--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:16:51 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML1010/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -322.05          -326.42
2       -322.11          -325.58
--------------------------------------
TOTAL     -322.08          -326.09
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.492384    0.049085    0.111649    0.918190    0.460304   1501.00   1501.00    1.000
r(A<->C){all}   0.160370    0.019466    0.000001    0.442189    0.124547    268.49    287.60    1.000
r(A<->G){all}   0.172695    0.020356    0.000034    0.457872    0.136214    309.43    364.98    1.000
r(A<->T){all}   0.165308    0.019764    0.000007    0.452955    0.128975    213.27    311.52    1.006
r(C<->G){all}   0.164070    0.020387    0.000040    0.456697    0.122524    391.76    397.53    1.000
r(C<->T){all}   0.164476    0.018929    0.000044    0.449293    0.128260    253.13    362.65    1.000
r(G<->T){all}   0.173081    0.021315    0.000027    0.466261    0.135325    350.80    362.93    1.003
pi(A){all}      0.180659    0.000616    0.134134    0.231639    0.179772   1374.04   1437.52    1.000
pi(C){all}      0.336348    0.000903    0.281970    0.398958    0.336122   1216.14   1314.14    1.000
pi(G){all}      0.318938    0.000905    0.261873    0.379277    0.318382   1390.71   1445.86    1.000
pi(T){all}      0.164055    0.000563    0.118878    0.210361    0.162674   1400.89   1412.39    1.000
alpha{1,2}      0.405426    0.216082    0.000159    1.330127    0.234933   1328.81   1393.74    1.000
alpha{3}        0.453299    0.223251    0.000123    1.428646    0.301880   1163.76   1317.27    1.000
pinvar{all}     0.992195    0.000101    0.974261    0.999996    0.995419   1305.39   1403.19    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-314.539193
Model 2: PositiveSelection	-314.539176
Model 0: one-ratio	-314.539174
Model 7: beta	-314.539212
Model 8: beta&w>1	-314.539174


Model 0 vs 1	3.800000001774606E-5

Model 2 vs 1	3.400000002784509E-5

Model 8 vs 7	7.600000003549212E-5
>C1
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C2
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C3
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C4
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=80 

C1              VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C2              VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C3              VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C4              VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
                **************************************************

C1              AVLARYSAALVRGDMCDKLAVHITSATSLG
C2              AVLARYSAALVRGDMCDKLAVHITSATSLG
C3              AVLARYSAALVRGDMCDKLAVHITSATSLG
C4              AVLARYSAALVRGDMCDKLAVHITSATSLG
                ******************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   80 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   80 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [960]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [960]--->[960]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.351 Mb, Max= 30.506 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C2              VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C3              VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
C4              VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
                **************************************************

C1              AVLARYSAALVRGDMCDKLAVHITSATSLG
C2              AVLARYSAALVRGDMCDKLAVHITSATSLG
C3              AVLARYSAALVRGDMCDKLAVHITSATSLG
C4              AVLARYSAALVRGDMCDKLAVHITSATSLG
                ******************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
C2              GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
C3              GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
C4              GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
                **************************************************

C1              CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
C2              CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
C3              CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
C4              CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
                **************************************************

C1              GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
C2              GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
C3              GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
C4              GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
                **************************************************

C1              GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
C2              GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
C3              GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
C4              GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
                **************************************************

C1              TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
C2              TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
C3              TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
C4              TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
                ****************************************



