (-328.474) (-323.468) * (-325.390) (-327.631) [-322.858] (-323.011) -- 0:00:04
900000 -- [-321.975] (-328.668) (-322.167) (-330.512) * (-322.744) [-328.270] (-321.749) (-320.985) -- 0:00:04
Average standard deviation of split frequencies: 0.002094
900500 -- (-325.222) (-323.333) [-321.060] (-323.199) * (-321.141) (-324.952) [-322.799] (-322.431) -- 0:00:04
901000 -- (-324.905) (-323.763) [-323.976] (-324.082) * (-320.733) (-323.588) [-323.634] (-321.892) -- 0:00:04
901500 -- [-324.657] (-324.270) (-322.434) (-326.591) * (-321.762) (-323.242) (-322.145) [-321.599] -- 0:00:04
902000 -- (-325.524) [-323.510] (-327.080) (-326.376) * (-321.585) [-323.661] (-326.174) (-323.108) -- 0:00:04
902500 -- (-321.432) (-320.703) (-332.673) [-321.281] * (-323.005) [-323.316] (-328.519) (-321.906) -- 0:00:04
903000 -- (-324.797) [-324.888] (-327.288) (-325.157) * (-322.245) [-323.074] (-326.955) (-323.130) -- 0:00:04
903500 -- (-321.442) (-324.528) [-323.545] (-322.586) * (-322.472) (-321.163) [-323.012] (-324.361) -- 0:00:04
904000 -- (-323.411) [-323.322] (-322.708) (-328.121) * (-322.706) (-322.307) (-324.441) [-324.096] -- 0:00:04
904500 -- (-325.916) (-321.249) (-322.109) [-324.946] * (-324.606) [-322.133] (-323.326) (-322.565) -- 0:00:04
905000 -- (-326.852) (-322.469) [-321.962] (-322.183) * (-329.727) (-321.390) [-325.432] (-321.470) -- 0:00:04
Average standard deviation of split frequencies: 0.003469
905500 -- (-327.863) (-323.306) (-320.433) [-324.373] * (-322.276) (-323.609) (-324.625) [-320.781] -- 0:00:04
906000 -- (-321.062) (-324.004) (-321.169) [-324.725] * (-322.113) [-325.607] (-325.406) (-322.019) -- 0:00:04
906500 -- (-322.468) (-323.246) [-321.078] (-321.217) * [-322.632] (-323.069) (-323.934) (-324.030) -- 0:00:04
907000 -- [-322.064] (-323.234) (-322.161) (-321.404) * (-328.528) [-322.960] (-322.787) (-328.111) -- 0:00:04
907500 -- (-321.738) (-322.797) (-323.247) [-320.697] * (-324.412) (-322.241) [-323.470] (-326.362) -- 0:00:04
908000 -- [-325.817] (-323.179) (-321.209) (-321.125) * (-323.701) [-323.323] (-323.928) (-323.335) -- 0:00:04
908500 -- (-324.365) (-320.786) (-321.082) [-322.933] * (-322.475) (-320.861) [-325.384] (-324.423) -- 0:00:04
909000 -- (-322.763) (-321.622) (-321.539) [-321.892] * (-326.405) (-322.479) [-322.500] (-321.678) -- 0:00:04
909500 -- [-322.583] (-323.184) (-325.758) (-320.910) * (-322.036) (-323.429) (-323.293) [-321.327] -- 0:00:04
910000 -- [-321.036] (-324.399) (-321.981) (-325.312) * (-321.396) (-321.113) (-323.987) [-322.978] -- 0:00:04
Average standard deviation of split frequencies: 0.005176
910500 -- (-321.809) (-322.180) (-325.506) [-321.544] * [-323.642] (-322.701) (-322.922) (-321.192) -- 0:00:04
911000 -- (-328.547) [-320.632] (-322.798) (-322.031) * (-322.938) (-321.986) [-325.889] (-321.096) -- 0:00:04
911500 -- (-321.733) (-322.952) [-322.570] (-322.032) * (-322.174) (-322.509) [-321.783] (-323.586) -- 0:00:03
912000 -- [-324.574] (-323.419) (-321.847) (-321.823) * (-320.415) [-323.197] (-323.144) (-325.055) -- 0:00:03
912500 -- (-323.307) (-323.548) (-322.436) [-323.191] * (-323.081) (-322.982) (-323.848) [-322.328] -- 0:00:03
913000 -- (-321.568) (-325.490) [-322.288] (-325.015) * (-323.511) (-323.176) [-323.342] (-324.846) -- 0:00:03
913500 -- (-321.830) (-321.641) (-327.678) [-322.447] * [-321.133] (-322.698) (-321.450) (-324.460) -- 0:00:03
914000 -- (-326.693) (-323.421) (-326.397) [-325.673] * [-321.330] (-323.859) (-324.650) (-321.312) -- 0:00:03
914500 -- (-325.366) [-322.378] (-322.826) (-323.153) * (-322.103) (-324.617) (-321.638) [-320.744] -- 0:00:03
915000 -- [-325.089] (-323.778) (-323.860) (-324.057) * (-324.511) (-320.750) [-320.990] (-321.765) -- 0:00:03
Average standard deviation of split frequencies: 0.004460
915500 -- (-321.409) (-323.627) (-321.376) [-323.396] * (-321.013) (-321.101) (-327.674) [-321.803] -- 0:00:03
916000 -- (-323.330) (-323.009) (-321.707) [-322.448] * (-321.697) [-325.658] (-323.959) (-323.666) -- 0:00:03
916500 -- (-323.449) (-323.303) (-322.125) [-321.713] * (-321.720) (-322.992) [-323.688] (-323.391) -- 0:00:03
917000 -- (-326.845) (-322.488) [-322.621] (-323.800) * (-323.459) [-325.020] (-323.473) (-321.497) -- 0:00:03
917500 -- (-324.309) [-321.983] (-322.525) (-324.310) * (-323.027) (-324.555) (-321.549) [-324.299] -- 0:00:03
918000 -- (-325.249) (-322.576) (-324.101) [-322.522] * (-322.151) (-324.098) [-322.840] (-322.016) -- 0:00:03
918500 -- (-323.882) (-327.289) (-322.387) [-324.117] * (-322.601) (-321.829) (-323.137) [-321.399] -- 0:00:03
919000 -- (-324.897) [-324.186] (-324.498) (-322.437) * [-322.686] (-322.530) (-322.401) (-329.158) -- 0:00:03
919500 -- (-325.931) (-326.973) (-321.582) [-321.205] * (-321.817) (-323.230) (-325.297) [-322.058] -- 0:00:03
920000 -- (-324.015) [-323.415] (-320.885) (-324.336) * (-326.149) [-323.957] (-322.889) (-322.343) -- 0:00:03
Average standard deviation of split frequencies: 0.004096
920500 -- (-322.544) [-321.168] (-322.695) (-324.836) * [-323.668] (-325.668) (-324.877) (-325.181) -- 0:00:03
921000 -- (-324.650) (-322.772) (-323.665) [-324.095] * (-326.104) (-320.738) [-322.955] (-321.140) -- 0:00:03
921500 -- (-326.067) (-323.402) [-323.170] (-322.202) * (-323.195) [-322.151] (-322.406) (-324.589) -- 0:00:03
922000 -- (-324.482) (-321.367) (-321.863) [-323.426] * (-321.115) [-321.926] (-324.341) (-321.094) -- 0:00:03
922500 -- (-325.152) [-321.250] (-321.677) (-324.408) * (-321.513) (-325.606) (-324.554) [-326.362] -- 0:00:03
923000 -- [-322.738] (-321.305) (-323.327) (-328.873) * (-320.800) [-322.907] (-322.696) (-321.183) -- 0:00:03
923500 -- (-323.686) (-322.460) [-322.935] (-321.273) * [-323.874] (-322.370) (-323.005) (-321.649) -- 0:00:03
924000 -- (-321.469) (-321.922) (-324.512) [-321.524] * (-321.012) (-321.215) (-321.303) [-321.566] -- 0:00:03
924500 -- (-324.343) (-320.896) [-323.880] (-320.920) * (-321.862) [-321.067] (-321.228) (-323.030) -- 0:00:03
925000 -- (-322.116) (-325.738) (-324.919) [-320.891] * [-322.771] (-322.443) (-321.245) (-324.014) -- 0:00:03
Average standard deviation of split frequencies: 0.004412
925500 -- (-322.060) (-325.786) (-325.483) [-321.189] * (-321.226) (-323.063) [-321.541] (-321.432) -- 0:00:03