>C1
GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>C2
GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>C3
GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>C4
GTGCGCGGCAGTCAACACAAGGTCGCCGCCCGTCGAGTGCACCACCGAGC
CTGTGCAAACCTGCATGGCGCCGCCGTCGACGAAGATTGCACCAACGCGG
GTCGGGGTCCACCGGACCCGCCACCTGCTCGGGCTCGGGTCAGCTATCCT
GCGGTATTAGCGCGCTACTCGGCTGCACTGGTGCGGGGGGACATGTGCGA
TAAGCTGGCCGTCCACATAACTTCAGCAACGTCGCTAGGC
>C1
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C2
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C3
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG
>C4
VRGSQHKVAARRVHHRACANLHGAAVDEDCTNAGRGPPDPPPARARVSYP
AVLARYSAALVRGDMCDKLAVHITSATSLG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 240 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579799752
      Setting output file names to "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 751878039
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0066520342
      Seed = 150299874
      Swapseed = 1579799752
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -448.087354 -- -26.620141
         Chain 2 -- -448.087354 -- -26.620141
         Chain 3 -- -448.087354 -- -26.620141
         Chain 4 -- -448.087354 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -448.087354 -- -26.620141
         Chain 2 -- -448.087354 -- -26.620141
         Chain 3 -- -448.087354 -- -26.620141
         Chain 4 -- -448.087354 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-448.087] (-448.087) (-448.087) (-448.087) * [-448.087] (-448.087) (-448.087) (-448.087) 
        500 -- [-325.838] (-327.834) (-328.465) (-328.976) * (-327.617) (-323.594) (-328.164) [-326.475] -- 0:00:00
       1000 -- (-326.413) [-327.910] (-329.183) (-328.855) * (-323.711) (-324.357) (-330.333) [-331.412] -- 0:16:39
       1500 -- (-339.780) (-325.406) [-329.183] (-327.886) * (-326.281) (-327.063) (-331.326) [-324.431] -- 0:11:05
       2000 -- (-326.141) (-324.445) (-326.626) [-326.992] * (-328.137) [-323.913] (-338.308) (-331.134) -- 0:08:19
       2500 -- (-323.264) [-325.424] (-327.627) (-333.224) * (-327.562) (-326.789) [-331.303] (-325.257) -- 0:06:39
       3000 -- (-333.122) (-325.546) [-323.044] (-326.594) * (-328.091) (-324.493) [-330.155] (-328.223) -- 0:05:32
       3500 -- [-330.509] (-327.874) (-330.318) (-326.135) * (-328.060) [-327.782] (-329.659) (-330.316) -- 0:04:44
       4000 -- (-327.079) (-328.616) (-331.293) [-330.023] * (-325.180) (-325.671) (-331.787) [-328.974] -- 0:04:09
       4500 -- [-325.869] (-329.674) (-325.532) (-328.459) * (-327.696) (-327.104) [-326.019] (-326.694) -- 0:03:41
       5000 -- (-333.180) (-328.802) [-324.081] (-323.534) * (-328.002) (-335.107) [-326.490] (-326.448) -- 0:03:19

      Average standard deviation of split frequencies: 0.104757

       5500 -- (-330.476) (-328.327) [-326.947] (-324.836) * [-325.642] (-325.243) (-331.212) (-327.001) -- 0:03:00
       6000 -- (-324.845) (-323.484) [-325.165] (-327.371) * (-328.937) [-322.625] (-331.066) (-322.847) -- 0:02:45
       6500 -- (-327.175) (-323.401) (-330.857) [-323.980] * [-327.376] (-327.681) (-329.679) (-327.542) -- 0:02:32
       7000 -- (-326.090) (-327.368) (-327.982) [-326.210] * (-328.602) (-327.715) (-324.153) [-326.283] -- 0:02:21
       7500 -- (-325.338) [-330.115] (-330.722) (-330.582) * (-325.047) (-325.444) [-326.072] (-325.243) -- 0:02:12
       8000 -- (-326.750) (-325.241) [-327.251] (-326.316) * (-324.698) [-324.799] (-329.903) (-327.689) -- 0:02:04
       8500 -- (-326.753) (-334.608) (-329.372) [-324.759] * (-324.716) [-326.729] (-330.094) (-328.994) -- 0:01:56
       9000 -- (-329.035) (-330.711) [-327.001] (-327.973) * [-329.653] (-326.057) (-334.409) (-323.547) -- 0:01:50
       9500 -- [-324.554] (-328.003) (-327.785) (-330.616) * [-326.633] (-328.781) (-327.659) (-332.622) -- 0:01:44
      10000 -- (-324.616) (-325.725) (-329.246) [-328.924] * (-325.509) (-324.956) [-326.196] (-329.240) -- 0:01:39

      Average standard deviation of split frequencies: 0.117851

      10500 -- [-325.147] (-332.242) (-335.024) (-326.989) * [-325.359] (-326.465) (-331.333) (-323.931) -- 0:01:34
      11000 -- [-322.030] (-323.962) (-329.728) (-323.777) * [-324.654] (-324.620) (-324.274) (-325.992) -- 0:01:29
      11500 -- (-324.121) [-326.676] (-331.098) (-323.600) * (-327.428) (-328.982) (-324.574) [-323.904] -- 0:01:25
      12000 -- (-329.284) [-327.419] (-326.405) (-326.846) * (-326.863) (-330.635) (-326.701) [-325.072] -- 0:01:22
      12500 -- (-332.595) (-326.429) [-326.493] (-322.803) * (-329.821) [-328.302] (-323.438) (-322.869) -- 0:01:19
      13000 -- (-327.972) [-327.068] (-323.799) (-322.473) * (-328.338) (-328.590) [-323.009] (-322.447) -- 0:01:15
      13500 -- [-325.590] (-332.075) (-322.248) (-322.493) * (-332.739) (-336.041) (-325.792) [-323.806] -- 0:01:13
      14000 -- (-329.217) (-322.631) (-322.984) [-325.803] * (-325.013) (-326.120) (-328.472) [-321.536] -- 0:01:10
      14500 -- (-329.661) (-330.051) [-322.249] (-325.431) * (-322.552) (-328.852) (-331.050) [-324.012] -- 0:01:07
      15000 -- (-330.703) (-325.782) [-323.872] (-328.835) * (-323.459) (-328.754) (-333.024) [-321.640] -- 0:01:05

      Average standard deviation of split frequencies: 0.078567

      15500 -- (-328.727) (-329.935) (-322.040) [-322.910] * [-325.075] (-326.071) (-328.367) (-322.376) -- 0:01:03
      16000 -- [-327.854] (-326.674) (-321.405) (-323.791) * [-324.820] (-326.021) (-325.615) (-321.648) -- 0:01:01
      16500 -- (-324.542) [-328.728] (-322.252) (-323.134) * (-322.412) (-329.565) [-324.799] (-323.978) -- 0:00:59
      17000 -- (-326.384) (-325.391) (-321.799) [-323.381] * (-322.786) (-328.416) (-330.910) [-322.193] -- 0:00:57
      17500 -- (-329.514) (-325.814) (-325.358) [-327.827] * [-321.003] (-324.930) (-329.756) (-324.219) -- 0:00:56
      18000 -- (-325.766) (-325.228) [-323.822] (-322.062) * [-325.410] (-328.082) (-325.344) (-324.956) -- 0:00:54
      18500 -- (-325.434) (-326.264) [-322.465] (-322.801) * (-321.365) (-325.989) (-327.537) [-322.287] -- 0:00:53
      19000 -- (-329.911) (-327.995) (-323.337) [-324.082] * (-321.568) (-328.705) (-328.163) [-322.118] -- 0:00:51
      19500 -- [-321.442] (-324.311) (-326.952) (-325.537) * (-322.501) (-325.421) [-325.949] (-322.870) -- 0:00:50
      20000 -- (-332.878) (-323.649) [-322.172] (-323.243) * (-322.937) (-330.576) [-325.911] (-323.101) -- 0:00:49

      Average standard deviation of split frequencies: 0.015207

      20500 -- (-328.038) (-328.617) [-323.207] (-325.510) * (-324.209) [-327.054] (-323.312) (-324.438) -- 0:00:47
      21000 -- (-327.451) [-324.571] (-324.048) (-324.707) * (-323.130) (-322.863) [-321.727] (-321.115) -- 0:00:46
      21500 -- [-330.469] (-326.079) (-321.111) (-323.777) * (-321.115) [-329.623] (-322.657) (-323.149) -- 0:00:45
      22000 -- (-329.960) (-323.085) [-321.004] (-326.229) * (-321.538) (-330.752) [-322.650] (-325.177) -- 0:00:44
      22500 -- (-330.349) (-330.855) (-320.943) [-324.885] * (-321.566) [-327.833] (-322.109) (-327.738) -- 0:00:43
      23000 -- [-332.072] (-329.165) (-320.922) (-321.893) * (-322.399) (-331.510) (-325.557) [-326.978] -- 0:00:42
      23500 -- (-329.643) [-328.759] (-321.714) (-321.956) * (-322.206) (-330.333) [-323.685] (-323.653) -- 0:01:23
      24000 -- (-328.657) (-330.367) [-325.128] (-322.823) * (-321.863) (-322.067) (-322.409) [-320.813] -- 0:01:21
      24500 -- (-327.231) (-325.800) (-321.684) [-321.101] * (-322.677) (-325.288) (-326.683) [-321.773] -- 0:01:19
      25000 -- (-333.148) (-328.764) (-322.417) [-323.053] * (-321.631) [-323.033] (-326.851) (-321.959) -- 0:01:18