926000 -- (-322.105) (-324.437) (-321.399) [-321.617] * [-322.408] (-323.665) (-322.683) (-323.158) -- 0:00:03
926500 -- (-322.185) [-322.577] (-322.351) (-321.300) * (-321.738) [-322.717] (-322.817) (-325.129) -- 0:00:03
927000 -- [-322.324] (-321.549) (-327.254) (-322.455) * (-322.509) (-323.289) [-321.445] (-321.652) -- 0:00:03
927500 -- [-321.279] (-321.838) (-327.169) (-322.042) * (-324.441) (-321.464) (-321.229) [-323.037] -- 0:00:03
928000 -- (-322.504) (-324.108) (-326.009) [-322.736] * (-323.567) (-324.352) (-322.730) [-321.335] -- 0:00:03
928500 -- (-323.630) (-321.482) (-322.368) [-322.637] * (-322.180) (-324.118) (-322.714) [-322.058] -- 0:00:03
929000 -- (-326.736) (-323.887) [-323.323] (-328.734) * (-321.426) (-323.285) (-322.891) [-322.255] -- 0:00:03
929500 -- [-324.289] (-321.555) (-330.275) (-322.828) * (-322.483) [-322.968] (-321.379) (-322.589) -- 0:00:03
930000 -- [-325.117] (-321.155) (-323.381) (-322.488) * (-323.057) [-326.376] (-321.265) (-321.771) -- 0:00:03
Average standard deviation of split frequencies: 0.004052
930500 -- (-322.073) (-325.793) [-321.655] (-322.318) * (-324.086) (-321.211) [-321.014] (-321.756) -- 0:00:03
931000 -- (-328.205) (-326.336) (-321.174) [-322.886] * [-323.502] (-322.183) (-323.907) (-321.318) -- 0:00:03
931500 -- (-324.171) (-327.222) (-324.119) [-323.206] * (-322.152) [-322.311] (-322.900) (-322.727) -- 0:00:03
932000 -- (-320.778) (-322.241) (-322.077) [-321.157] * (-323.388) [-325.856] (-324.016) (-326.925) -- 0:00:03
932500 -- (-323.456) [-322.924] (-329.448) (-323.490) * (-321.381) (-322.061) [-322.437] (-322.124) -- 0:00:03
933000 -- (-325.289) [-321.309] (-323.868) (-323.099) * (-321.638) (-325.361) (-322.700) [-321.261] -- 0:00:03
933500 -- (-328.702) (-322.614) (-323.669) [-323.026] * (-324.169) [-322.980] (-322.952) (-327.181) -- 0:00:02
934000 -- (-323.440) (-328.396) (-321.504) [-322.232] * (-322.856) [-323.555] (-320.886) (-326.049) -- 0:00:02
934500 -- (-321.875) (-322.262) [-323.200] (-325.000) * (-324.291) (-321.444) [-321.916] (-327.178) -- 0:00:02
935000 -- [-322.476] (-323.882) (-321.373) (-321.656) * (-326.234) [-321.842] (-322.837) (-323.335) -- 0:00:02
Average standard deviation of split frequencies: 0.003358
935500 -- (-322.546) [-320.851] (-321.949) (-324.890) * (-321.288) (-323.928) (-324.370) [-321.757] -- 0:00:02
936000 -- (-323.931) [-322.847] (-321.364) (-322.263) * (-324.762) (-322.012) [-322.276] (-322.387) -- 0:00:02
936500 -- (-326.155) [-323.723] (-322.794) (-321.850) * (-323.013) [-321.438] (-321.432) (-320.717) -- 0:00:02
937000 -- (-323.270) (-321.609) (-326.352) [-320.912] * [-323.074] (-322.182) (-321.807) (-324.923) -- 0:00:02
937500 -- (-320.461) (-321.172) [-320.845] (-323.765) * (-323.336) [-325.216] (-321.940) (-321.693) -- 0:00:02
938000 -- (-324.550) (-323.451) (-321.992) [-322.421] * [-320.630] (-327.677) (-322.891) (-322.098) -- 0:00:02
938500 -- (-320.816) [-321.986] (-325.344) (-320.972) * [-322.353] (-327.369) (-324.316) (-321.127) -- 0:00:02
939000 -- [-323.946] (-322.869) (-323.353) (-322.269) * (-321.891) [-322.672] (-322.411) (-322.914) -- 0:00:02
939500 -- (-321.262) (-321.061) [-322.860] (-322.726) * (-324.165) [-322.365] (-323.892) (-325.706) -- 0:00:02
940000 -- (-320.723) [-323.774] (-323.628) (-324.997) * (-325.292) (-326.360) (-324.866) [-323.675] -- 0:00:02
Average standard deviation of split frequencies: 0.005345
940500 -- (-321.143) (-322.665) (-321.298) [-322.355] * (-323.089) [-321.367] (-321.586) (-323.471) -- 0:00:02
941000 -- (-323.093) [-323.599] (-320.693) (-324.741) * [-320.653] (-321.884) (-324.151) (-322.681) -- 0:00:02
941500 -- (-327.367) (-322.368) [-320.807] (-322.807) * [-320.540] (-324.922) (-322.845) (-324.302) -- 0:00:02
942000 -- [-321.821] (-322.029) (-322.171) (-324.246) * (-320.965) [-321.397] (-321.876) (-323.170) -- 0:00:02
942500 -- (-321.123) [-322.622] (-322.042) (-321.169) * (-323.740) [-322.701] (-321.675) (-320.555) -- 0:00:02
943000 -- (-323.616) (-322.906) [-323.732] (-321.888) * (-323.255) (-322.492) (-320.950) [-324.486] -- 0:00:02
943500 -- (-326.765) (-321.351) (-322.914) [-320.514] * (-322.825) [-321.813] (-321.189) (-320.716) -- 0:00:02
944000 -- [-329.590] (-323.151) (-323.841) (-320.697) * (-325.414) (-321.515) [-321.200] (-321.500) -- 0:00:02
944500 -- (-324.891) [-320.575] (-320.637) (-324.728) * (-323.821) [-321.040] (-325.204) (-324.787) -- 0:00:02
945000 -- (-323.513) [-321.776] (-323.412) (-322.583) * (-323.501) (-323.212) [-321.899] (-322.627) -- 0:00:02
Average standard deviation of split frequencies: 0.005315
945500 -- (-328.781) (-324.599) (-321.834) [-322.070] * (-323.057) (-322.445) (-321.922) [-323.751] -- 0:00:02
946000 -- [-325.683] (-324.331) (-322.081) (-321.157) * (-322.802) (-321.368) (-322.214) [-323.029] -- 0:00:02
946500 -- (-322.359) (-323.150) [-324.135] (-323.893) * (-324.826) (-322.518) [-322.943] (-323.428) -- 0:00:02
947000 -- (-322.262) [-322.542] (-323.884) (-327.102) * (-322.596) (-326.418) [-322.633] (-323.123) -- 0:00:02
947500 -- (-320.770) [-325.345] (-323.049) (-323.981) * [-323.385] (-324.773) (-322.973) (-324.717) -- 0:00:02
948000 -- (-321.488) (-322.981) [-322.764] (-321.353) * (-323.132) (-325.170) (-324.423) [-322.787] -- 0:00:02
948500 -- (-321.703) (-322.655) (-324.308) [-326.484] * (-322.917) [-321.693] (-322.050) (-323.907) -- 0:00:02
949000 -- (-324.470) (-322.486) [-323.435] (-324.235) * (-322.839) (-321.922) (-321.025) [-325.363] -- 0:00:02
949500 -- (-320.617) (-327.491) (-323.420) [-324.939] * (-325.299) [-322.822] (-323.691) (-322.969) -- 0:00:02
950000 -- [-321.606] (-322.137) (-321.797) (-324.257) * [-322.015] (-324.095) (-321.294) (-321.130) -- 0:00:02
Average standard deviation of split frequencies: 0.005950
950500 -- (-320.980) [-324.964] (-321.858) (-323.483) * [-323.137] (-322.167) (-322.968) (-323.569) -- 0:00:02
951000 -- [-321.293] (-321.363) (-322.351) (-323.052) * (-327.969) (-322.361) [-321.297] (-320.926) -- 0:00:02
951500 -- (-322.219) (-321.017) [-321.115] (-324.198) * (-323.876) (-323.614) [-324.793] (-323.275) -- 0:00:02