      Average standard deviation of split frequencies: 0.036262

      25500 -- (-333.680) (-324.823) (-322.732) [-322.088] * [-321.326] (-322.926) (-323.115) (-321.204) -- 0:01:16
      26000 -- (-320.443) (-326.020) (-325.396) [-326.399] * (-321.220) [-322.039] (-321.804) (-321.281) -- 0:01:14
      26500 -- (-322.627) (-326.892) (-322.052) [-326.497] * [-321.596] (-328.381) (-324.502) (-322.257) -- 0:01:13
      27000 -- (-323.476) (-328.375) (-324.055) [-322.661] * [-320.905] (-321.310) (-322.338) (-322.615) -- 0:01:12
      27500 -- (-322.298) (-328.025) (-323.732) [-322.284] * (-323.949) (-322.359) (-326.160) [-323.813] -- 0:01:10
      28000 -- (-324.703) [-327.116] (-321.154) (-321.760) * (-321.403) (-320.680) [-322.385] (-324.738) -- 0:01:09
      28500 -- (-321.903) (-331.175) (-323.658) [-323.896] * (-321.732) (-321.033) [-323.770] (-321.603) -- 0:01:08
      29000 -- (-322.002) [-325.395] (-322.269) (-322.070) * (-323.108) [-322.196] (-324.310) (-321.872) -- 0:01:06
      29500 -- (-326.675) (-328.736) (-324.565) [-324.668] * (-325.572) [-322.387] (-323.639) (-322.702) -- 0:01:05
      30000 -- (-323.151) (-329.867) (-323.483) [-322.404] * (-324.784) (-323.013) [-324.088] (-324.667) -- 0:01:04

      Average standard deviation of split frequencies: 0.040992

      30500 -- (-323.420) (-324.349) [-324.214] (-328.144) * (-323.511) (-322.413) [-322.731] (-322.928) -- 0:01:03
      31000 -- (-321.016) [-328.182] (-321.084) (-320.742) * (-324.119) (-327.782) [-321.204] (-324.429) -- 0:01:02
      31500 -- [-323.847] (-327.548) (-322.969) (-321.596) * (-323.034) [-322.505] (-323.847) (-321.512) -- 0:01:01
      32000 -- [-320.894] (-327.908) (-321.568) (-327.001) * (-321.444) [-325.572] (-327.354) (-321.025) -- 0:01:00
      32500 -- [-323.517] (-329.813) (-323.523) (-324.475) * [-324.160] (-324.344) (-321.593) (-322.414) -- 0:00:59
      33000 -- (-321.818) [-329.067] (-321.244) (-328.315) * (-322.480) [-324.768] (-322.274) (-323.879) -- 0:00:58
      33500 -- (-324.064) [-327.324] (-320.521) (-321.553) * (-322.009) (-323.852) (-322.511) [-322.970] -- 0:00:57
      34000 -- [-321.183] (-328.030) (-323.192) (-323.927) * (-321.474) [-323.674] (-322.491) (-321.262) -- 0:00:56
      34500 -- (-321.109) (-327.353) [-326.250] (-324.055) * (-322.712) (-327.563) (-324.120) [-322.223] -- 0:00:55
      35000 -- (-321.538) (-328.184) (-324.248) [-321.188] * [-323.460] (-325.917) (-322.958) (-323.859) -- 0:00:55

      Average standard deviation of split frequencies: 0.052378

      35500 -- (-322.234) [-327.469] (-321.568) (-330.508) * [-321.801] (-323.063) (-324.439) (-323.525) -- 0:00:54
      36000 -- (-322.748) (-326.689) [-321.284] (-321.803) * (-322.086) (-321.021) (-321.857) [-321.796] -- 0:00:53
      36500 -- [-321.230] (-330.262) (-323.101) (-322.478) * (-323.811) [-321.492] (-321.826) (-322.865) -- 0:00:52
      37000 -- (-320.694) (-330.854) (-323.209) [-324.748] * (-329.899) [-321.551] (-326.095) (-324.978) -- 0:00:52
      37500 -- (-322.505) (-333.220) [-324.710] (-321.821) * (-326.333) [-321.473] (-326.181) (-322.840) -- 0:00:51
      38000 -- (-323.402) (-327.163) (-322.270) [-326.357] * (-325.104) (-323.363) (-322.826) [-321.354] -- 0:00:50
      38500 -- (-324.093) (-329.548) [-323.687] (-322.567) * [-321.713] (-325.636) (-322.567) (-321.995) -- 0:00:49
      39000 -- (-323.508) (-336.414) [-325.543] (-325.685) * [-321.913] (-326.502) (-323.162) (-321.224) -- 0:00:49
      39500 -- (-320.931) (-328.593) (-327.266) [-324.363] * (-323.117) [-322.351] (-322.293) (-323.376) -- 0:00:48
      40000 -- [-322.125] (-321.244) (-333.898) (-321.109) * (-321.600) [-320.707] (-323.013) (-321.170) -- 0:00:48

      Average standard deviation of split frequencies: 0.038640

      40500 -- [-322.683] (-323.476) (-322.717) (-320.733) * (-321.614) [-322.009] (-321.294) (-321.751) -- 0:00:47
      41000 -- (-321.001) (-322.703) (-323.915) [-325.992] * (-325.463) [-321.651] (-322.203) (-326.018) -- 0:00:46
      41500 -- (-326.160) (-327.303) (-323.334) [-323.928] * (-323.564) (-323.693) (-322.568) [-321.822] -- 0:00:46
      42000 -- (-323.136) (-326.634) (-321.180) [-322.602] * (-327.000) [-321.673] (-322.489) (-323.490) -- 0:00:45
      42500 -- (-324.828) (-322.699) [-321.290] (-322.519) * (-324.352) (-326.143) [-320.490] (-322.261) -- 0:00:45
      43000 -- (-323.105) [-321.054] (-321.325) (-324.103) * (-321.479) (-321.328) (-322.395) [-322.208] -- 0:00:44
      43500 -- [-321.680] (-325.891) (-321.262) (-323.102) * [-322.224] (-323.507) (-320.949) (-321.915) -- 0:00:43
      44000 -- (-323.412) [-320.808] (-321.655) (-322.937) * (-322.201) (-323.881) [-320.940] (-322.439) -- 0:00:43
      44500 -- (-321.728) [-321.450] (-322.934) (-323.531) * (-321.442) (-322.914) (-322.409) [-322.445] -- 0:00:42
      45000 -- (-321.968) (-321.040) [-322.370] (-322.456) * (-323.810) (-323.569) (-321.858) [-326.998] -- 0:00:42

      Average standard deviation of split frequencies: 0.034160

      45500 -- [-323.094] (-326.862) (-321.551) (-321.593) * (-324.496) [-324.474] (-321.890) (-324.059) -- 0:00:41
      46000 -- [-322.884] (-321.494) (-323.154) (-322.215) * (-323.609) (-326.420) [-322.185] (-320.893) -- 0:01:02
      46500 -- (-321.406) (-321.108) (-323.522) [-322.200] * [-322.090] (-324.176) (-323.304) (-322.113) -- 0:01:01
      47000 -- (-322.378) (-324.524) [-324.395] (-327.486) * (-322.378) [-322.681] (-322.382) (-322.834) -- 0:01:00
      47500 -- (-324.157) (-325.600) (-331.550) [-321.349] * (-321.056) (-320.965) [-321.555] (-324.701) -- 0:01:00
      48000 -- (-322.585) (-322.320) (-326.365) [-322.549] * (-324.647) (-325.367) (-330.517) [-322.512] -- 0:00:59
      48500 -- (-321.485) (-324.624) [-322.257] (-322.693) * [-322.092] (-325.466) (-332.944) (-322.536) -- 0:00:58
      49000 -- (-324.677) (-321.516) (-322.357) [-321.193] * (-328.870) (-322.246) (-321.187) [-321.101] -- 0:00:58
      49500 -- [-322.395] (-325.337) (-321.168) (-322.029) * (-324.556) (-325.061) (-322.255) [-320.662] -- 0:00:57
      50000 -- (-323.195) (-325.535) [-323.058] (-320.915) * (-323.528) (-328.394) [-322.143] (-325.788) -- 0:00:57