952000 -- (-323.830) (-323.713) [-320.990] (-321.127) * (-324.106) (-321.755) (-325.332) [-325.090] -- 0:00:02
952500 -- (-322.628) (-322.807) (-321.212) [-322.071] * (-326.113) (-320.628) (-321.340) [-321.650] -- 0:00:02
953000 -- (-326.514) (-322.835) [-321.818] (-324.559) * (-321.952) [-321.544] (-322.762) (-321.135) -- 0:00:02
953500 -- [-323.402] (-322.817) (-322.799) (-322.027) * [-321.098] (-322.202) (-323.269) (-321.070) -- 0:00:02
954000 -- (-322.426) (-325.882) (-321.229) [-324.101] * (-322.563) (-320.577) (-322.978) [-323.126] -- 0:00:02
954500 -- (-322.312) (-322.308) (-327.334) [-320.444] * (-321.864) [-323.533] (-323.697) (-323.594) -- 0:00:02
955000 -- (-323.370) (-323.498) (-325.898) [-321.818] * [-321.681] (-323.675) (-324.257) (-323.390) -- 0:00:02
Average standard deviation of split frequencies: 0.006246
955500 -- (-324.165) (-321.293) (-321.258) [-324.340] * (-321.020) (-321.002) [-322.375] (-321.544) -- 0:00:02
956000 -- (-322.264) (-324.026) (-323.224) [-323.995] * (-321.486) (-322.095) [-322.995] (-322.600) -- 0:00:01
956500 -- (-323.284) (-321.283) [-323.146] (-324.338) * (-329.162) [-323.949] (-321.679) (-326.730) -- 0:00:01
957000 -- (-326.788) [-321.324] (-323.957) (-326.730) * (-321.982) [-323.832] (-324.585) (-327.593) -- 0:00:01
957500 -- (-324.888) (-324.854) (-326.230) [-322.023] * (-321.608) (-324.296) (-322.664) [-325.530] -- 0:00:01
958000 -- (-323.486) (-324.498) (-321.905) [-321.048] * (-321.788) [-323.257] (-323.311) (-323.513) -- 0:00:01
958500 -- [-323.156] (-322.780) (-321.581) (-322.872) * [-322.605] (-323.123) (-321.970) (-325.275) -- 0:00:01
959000 -- (-321.598) (-323.012) (-324.039) [-323.390] * [-324.073] (-321.460) (-320.799) (-322.384) -- 0:00:01
959500 -- (-324.811) (-321.961) (-321.875) [-323.476] * (-322.535) [-322.559] (-320.657) (-327.958) -- 0:00:01
960000 -- (-322.554) [-323.665] (-321.943) (-324.069) * (-321.660) [-321.588] (-321.451) (-324.571) -- 0:00:01
Average standard deviation of split frequencies: 0.006543
960500 -- (-324.488) [-323.397] (-323.430) (-326.474) * (-326.327) (-323.251) (-321.544) [-322.751] -- 0:00:01
961000 -- (-322.759) [-322.684] (-323.473) (-321.342) * [-322.228] (-324.289) (-320.877) (-321.924) -- 0:00:01
961500 -- (-321.675) [-326.624] (-324.714) (-322.263) * (-325.374) [-321.836] (-329.002) (-326.352) -- 0:00:01
962000 -- [-321.521] (-322.969) (-321.398) (-323.139) * (-322.372) [-322.222] (-322.078) (-326.250) -- 0:00:01
962500 -- (-325.695) [-323.507] (-322.932) (-325.424) * [-322.662] (-323.526) (-323.617) (-321.134) -- 0:00:01
963000 -- (-324.540) (-323.507) (-320.664) [-327.885] * (-324.025) (-322.999) (-325.988) [-323.976] -- 0:00:01
963500 -- (-322.960) (-325.074) [-320.515] (-323.704) * (-320.751) (-325.486) [-322.697] (-323.162) -- 0:00:01
964000 -- (-325.491) [-325.779] (-324.846) (-322.366) * [-322.468] (-321.432) (-331.277) (-322.562) -- 0:00:01
964500 -- (-325.405) [-322.058] (-324.505) (-320.979) * (-323.621) [-326.749] (-324.948) (-325.745) -- 0:00:01
965000 -- (-322.600) (-322.796) (-322.520) [-322.353] * (-324.074) (-325.857) [-322.682] (-323.011) -- 0:00:01
Average standard deviation of split frequencies: 0.006832
965500 -- (-323.751) [-321.786] (-327.574) (-325.735) * (-322.258) (-320.993) (-323.925) [-321.011] -- 0:00:01
966000 -- [-324.790] (-324.327) (-326.871) (-326.105) * [-323.119] (-323.801) (-322.713) (-322.412) -- 0:00:01
966500 -- (-322.576) (-321.669) [-323.096] (-320.829) * [-324.181] (-322.305) (-323.290) (-321.526) -- 0:00:01
967000 -- (-322.163) [-321.719] (-322.493) (-323.258) * (-323.868) (-322.708) [-320.965] (-322.598) -- 0:00:01
967500 -- [-320.880] (-322.903) (-325.542) (-322.686) * (-323.890) (-322.082) (-322.568) [-321.152] -- 0:00:01
968000 -- [-323.571] (-323.931) (-323.158) (-321.720) * (-322.319) (-324.230) [-321.879] (-325.398) -- 0:00:01
968500 -- (-321.327) (-323.648) [-323.410] (-321.070) * (-323.285) [-322.378] (-326.001) (-322.621) -- 0:00:01
969000 -- (-322.987) [-320.777] (-324.709) (-320.800) * [-321.010] (-321.830) (-325.083) (-323.893) -- 0:00:01
969500 -- (-321.267) [-323.725] (-323.532) (-321.705) * (-325.396) (-322.777) [-324.442] (-322.759) -- 0:00:01
970000 -- (-321.766) (-323.191) [-324.116] (-325.679) * (-327.517) (-322.215) (-323.652) [-322.495] -- 0:00:01
Average standard deviation of split frequencies: 0.007447
970500 -- (-322.325) (-321.962) [-322.327] (-322.842) * [-324.939] (-321.847) (-320.909) (-320.681) -- 0:00:01
971000 -- (-326.710) (-321.941) [-321.192] (-324.175) * [-322.884] (-321.222) (-321.730) (-321.615) -- 0:00:01
971500 -- (-323.045) [-323.007] (-321.353) (-321.368) * (-322.612) (-322.392) [-321.944] (-321.319) -- 0:00:01
972000 -- (-329.740) (-323.636) (-321.935) [-323.492] * [-321.534] (-321.575) (-323.488) (-324.581) -- 0:00:01
972500 -- (-327.861) (-322.829) [-321.381] (-325.385) * (-321.347) (-322.879) (-323.337) [-321.616] -- 0:00:01
973000 -- [-324.242] (-323.266) (-321.132) (-322.786) * [-323.532] (-322.774) (-320.861) (-321.619) -- 0:00:01
973500 -- (-321.998) (-325.892) (-321.808) [-322.763] * (-327.163) (-321.321) [-321.619] (-323.598) -- 0:00:01
974000 -- (-323.507) (-323.673) [-321.164] (-326.604) * (-324.780) (-322.745) [-322.747] (-321.368) -- 0:00:01
974500 -- (-327.411) (-323.764) (-322.624) [-321.190] * (-329.813) [-322.210] (-322.016) (-322.107) -- 0:00:01
975000 -- [-322.955] (-324.114) (-322.956) (-322.983) * (-324.041) (-322.330) [-323.499] (-322.157) -- 0:00:01
Average standard deviation of split frequencies: 0.008050
975500 -- (-323.036) (-323.426) (-324.637) [-320.716] * (-326.715) (-322.889) (-322.797) [-324.128] -- 0:00:01
976000 -- (-322.308) (-322.251) (-324.222) [-322.998] * (-322.495) (-321.942) [-322.448] (-322.475) -- 0:00:01
976500 -- (-321.969) [-321.925] (-324.433) (-327.812) * (-328.540) (-322.710) (-323.117) [-323.528] -- 0:00:01
977000 -- (-322.555) (-327.899) [-325.220] (-321.575) * (-323.319) [-321.992] (-322.220) (-321.794) -- 0:00:01
977500 -- (-326.173) (-324.516) [-323.229] (-321.149) * (-320.663) [-323.552] (-322.973) (-329.208) -- 0:00:01
978000 -- [-322.350] (-324.329) (-322.394) (-321.740) * (-323.354) [-323.941] (-324.247) (-322.753) -- 0:00:00