      Average standard deviation of split frequencies: 0.018608

      50500 -- [-322.251] (-321.097) (-322.872) (-321.446) * (-322.361) [-322.617] (-322.465) (-322.180) -- 0:00:56
      51000 -- (-326.126) (-323.181) [-321.750] (-325.473) * (-322.240) (-324.760) (-326.032) [-322.977] -- 0:00:55
      51500 -- (-324.239) (-322.785) [-327.985] (-321.542) * [-322.638] (-323.325) (-324.781) (-323.150) -- 0:00:55
      52000 -- [-322.292] (-324.639) (-321.897) (-321.079) * [-322.029] (-328.821) (-321.967) (-322.854) -- 0:00:54
      52500 -- (-322.739) (-322.566) (-321.499) [-322.541] * (-323.102) (-322.329) [-321.975] (-321.009) -- 0:00:54
      53000 -- (-324.835) (-325.853) [-321.022] (-321.225) * [-321.264] (-324.665) (-328.892) (-321.819) -- 0:00:53
      53500 -- (-322.121) (-324.816) [-321.656] (-322.595) * (-324.053) (-320.959) (-320.882) [-321.659] -- 0:00:53
      54000 -- (-326.675) [-323.667] (-321.846) (-321.985) * (-322.642) [-324.165] (-323.359) (-322.627) -- 0:00:52
      54500 -- (-323.915) (-321.547) [-322.511] (-321.400) * [-322.273] (-325.421) (-321.930) (-322.456) -- 0:00:52
      55000 -- (-321.255) (-322.277) [-324.939] (-322.919) * (-322.358) (-321.626) (-325.029) [-324.067] -- 0:00:51

      Average standard deviation of split frequencies: 0.022448

      55500 -- (-328.677) (-322.491) (-321.568) [-323.979] * (-320.783) (-323.632) (-325.513) [-324.369] -- 0:00:51
      56000 -- (-323.404) (-321.910) (-323.786) [-322.946] * (-321.704) [-323.115] (-323.383) (-323.871) -- 0:00:50
      56500 -- (-323.070) (-320.604) [-321.292] (-324.667) * (-322.806) (-321.932) [-321.551] (-323.983) -- 0:00:50
      57000 -- (-321.578) (-321.552) (-323.126) [-322.587] * [-323.274] (-323.913) (-321.471) (-323.726) -- 0:00:49
      57500 -- (-321.038) [-322.495] (-320.608) (-322.677) * [-323.526] (-324.754) (-323.736) (-324.667) -- 0:00:49
      58000 -- (-323.627) (-322.246) [-321.315] (-326.651) * (-323.929) (-323.964) [-321.878] (-321.464) -- 0:00:48
      58500 -- [-321.466] (-324.118) (-322.288) (-325.095) * (-322.699) [-322.373] (-321.771) (-323.716) -- 0:00:48
      59000 -- [-323.461] (-322.199) (-323.719) (-322.477) * [-323.159] (-323.109) (-326.376) (-327.522) -- 0:00:47
      59500 -- (-321.358) [-322.239] (-323.131) (-321.081) * (-321.950) [-322.966] (-323.360) (-327.320) -- 0:00:47
      60000 -- (-321.671) (-322.103) [-321.773] (-321.817) * (-324.326) (-324.420) (-324.175) [-321.376] -- 0:00:47