978500 -- [-322.322] (-325.956) (-321.627) (-323.702) * (-321.177) (-323.327) (-321.574) [-324.327] -- 0:00:00
979000 -- (-321.147) (-322.688) (-322.150) [-321.130] * (-320.937) (-325.660) (-323.112) [-321.679] -- 0:00:00
979500 -- [-324.316] (-321.985) (-322.727) (-321.024) * (-322.332) [-321.233] (-327.045) (-322.021) -- 0:00:00
980000 -- [-325.486] (-322.927) (-324.476) (-322.007) * (-322.937) (-324.586) (-322.854) [-324.196] -- 0:00:00
Average standard deviation of split frequencies: 0.007691
980500 -- [-324.759] (-326.590) (-326.446) (-321.641) * (-322.757) (-321.955) [-322.185] (-321.637) -- 0:00:00
981000 -- (-321.484) (-324.763) [-322.555] (-321.681) * [-322.602] (-324.066) (-322.028) (-321.905) -- 0:00:00
981500 -- (-321.620) (-323.370) [-323.665] (-321.246) * (-323.774) [-323.422] (-330.664) (-321.992) -- 0:00:00
982000 -- (-322.610) [-322.873] (-326.336) (-322.240) * (-322.346) [-321.631] (-324.439) (-322.472) -- 0:00:00
982500 -- (-321.010) [-321.361] (-322.188) (-327.211) * (-322.095) (-322.096) [-324.329] (-321.152) -- 0:00:00
983000 -- [-321.341] (-323.753) (-322.489) (-323.299) * (-322.455) [-322.924] (-321.786) (-322.864) -- 0:00:00
983500 -- (-321.492) (-322.392) [-322.589] (-323.027) * [-323.644] (-321.624) (-320.766) (-324.512) -- 0:00:00
984000 -- (-321.421) (-325.552) (-323.341) [-321.726] * (-323.749) (-326.176) (-322.784) [-321.944] -- 0:00:00
984500 -- [-321.510] (-323.922) (-322.877) (-321.868) * (-324.021) [-323.782] (-322.060) (-323.290) -- 0:00:00
985000 -- (-322.444) (-323.398) (-326.275) [-321.915] * (-321.357) (-322.025) [-321.898] (-324.327) -- 0:00:00
Average standard deviation of split frequencies: 0.007650
985500 -- [-326.563] (-322.310) (-321.673) (-323.912) * [-321.228] (-325.790) (-325.254) (-323.032) -- 0:00:00
986000 -- [-322.331] (-323.258) (-323.188) (-323.036) * (-321.278) [-323.446] (-324.064) (-324.240) -- 0:00:00
986500 -- [-323.322] (-323.221) (-323.403) (-320.842) * [-323.430] (-321.579) (-322.781) (-325.926) -- 0:00:00
987000 -- (-324.894) (-324.173) (-321.221) [-321.875] * (-325.980) (-323.370) (-322.853) [-324.498] -- 0:00:00
987500 -- (-324.428) (-323.281) (-322.008) [-320.895] * (-322.270) [-322.234] (-322.170) (-323.335) -- 0:00:00
988000 -- (-324.419) [-322.001] (-324.193) (-321.519) * (-321.690) (-322.372) (-324.906) [-325.742] -- 0:00:00
988500 -- (-327.533) [-321.812] (-326.083) (-321.345) * (-326.735) [-322.021] (-323.985) (-328.904) -- 0:00:00
989000 -- (-323.759) [-324.120] (-324.270) (-324.301) * [-320.693] (-321.908) (-321.311) (-321.179) -- 0:00:00
989500 -- (-325.796) [-321.754] (-321.799) (-325.319) * [-325.972] (-323.923) (-324.545) (-327.313) -- 0:00:00
990000 -- [-330.956] (-322.885) (-324.422) (-322.086) * (-322.834) [-323.138] (-322.129) (-322.426) -- 0:00:00
Average standard deviation of split frequencies: 0.008248
990500 -- (-323.930) (-321.945) (-322.168) [-322.942] * (-321.097) (-323.240) [-324.745] (-321.486) -- 0:00:00
991000 -- (-323.508) [-321.953] (-322.810) (-324.248) * (-321.003) (-323.460) [-324.259] (-323.935) -- 0:00:00
991500 -- (-321.842) (-321.310) (-324.680) [-321.394] * (-327.328) (-323.960) (-327.842) [-321.605] -- 0:00:00
992000 -- [-324.526] (-321.399) (-332.688) (-322.352) * (-328.634) (-322.269) (-322.859) [-323.015] -- 0:00:00
992500 -- [-321.137] (-324.392) (-325.118) (-321.651) * [-324.856] (-322.347) (-323.239) (-325.567) -- 0:00:00
993000 -- [-321.264] (-321.931) (-324.300) (-322.113) * (-324.941) [-322.658] (-320.517) (-321.575) -- 0:00:00
993500 -- (-322.810) (-322.605) (-325.800) [-322.802] * (-321.567) [-321.819] (-321.128) (-326.388) -- 0:00:00
994000 -- [-325.203] (-323.432) (-322.829) (-322.938) * (-323.251) (-324.933) (-323.135) [-320.908] -- 0:00:00
994500 -- (-323.901) (-322.525) [-322.343] (-330.591) * (-325.160) [-321.755] (-321.195) (-323.199) -- 0:00:00
995000 -- (-324.760) [-321.007] (-322.210) (-326.188) * (-321.548) (-321.784) [-321.719] (-321.700) -- 0:00:00
Average standard deviation of split frequencies: 0.007888
995500 -- (-323.211) (-326.845) (-321.877) [-323.273] * (-322.448) (-324.562) [-322.430] (-324.046) -- 0:00:00
996000 -- (-321.668) (-321.878) [-321.562] (-322.235) * (-329.671) (-324.176) (-321.981) [-322.591] -- 0:00:00
996500 -- [-322.363] (-322.362) (-323.949) (-322.356) * [-322.408] (-323.891) (-325.777) (-324.995) -- 0:00:00
997000 -- [-321.576] (-320.705) (-321.408) (-323.767) * (-324.013) [-322.080] (-325.126) (-320.973) -- 0:00:00
997500 -- (-321.496) [-322.803] (-322.290) (-326.891) * (-324.774) [-322.099] (-320.777) (-326.523) -- 0:00:00
998000 -- (-323.817) [-321.687] (-323.186) (-321.236) * (-323.826) [-322.987] (-321.684) (-328.460) -- 0:00:00
998500 -- (-322.707) (-323.079) [-321.916] (-322.732) * [-321.649] (-326.413) (-323.908) (-324.438) -- 0:00:00
999000 -- [-323.059] (-322.508) (-322.664) (-327.275) * (-326.697) (-326.859) (-322.165) [-323.019] -- 0:00:00
999500 -- (-325.471) (-321.647) [-322.275] (-324.251) * (-324.030) (-323.106) [-323.514] (-323.844) -- 0:00:00
1000000 -- (-325.016) (-322.335) (-325.878) [-323.220] * (-321.873) (-323.755) (-322.543) [-323.837] -- 0:00:00
Average standard deviation of split frequencies: 0.008166
Analysis completed in 45 seconds
Analysis used 43.39 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -320.36
Likelihood of best state for "cold" chain of run 2 was -320.36
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.5 % ( 57 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
41.7 % ( 33 %) Dirichlet(Pi{all})
38.2 % ( 20 %) Slider(Pi{all})
71.3 % ( 33 %) Multiplier(Alpha{1,2})
70.0 % ( 32 %) Multiplier(Alpha{3})
27.3 % ( 28 %) Slider(Pinvar{all})
99.9 % (100 %) NNI(Tau{all},V{all})
73.7 % ( 77 %) ParsSPR(Tau{all},V{all})
27.6 % ( 20 %) Multiplier(V{all})
97.4 % (100 %) Nodeslider(V{all})
32.0 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
73.9 % ( 63 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
41.1 % ( 31 %) Dirichlet(Pi{all})
38.9 % ( 34 %) Slider(Pi{all})
71.5 % ( 33 %) Multiplier(Alpha{1,2})
69.5 % ( 31 %) Multiplier(Alpha{3})
27.4 % ( 23 %) Slider(Pinvar{all})
99.9 % (100 %) NNI(Tau{all},V{all})
73.7 % ( 69 %) ParsSPR(Tau{all},V{all})
27.7 % ( 29 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
32.0 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.58
2 | 166487 0.85 0.72
3 | 166139 166977 0.86
4 | 167036 166828 166533
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.57
2 | 166986 0.85 0.72
3 | 166469 166693 0.86
4 | 166941 166283 166628
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -322.06
| 1 2 2 |
| 2 |
| 2 |
|2 11 1 2 111 12 |
| 12 1 2 2 1 2 1 2 2 2 2 |
| 1 1 1 2 2 2 1 1 * 2 12 1|
| 2 1 2 2 11 2 2 2 2112|
| 22 * 1 2 1*2 2 2 2 1 1 111 |
| 1 1 1 1 1 1 1 1 2 1* 1 2 |
|1 2 1 1 1 121 * 1 1 2 |
| 2 2 2 22 2 2 1 1 2 1 |
| 2 1 2 |
| 2 2 2 |
| 2 1 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -323.76
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -322.05 -326.42
2 -322.11 -325.58
--------------------------------------
TOTAL -322.08 -326.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.492384 0.049085 0.111649 0.918190 0.460304 1501.00 1501.00 1.000
r(A<->C){all} 0.160370 0.019466 0.000001 0.442189 0.124547 268.49 287.60 1.000
r(A<->G){all} 0.172695 0.020356 0.000034 0.457872 0.136214 309.43 364.98 1.000
r(A<->T){all} 0.165308 0.019764 0.000007 0.452955 0.128975 213.27 311.52 1.006
r(C<->G){all} 0.164070 0.020387 0.000040 0.456697 0.122524 391.76 397.53 1.000
r(C<->T){all} 0.164476 0.018929 0.000044 0.449293 0.128260 253.13 362.65 1.000
r(G<->T){all} 0.173081 0.021315 0.000027 0.466261 0.135325 350.80 362.93 1.003
pi(A){all} 0.180659 0.000616 0.134134 0.231639 0.179772 1374.04 1437.52 1.000
pi(C){all} 0.336348 0.000903 0.281970 0.398958 0.336122 1216.14 1314.14 1.000
pi(G){all} 0.318938 0.000905 0.261873 0.379277 0.318382 1390.71 1445.86 1.000
pi(T){all} 0.164055 0.000563 0.118878 0.210361 0.162674 1400.89 1412.39 1.000
alpha{1,2} 0.405426 0.216082 0.000159 1.330127 0.234933 1328.81 1393.74 1.000
alpha{3} 0.453299 0.223251 0.000123 1.428646 0.301880 1163.76 1317.27 1.000
pinvar{all} 0.992195 0.000101 0.974261 0.999996 0.995419 1305.39 1403.19 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- ..**
6 -- .*.*
7 -- .**.
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1040 0.346436 0.009422 0.339773 0.353098 2
6 984 0.327781 0.012248 0.319121 0.336442 2
7 978 0.325783 0.002827 0.323784 0.327781 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.095165 0.008916 0.000031 0.281533 0.065433 1.001 2
length{all}[2] 0.098016 0.009372 0.000027 0.294413 0.067870 1.000 2
length{all}[3] 0.101039 0.010889 0.000010 0.311671 0.069917 1.000 2
length{all}[4] 0.097657 0.009946 0.000008 0.298855 0.066470 1.000 2
length{all}[5] 0.098982 0.009634 0.000091 0.290691 0.066852 0.999 2
length{all}[6] 0.098195 0.010600 0.000081 0.283187 0.065520 0.999 2
length{all}[7] 0.104455 0.010332 0.000071 0.318341 0.075684 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008166
Maximum standard deviation of split frequencies = 0.012248
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\-------------------------------------------------------------------- C4 (4)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 4 ls = 240
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 80 / 80 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 80 / 80 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4); MP score: 0
0.059602 0.080421 0.042611 0.010136 0.300000 1.300000
ntime & nrate & np: 4 2 6
Bounds (np=6):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 6
lnL0 = -329.669148
Iterating by ming2
Initial: fx= 329.669148
x= 0.05960 0.08042 0.04261 0.01014 0.30000 1.30000
1 h-m-p 0.0000 0.0001 156.4826 ++ 326.517660 m 0.0001 11 | 1/6
2 h-m-p 0.0007 0.0151 23.8339 -----------.. | 1/6
3 h-m-p 0.0000 0.0004 135.4507 +++ 318.887461 m 0.0004 39 | 2/6
4 h-m-p 0.0026 0.0215 17.3375 ------------.. | 2/6
5 h-m-p 0.0000 0.0002 111.0766 +++ 316.198020 m 0.0002 68 | 3/6
6 h-m-p 0.0016 0.0374 10.7803 -----------.. | 3/6
7 h-m-p 0.0000 0.0003 78.6391 +++ 314.539193 m 0.0003 96 | 4/6
8 h-m-p 1.6000 8.0000 0.0000 ++ 314.539193 m 8.0000 105 | 4/6
9 h-m-p 0.3276 8.0000 0.0000 -Y 314.539193 0 0.0205 117 | 4/6
10 h-m-p 0.0160 8.0000 0.0001 -------------.. | 4/6
11 h-m-p 0.0160 8.0000 0.0000 +++++ 314.539193 m 8.0000 153 | 4/6
12 h-m-p 0.0020 0.9980 1.9490 ---------Y 314.539193 0 0.0000 173 | 4/6
13 h-m-p 0.0160 8.0000 0.0000 +++++ 314.539193 m 8.0000 185 | 4/6
14 h-m-p 0.0072 3.6208 0.4404 +++++ 314.539182 m 3.6208 199 | 5/6
15 h-m-p 1.6000 8.0000 0.6463 ++ 314.539177 m 8.0000 210 | 5/6
16 h-m-p 1.6000 8.0000 0.9044 ++ 314.539176 m 8.0000 220 | 5/6
17 h-m-p 1.6000 8.0000 2.9532 ++ 314.539175 m 8.0000 230 | 5/6
18 h-m-p 1.6000 8.0000 8.4549 ++ 314.539175 m 8.0000 239 | 5/6
19 h-m-p 1.6000 8.0000 6.0778 ++ 314.539174 m 8.0000 248 | 5/6
20 h-m-p 0.4956 2.4782 62.6097 ---------C 314.539174 0 0.0000 266 | 5/6
21 h-m-p 1.6000 8.0000 0.0000 ----C 314.539174 0 0.0016 279 | 5/6
22 h-m-p 0.7071 8.0000 0.0000 ---------N 314.539174 0 0.0000 298
Out..
lnL = -314.539174
299 lfun, 299 eigenQcodon, 1196 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 0
0.096545 0.011264 0.090281 0.062220 0.000100 0.875439 0.574855
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.186087
np = 7
lnL0 = -334.938215
Iterating by ming2
Initial: fx= 334.938215
x= 0.09655 0.01126 0.09028 0.06222 0.00011 0.87544 0.57486
1 h-m-p 0.0000 0.0000 155.4073 ++ 334.590940 m 0.0000 12 | 1/7
2 h-m-p 0.0001 0.0038 43.3139 ++++ 331.214199 m 0.0038 24 | 2/7
3 h-m-p 0.0005 0.0027 165.4523 ++ 320.013233 m 0.0027 34 | 3/7
4 h-m-p 0.0000 0.0002 560.1004 ++ 315.170374 m 0.0002 44 | 4/7
5 h-m-p 0.0003 0.0015 41.9602 ++ 315.112910 m 0.0015 54 | 4/7
6 h-m-p 0.0002 0.0042 268.8767 ----------.. | 4/7
7 h-m-p 0.0000 0.0001 79.0550 ++ 314.539200 m 0.0001 82 | 5/7
8 h-m-p 0.3131 8.0000 0.0000 +++ 314.539200 m 8.0000 93 | 5/7
9 h-m-p 0.0510 8.0000 0.0004 ++++ 314.539200 m 8.0000 107 | 5/7
10 h-m-p 0.0028 0.0139 0.2488 --------C 314.539200 0 0.0000 127 | 5/7
11 h-m-p 0.0160 8.0000 0.0000 ----N 314.539200 0 0.0000 143 | 5/7
12 h-m-p 0.0038 1.8777 0.5466 +++++ 314.539193 m 1.8777 158 | 6/7
13 h-m-p 1.6000 8.0000 0.0000 N 314.539193 0 1.6000 170 | 6/7
14 h-m-p 0.0160 8.0000 0.0000 Y 314.539193 0 0.0160 181
Out..