      Average standard deviation of split frequencies: 0.015541

      60500 -- (-322.273) (-324.029) [-322.096] (-322.426) * (-325.254) [-323.106] (-321.612) (-321.376) -- 0:00:46
      61000 -- (-322.125) (-324.932) [-325.208] (-322.406) * (-323.385) [-323.076] (-322.977) (-323.027) -- 0:00:46
      61500 -- (-323.851) (-321.560) [-322.809] (-323.935) * (-322.430) [-323.792] (-323.985) (-322.164) -- 0:00:45
      62000 -- (-324.838) [-322.796] (-321.736) (-323.978) * (-322.612) (-322.550) [-322.229] (-324.571) -- 0:00:45
      62500 -- (-324.010) (-321.876) (-324.738) [-321.305] * (-323.577) (-321.197) (-323.710) [-324.023] -- 0:00:45
      63000 -- (-321.110) (-324.710) (-323.363) [-321.464] * (-324.473) [-324.717] (-321.521) (-326.950) -- 0:00:44
      63500 -- (-324.101) (-326.759) (-322.902) [-321.572] * [-322.850] (-323.323) (-322.082) (-327.950) -- 0:00:44
      64000 -- (-324.994) (-324.799) [-322.211] (-321.336) * (-321.150) (-321.345) [-322.631] (-325.641) -- 0:00:43
      64500 -- (-324.411) (-323.788) [-322.998] (-321.838) * (-322.758) (-321.694) (-321.839) [-328.304] -- 0:00:43
      65000 -- (-320.751) (-322.965) (-323.741) [-321.862] * (-321.851) (-322.379) [-322.052] (-329.796) -- 0:00:43

      Average standard deviation of split frequencies: 0.004762

      65500 -- [-321.900] (-322.814) (-323.752) (-324.704) * (-322.109) (-325.600) [-322.761] (-323.495) -- 0:00:42
      66000 -- (-322.041) (-322.430) [-326.757] (-324.219) * (-323.100) (-326.001) (-324.174) [-323.271] -- 0:00:42
      66500 -- (-321.869) [-324.577] (-322.218) (-325.967) * (-323.702) (-321.040) [-322.211] (-329.111) -- 0:00:42
      67000 -- (-322.298) (-327.313) [-322.230] (-324.594) * (-323.185) (-322.980) [-323.737] (-324.890) -- 0:00:41
      67500 -- (-323.827) [-321.729] (-323.023) (-324.093) * (-324.049) (-321.852) (-323.755) [-322.876] -- 0:00:41
      68000 -- (-323.282) (-323.183) [-323.924] (-326.356) * (-321.678) [-320.554] (-323.495) (-325.777) -- 0:00:41
      68500 -- (-321.184) [-324.312] (-324.541) (-323.873) * [-321.020] (-325.569) (-323.527) (-324.388) -- 0:00:40
      69000 -- (-324.310) (-321.831) (-322.878) [-321.221] * (-322.389) [-321.695] (-321.290) (-324.668) -- 0:00:53
      69500 -- (-323.404) (-323.139) (-324.811) [-321.745] * (-321.162) (-321.085) [-320.540] (-321.693) -- 0:00:53
      70000 -- (-325.154) (-320.891) (-326.513) [-324.192] * (-320.801) (-323.982) [-321.929] (-321.334) -- 0:00:53