lnL = -314.539193
182 lfun, 546 eigenQcodon, 1456 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 0
0.063482 0.072842 0.030736 0.106595 0.000100 1.109540 0.423163 0.113056 168.721369
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.363803
np = 9
lnL0 = -326.061374
Iterating by ming2
Initial: fx= 326.061374
x= 0.06348 0.07284 0.03074 0.10660 0.00011 1.10954 0.42316 0.11306 168.72137
1 h-m-p 0.0000 0.0000 42.3746 ++ 326.043278 m 0.0000 14 | 1/9
2 h-m-p 0.0003 0.1486 7.7350 +++++ 319.277411 m 0.1486 29 | 2/9
3 h-m-p 0.0002 0.0008 44.3949 ++ 319.041315 m 0.0008 41 | 3/9
4 h-m-p 0.0001 0.0003 517.9001 ++ 318.401216 m 0.0003 53 | 4/9
5 h-m-p 0.0005 0.0027 55.8750 ++ 317.656494 m 0.0027 65 | 5/9
6 h-m-p 0.0038 0.0190 8.6091 ++ 314.539176 m 0.0190 77 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 N 314.539176 0 0.4000 89
Out..
lnL = -314.539176
90 lfun, 360 eigenQcodon, 1080 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -314.538157 S = -314.537966 -0.000073
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:01
did 20 / 41 patterns 0:01
did 30 / 41 patterns 0:01
did 40 / 41 patterns 0:01
did 41 / 41 patterns 0:01
Time used: 0:01
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 0
0.037968 0.038136 0.104239 0.072032 0.000100 0.413934 1.240067
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.909615
np = 7
lnL0 = -334.058907
Iterating by ming2
Initial: fx= 334.058907
x= 0.03797 0.03814 0.10424 0.07203 0.00011 0.41393 1.24007
1 h-m-p 0.0000 0.0000 149.6861 ++ 333.817130 m 0.0000 12 | 1/7
2 h-m-p 0.0002 0.0925 7.1453 ----------.. | 1/7
3 h-m-p 0.0000 0.0005 149.8188 +++ 322.578024 m 0.0005 41 | 2/7
4 h-m-p 0.0130 0.2773 4.8773 -------------.. | 2/7
5 h-m-p 0.0000 0.0000 134.7107 ++ 322.538877 m 0.0000 72 | 3/7
6 h-m-p 0.0009 0.4283 3.2712 -----------.. | 3/7
7 h-m-p 0.0000 0.0004 109.1956 +++ 317.183212 m 0.0004 102 | 4/7
8 h-m-p 0.0139 0.6646 2.4519 -------------.. | 4/7
9 h-m-p 0.0000 0.0004 78.7606 +++ 314.539216 m 0.0004 134 | 5/7
10 h-m-p 1.6000 8.0000 0.0000 ++ 314.539216 m 8.0000 144 | 5/7
11 h-m-p 0.0270 8.0000 0.0011 +++++ 314.539216 m 8.0000 159 | 5/7
12 h-m-p 0.0164 8.0000 0.5512 +++++ 314.539213 m 8.0000 174 | 5/7
13 h-m-p 1.6000 8.0000 0.2068 ++ 314.539212 m 8.0000 186 | 5/7
14 h-m-p 0.6715 8.0000 2.4640 ++ 314.539212 m 8.0000 198 | 5/7
15 h-m-p 1.6000 8.0000 1.0933 ++ 314.539212 m 8.0000 208 | 5/7
16 h-m-p 0.5540 2.7698 12.8101 ----------Y 314.539212 0 0.0000 228 | 5/7
17 h-m-p 1.6000 8.0000 0.0000 -------N 314.539212 0 0.0000 245 | 5/7
18 h-m-p 0.0187 8.0000 0.0000 ------Y 314.539212 0 0.0000 263
Out..
lnL = -314.539212
264 lfun, 2904 eigenQcodon, 10560 P(t)
Time used: 0:04
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 0
0.029034 0.091340 0.103807 0.074024 0.000100 0.900000 0.822469 1.324326 155.159063
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.695824
np = 9
lnL0 = -323.044934
Iterating by ming2
Initial: fx= 323.044934
x= 0.02903 0.09134 0.10381 0.07402 0.00011 0.90000 0.82247 1.32433 155.15906
1 h-m-p 0.0000 0.0000 53.7378 ++ 323.004140 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0001 1814.0010 +YYYYCCC 319.971347 6 0.0000 35 | 1/9
3 h-m-p 0.0330 0.1648 2.0500 ++ 319.101480 m 0.1648 47 | 2/9
4 h-m-p 0.0014 0.0071 17.0989 ++ 318.890330 m 0.0071 59 | 3/9
5 h-m-p 0.0008 0.0038 51.9734 ++ 317.767771 m 0.0038 71 | 4/9
6 h-m-p 0.0000 0.0000 156519.4312 +YYCCCC 317.231017 5 0.0000 92 | 4/9
7 h-m-p 0.0025 0.0125 10.8331 ++ 316.921686 m 0.0125 104 | 5/9
8 h-m-p 0.0093 0.0482 9.0590
QuantileBeta(0.15, 0.00500, 2.32893) = 1.112021e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
+ 314.805642 m 0.0482 116
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.092765e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055903e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
| 5/9
9 h-m-p 1.6000 8.0000 0.0839
QuantileBeta(0.15, 0.00500, 2.48969) = 1.024095e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44377) = 1.047769e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.43230) = 1.053858e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42943) = 1.055392e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42871) = 1.055776e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42853) = 1.055872e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42848) = 1.055896e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055902e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055903e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.092765e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42860) = 1.055835e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42834) = 1.055972e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
| 5/9
10 h-m-p 0.0000 0.0000 99.9434
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
+ 314.539209 m 0.0000 158
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.092765e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055903e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
| 6/9
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
+ 314.539209 m 8.0000 170
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.092765e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42860) = 1.055835e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42834) = 1.055972e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42847) = 1.055904e-160 2000 rounds
| 6/9
12 h-m-p 0.0160 8.0000 0.0030
QuantileBeta(0.15, 0.00500, 2.42846) = 1.055906e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42845) = 1.055914e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.42839) = 1.055945e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.42816) = 1.056069e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.42724) = 1.056564e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
+ 314.539180 m 8.0000 188
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.094100e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42619) = 1.057125e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42594) = 1.057262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42606) = 1.057194e-160 2000 rounds
| 6/9
13 h-m-p 1.6000 8.0000 0.0007
QuantileBeta(0.15, 0.00500, 2.42595) = 1.057256e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42560) = 1.057444e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
+ 314.539179 m 8.0000 203
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.094423e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42561) = 1.057438e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42535) = 1.057575e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42548) = 1.057506e-160 2000 rounds
| 6/9
14 h-m-p 0.4412 8.0000 0.0132
QuantileBeta(0.15, 0.00500, 2.42490) = 1.057819e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42315) = 1.058758e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.41617) = 1.062531e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
+ 314.539175 m 8.0000 219
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.100321e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41506) = 1.063135e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41480) = 1.063274e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41493) = 1.063205e-160 2000 rounds
| 6/9
15 h-m-p 1.6000 8.0000 0.0069
QuantileBeta(0.15, 0.00500, 2.41382) = 1.063807e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41050) = 1.065617e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
+ 314.539175 m 8.0000 234
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.103444e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40951) = 1.066153e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40926) = 1.066292e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40939) = 1.066222e-160 2000 rounds
| 6/9
16 h-m-p 0.9457 8.0000 0.0587
QuantileBeta(0.15, 0.00500, 2.40384) = 1.069257e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38722) = 1.078465e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
+ 314.539175 m 8.0000 249
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.130584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36262) = 1.092374e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36237) = 1.092519e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36250) = 1.092447e-160 2000 rounds
| 6/9
17 h-m-p 1.6000 8.0000 0.0446
QuantileBeta(0.15, 0.00500, 2.35537) = 1.096546e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.33399) = 1.109027e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
+ 314.539174 m 8.0000 264
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.152113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32698) = 1.113176e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32673) = 1.113325e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
| 6/9
18 h-m-p 0.0460 0.2298 0.2643
QuantileBeta(0.15, 0.00500, 2.32565) = 1.113972e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32201) = 1.116141e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
+ 314.539174 m 0.2298 279
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.155856e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32092) = 1.116792e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32067) = 1.116941e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32080) = 1.116866e-160 2000 rounds
| 7/9
19 h-m-p 0.0869 8.0000 0.2655
QuantileBeta(0.15, 0.00500, 2.32686) = 1.113250e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32231) = 1.115960e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32117) = 1.116640e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32089) = 1.116810e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32084) = 1.116843e-160 2000 rounds
Y 314.539174 0 0.0003 297
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.155841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32094) = 1.116777e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32069) = 1.116927e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
| 7/9
20 h-m-p 0.1500 8.0000 0.0006
QuantileBeta(0.15, 0.00500, 2.32084) = 1.116838e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32083) = 1.116849e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116851e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
N 314.539174 0 0.0047 312
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.155841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32095) = 1.116777e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32070) = 1.116927e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
| 7/9
21 h-m-p 0.0476 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
Y 314.539174 0 0.0007 328
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
Out..
lnL = -314.539174
329 lfun, 3948 eigenQcodon, 14476 P(t)
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -314.537959 S = -314.537934 -0.000011
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:09
did 20 / 41 patterns 0:09
did 30 / 41 patterns 0:09
did 40 / 41 patterns 0:09
did 41 / 41 patterns 0:09
QuantileBeta(0.15, 0.00500, 2.32082) = 1.116852e-160 2000 rounds
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=80
NC_011896_1_WP_010908071_1_1046_MLBR_RS16095 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
NC_002677_1_NP_301747_1_619_ML1010 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
**************************************************
NC_011896_1_WP_010908071_1_1046_MLBR_RS16095 AVLARYSAALVRGDMCDKLAVHITSATSLG
NC_002677_1_NP_301747_1_619_ML1010 AVLARYSAALVRGDMCDKLAVHITSATSLG
NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230 AVLARYSAALVRGDMCDKLAVHITSATSLG
NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315 AVLARYSAALVRGDMCDKLAVHITSATSLG
******************************
>NC_011896_1_WP_010908071_1_1046_MLBR_RS16095 GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC >NC_002677_1_NP_301747_1_619_ML1010 GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC >NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230 GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC >NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315 GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>NC_011896_1_WP_010908071_1_1046_MLBR_RS16095 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP AVLARYSAALVRGDMCDKLAVHITSATSLG >NC_002677_1_NP_301747_1_619_ML1010 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP AVLARYSAALVRGDMCDKLAVHITSATSLG >NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP AVLARYSAALVRGDMCDKLAVHITSATSLG >NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315 VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP AVLARYSAALVRGDMCDKLAVHITSATSLG
#NEXUS
[ID: 0066520342]
begin taxa;
dimensions ntax=4;
taxlabels
NC_011896_1_WP_010908071_1_1046_MLBR_RS16095
NC_002677_1_NP_301747_1_619_ML1010
NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230
NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908071_1_1046_MLBR_RS16095,
2 NC_002677_1_NP_301747_1_619_ML1010,
3 NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230,
4 NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06543344,2:0.06786986,3:0.06991688,4:0.06647017);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06543344,2:0.06786986,3:0.06991688,4:0.06647017);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -322.05 -326.42
2 -322.11 -325.58
--------------------------------------
TOTAL -322.08 -326.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.492384 0.049085 0.111649 0.918190 0.460304 1501.00 1501.00 1.000
r(A<->C){all} 0.160370 0.019466 0.000001 0.442189 0.124547 268.49 287.60 1.000
r(A<->G){all} 0.172695 0.020356 0.000034 0.457872 0.136214 309.43 364.98 1.000
r(A<->T){all} 0.165308 0.019764 0.000007 0.452955 0.128975 213.27 311.52 1.006
r(C<->G){all} 0.164070 0.020387 0.000040 0.456697 0.122524 391.76 397.53 1.000
r(C<->T){all} 0.164476 0.018929 0.000044 0.449293 0.128260 253.13 362.65 1.000
r(G<->T){all} 0.173081 0.021315 0.000027 0.466261 0.135325 350.80 362.93 1.003
pi(A){all} 0.180659 0.000616 0.134134 0.231639 0.179772 1374.04 1437.52 1.000
pi(C){all} 0.336348 0.000903 0.281970 0.398958 0.336122 1216.14 1314.14 1.000
pi(G){all} 0.318938 0.000905 0.261873 0.379277 0.318382 1390.71 1445.86 1.000
pi(T){all} 0.164055 0.000563 0.118878 0.210361 0.162674 1400.89 1412.39 1.000
alpha{1,2} 0.405426 0.216082 0.000159 1.330127 0.234933 1328.81 1393.74 1.000
alpha{3} 0.453299 0.223251 0.000123 1.428646 0.301880 1163.76 1317.27 1.000
pinvar{all} 0.992195 0.000101 0.974261 0.999996 0.995419 1305.39 1403.19 1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML1010/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 80
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 | Ser TCT 0 0 0 0 | Tyr TAT 1 1 1 1 | Cys TGT 1 1 1 1
TTC 0 0 0 0 | TCC 0 0 0 0 | TAC 1 1 1 1 | TGC 2 2 2 2
Leu TTA 1 1 1 1 | TCA 1 1 1 1 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 0 0 0 0 | TCG 2 2 2 2 | TAG 0 0 0 0 | Trp TGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 | Pro CCT 2 2 2 2 | His CAT 1 1 1 1 | Arg CGT 1 1 1 1
CTC 0 0 0 0 | CCC 0 0 0 0 | CAC 4 4 4 4 | CGC 2 2 2 2
CTA 1 1 1 1 | CCA 2 2 2 2 | Gln CAA 1 1 1 1 | CGA 2 2 2 2
CTG 3 3 3 3 | CCG 2 2 2 2 | CAG 0 0 0 0 | CGG 4 4 4 4
------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 | Thr ACT 1 1 1 1 | Asn AAT 0 0 0 0 | Ser AGT 1 1 1 1
ATC 0 0 0 0 | ACC 1 1 1 1 | AAC 2 2 2 2 | AGC 1 1 1 1
ATA 1 1 1 1 | ACA 0 0 0 0 | Lys AAA 0 0 0 0 | Arg AGA 0 0 0 0
Met ATG 1 1 1 1 | ACG 1 1 1 1 | AAG 2 2 2 2 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 | Ala GCT 3 3 3 3 | Asp GAT 2 2 2 2 | Gly GGT 2 2 2 2
GTC 4 4 4 4 | GCC 6 6 6 6 | GAC 3 3 3 3 | GGC 3 3 3 3
GTA 1 1 1 1 | GCA 3 3 3 3 | Glu GAA 1 1 1 1 | GGA 0 0 0 0
GTG 3 3 3 3 | GCG 3 3 3 3 | GAG 0 0 0 0 | GGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908071_1_1046_MLBR_RS16095
position 1: T:0.11250 C:0.31250 A:0.13750 G:0.43750
position 2: T:0.18750 C:0.33750 A:0.22500 G:0.25000
position 3: T:0.18750 C:0.36250 A:0.17500 G:0.27500
Average T:0.16250 C:0.33750 A:0.17917 G:0.32083
#2: NC_002677_1_NP_301747_1_619_ML1010
position 1: T:0.11250 C:0.31250 A:0.13750 G:0.43750
position 2: T:0.18750 C:0.33750 A:0.22500 G:0.25000
position 3: T:0.18750 C:0.36250 A:0.17500 G:0.27500
Average T:0.16250 C:0.33750 A:0.17917 G:0.32083
#3: NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230
position 1: T:0.11250 C:0.31250 A:0.13750 G:0.43750
position 2: T:0.18750 C:0.33750 A:0.22500 G:0.25000
position 3: T:0.18750 C:0.36250 A:0.17500 G:0.27500
Average T:0.16250 C:0.33750 A:0.17917 G:0.32083
#4: NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315
position 1: T:0.11250 C:0.31250 A:0.13750 G:0.43750
position 2: T:0.18750 C:0.33750 A:0.22500 G:0.25000
position 3: T:0.18750 C:0.36250 A:0.17500 G:0.27500
Average T:0.16250 C:0.33750 A:0.17917 G:0.32083
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 4 | Cys C TGT 4
TTC 0 | TCC 0 | TAC 4 | TGC 8
Leu L TTA 4 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 8 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 8 | His H CAT 4 | Arg R CGT 4
CTC 0 | CCC 0 | CAC 16 | CGC 8
CTA 4 | CCA 8 | Gln Q CAA 4 | CGA 8
CTG 12 | CCG 8 | CAG 0 | CGG 16
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 4 | Asn N AAT 0 | Ser S AGT 4
ATC 0 | ACC 4 | AAC 8 | AGC 4
ATA 4 | ACA 0 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 4 | ACG 4 | AAG 8 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 12 | Asp D GAT 8 | Gly G GGT 8
GTC 16 | GCC 24 | GAC 12 | GGC 12
GTA 4 | GCA 12 | Glu E GAA 4 | GGA 0
GTG 12 | GCG 12 | GAG 0 | GGG 4
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11250 C:0.31250 A:0.13750 G:0.43750
position 2: T:0.18750 C:0.33750 A:0.22500 G:0.25000
position 3: T:0.18750 C:0.36250 A:0.17500 G:0.27500
Average T:0.16250 C:0.33750 A:0.17917 G:0.32083
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 6): -314.539174 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 155.159063
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908071_1_1046_MLBR_RS16095: 0.000004, NC_002677_1_NP_301747_1_619_ML1010: 0.000004, NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230: 0.000004, NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 155.15906
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 173.6 66.4 155.1591 0.0000 0.0000 0.0 0.0
5..2 0.000 173.6 66.4 155.1591 0.0000 0.0000 0.0 0.0
5..3 0.000 173.6 66.4 155.1591 0.0000 0.0000 0.0 0.0
5..4 0.000 173.6 66.4 155.1591 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 7): -314.539193 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.599984 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908071_1_1046_MLBR_RS16095: 0.000004, NC_002677_1_NP_301747_1_619_ML1010: 0.000004, NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230: 0.000004, NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.59998 0.40002
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 173.6 66.4 1.0000 0.0000 0.0000 0.0 0.0
5..2 0.000 173.6 66.4 1.0000 0.0000 0.0000 0.0 0.0
5..3 0.000 173.6 66.4 1.0000 0.0000 0.0000 0.0 0.0
5..4 0.000 173.6 66.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 9): -314.539176 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.707403 0.201848 0.000001 168.722191
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908071_1_1046_MLBR_RS16095: 0.000004, NC_002677_1_NP_301747_1_619_ML1010: 0.000004, NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230: 0.000004, NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.70740 0.20185 0.09075
w: 0.00000 1.00000 168.72219
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 173.6 66.4 15.5133 0.0000 0.0000 0.0 0.0
5..2 0.000 173.6 66.4 15.5133 0.0000 0.0000 0.0 0.0
5..3 0.000 173.6 66.4 15.5133 0.0000 0.0000 0.0 0.0
5..4 0.000 173.6 66.4 15.5133 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908071_1_1046_MLBR_RS16095)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908071_1_1046_MLBR_RS16095)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:01
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 7): -314.539212 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 15.277977 32.408618
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908071_1_1046_MLBR_RS16095: 0.000004, NC_002677_1_NP_301747_1_619_ML1010: 0.000004, NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230: 0.000004, NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 15.27798 q = 32.40862
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.21473 0.25075 0.27342 0.29215 0.30938 0.32641 0.34433 0.36462 0.39046 0.43469
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 173.6 66.4 0.3201 0.0000 0.0000 0.0 0.0
5..2 0.000 173.6 66.4 0.3201 0.0000 0.0000 0.0 0.0
5..3 0.000 173.6 66.4 0.3201 0.0000 0.0000 0.0 0.0
5..4 0.000 173.6 66.4 0.3201 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 9): -314.539174 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 2.320821 155.583843
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908071_1_1046_MLBR_RS16095: 0.000004, NC_002677_1_NP_301747_1_619_ML1010: 0.000004, NZ_LVXE01000017_1_WP_010908071_1_640_A3216_RS15230: 0.000004, NZ_LYPH01000015_1_WP_010908071_1_492_A8144_RS02315: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 2.32082
(p1 = 0.99999) w = 155.58384
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 155.58384
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 173.6 66.4 155.5823 0.0000 0.0000 0.0 0.0
5..2 0.000 173.6 66.4 155.5823 0.0000 0.0000 0.0 0.0
5..3 0.000 173.6 66.4 155.5823 0.0000 0.0000 0.0 0.0
5..4 0.000 173.6 66.4 155.5823 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908071_1_1046_MLBR_RS16095)
Pr(w>1) post mean +- SE for w
1 V 1.000** 155.582
2 R 1.000** 155.582
3 G 1.000** 155.582
4 S 1.000** 155.582
5 Q 1.000** 155.582
6 H 1.000** 155.582
7 K 1.000** 155.582
8 V 1.000** 155.582
9 A 1.000** 155.582
10 A 1.000** 155.582
11 R 1.000** 155.582
12 R 1.000** 155.582
13 V 1.000** 155.582
14 H 1.000** 155.582
15 H 1.000** 155.582
16 R 1.000** 155.582
17 A 1.000** 155.582
18 C 1.000** 155.582
19 A 1.000** 155.582
20 N 1.000** 155.582
21 L 1.000** 155.582
22 H 1.000** 155.582
23 G 1.000** 155.582
24 A 1.000** 155.582
25 A 1.000** 155.582
26 V 1.000** 155.582
27 D 1.000** 155.582
28 E 1.000** 155.582
29 D 1.000** 155.582
30 C 1.000** 155.582
31 T 1.000** 155.582
32 N 1.000** 155.582
33 A 1.000** 155.582
34 G 1.000** 155.582
35 R 1.000** 155.582
36 G 1.000** 155.582
37 P 1.000** 155.582
38 P 1.000** 155.582
39 D 1.000** 155.582
40 P 1.000** 155.582
41 P 1.000** 155.582
42 P 1.000** 155.582
43 A 1.000** 155.582
44 R 1.000** 155.582
45 A 1.000** 155.582
46 R 1.000** 155.582
47 V 1.000** 155.582
48 S 1.000** 155.582
49 Y 1.000** 155.582
50 P 1.000** 155.582
51 A 1.000** 155.582
52 V 1.000** 155.582
53 L 1.000** 155.582
54 A 1.000** 155.582
55 R 1.000** 155.582
56 Y 1.000** 155.582
57 S 1.000** 155.582
58 A 1.000** 155.582
59 A 1.000** 155.582
60 L 1.000** 155.582
61 V 1.000** 155.582
62 R 1.000** 155.582
63 G 1.000** 155.582
64 D 1.000** 155.582
65 M 1.000** 155.582
66 C 1.000** 155.582
67 D 1.000** 155.582
68 K 1.000** 155.582
69 L 1.000** 155.582
70 A 1.000** 155.582
71 V 1.000** 155.582
72 H 1.000** 155.582
73 I 1.000** 155.582
74 T 1.000** 155.582
75 S 1.000** 155.582
76 A 1.000** 155.582
77 T 1.000** 155.582
78 S 1.000** 155.582
79 L 1.000** 155.582
80 G 1.000** 155.582
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908071_1_1046_MLBR_RS16095)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:10
Model 1: NearlyNeutral -314.539193 Model 2: PositiveSelection -314.539176 Model 0: one-ratio -314.539174 Model 7: beta -314.539212 Model 8: beta&w>1 -314.539174 Model 0 vs 1 3.800000001774606E-5 Model 2 vs 1 3.400000002784509E-5 Model 8 vs 7 7.600000003549212E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