      Average standard deviation of split frequencies: 0.022236

      70500 -- (-326.068) [-321.312] (-321.377) (-321.767) * (-328.061) [-322.132] (-322.470) (-320.736) -- 0:00:52
      71000 -- (-324.043) [-321.488] (-324.906) (-321.028) * (-321.498) (-321.583) [-324.939] (-321.172) -- 0:00:52
      71500 -- (-322.183) (-321.382) [-321.346] (-322.167) * (-322.047) (-323.264) [-323.259] (-321.878) -- 0:00:51
      72000 -- [-320.943] (-321.394) (-324.305) (-326.014) * (-324.286) (-323.033) [-322.538] (-322.358) -- 0:00:51
      72500 -- (-321.704) (-322.395) (-323.344) [-321.467] * [-325.685] (-321.151) (-323.217) (-321.413) -- 0:00:51
      73000 -- (-323.005) (-325.053) [-321.723] (-322.553) * (-326.893) (-323.739) (-321.025) [-326.707] -- 0:00:50
      73500 -- (-325.214) (-328.022) (-324.477) [-321.542] * [-322.132] (-321.328) (-325.733) (-324.911) -- 0:00:50
      74000 -- (-337.198) [-322.350] (-321.864) (-321.525) * (-323.697) [-321.192] (-325.429) (-327.903) -- 0:00:50
      74500 -- (-329.331) [-322.189] (-321.785) (-326.398) * (-324.127) [-323.080] (-325.739) (-320.839) -- 0:00:49
      75000 -- (-321.251) (-322.218) (-325.598) [-324.719] * [-326.289] (-321.493) (-325.395) (-322.873) -- 0:00:49

      Average standard deviation of split frequencies: 0.028946

      75500 -- (-320.901) (-322.607) (-324.613) [-323.068] * [-323.641] (-320.690) (-322.968) (-323.996) -- 0:00:48
      76000 -- (-327.834) (-320.884) (-321.335) [-321.687] * (-328.660) [-323.035] (-323.127) (-321.542) -- 0:00:48
      76500 -- (-324.677) (-323.027) [-324.000] (-321.358) * (-323.172) (-326.131) (-320.952) [-320.693] -- 0:00:48
      77000 -- (-324.538) (-323.304) (-322.246) [-322.567] * (-322.720) (-322.421) (-325.635) [-324.440] -- 0:00:47
      77500 -- (-320.992) (-325.572) (-323.468) [-323.315] * (-326.226) [-322.361] (-321.891) (-324.149) -- 0:00:47
      78000 -- [-323.414] (-322.157) (-325.534) (-320.498) * [-321.803] (-323.250) (-322.121) (-324.854) -- 0:00:47
      78500 -- (-323.891) [-321.822] (-321.903) (-321.745) * [-322.043] (-323.826) (-323.105) (-321.377) -- 0:00:46
      79000 -- (-324.432) (-323.878) (-323.605) [-321.398] * (-324.497) [-321.496] (-322.314) (-322.059) -- 0:00:46
      79500 -- (-321.891) (-323.117) (-321.624) [-321.791] * (-324.871) [-321.337] (-321.512) (-323.393) -- 0:00:46
      80000 -- (-325.420) [-322.335] (-322.727) (-323.494) * (-327.246) [-323.509] (-321.544) (-320.929) -- 0:00:46

      Average standard deviation of split frequencies: 0.023375

      80500 -- (-324.580) (-320.705) (-322.920) [-324.854] * (-323.922) [-322.508] (-328.169) (-321.261) -- 0:00:45
      81000 -- (-321.017) (-326.472) (-322.462) [-321.570] * (-323.591) (-322.523) [-321.727] (-323.457) -- 0:00:45
      81500 -- (-322.234) (-324.935) (-324.589) [-321.505] * (-321.724) (-320.472) [-322.245] (-321.015) -- 0:00:45
      82000 -- [-322.439] (-322.604) (-321.961) (-322.512) * [-321.652] (-320.589) (-322.885) (-320.991) -- 0:00:44
      82500 -- (-322.367) (-327.224) (-322.219) [-321.708] * (-322.139) [-322.663] (-326.510) (-320.775) -- 0:00:44
      83000 -- (-325.375) (-320.948) [-325.509] (-322.162) * (-321.462) [-323.175] (-324.399) (-321.356) -- 0:00:44
      83500 -- (-321.841) [-323.100] (-324.203) (-322.159) * (-322.381) (-322.811) [-323.880] (-321.293) -- 0:00:43
      84000 -- [-321.994] (-325.217) (-325.946) (-321.712) * (-324.076) (-324.245) [-331.845] (-322.133) -- 0:00:43
      84500 -- (-320.676) [-322.473] (-320.518) (-321.450) * (-323.847) [-323.351] (-320.697) (-323.951) -- 0:00:43
      85000 -- [-322.847] (-326.445) (-321.349) (-323.087) * [-323.420] (-322.232) (-321.884) (-321.340) -- 0:00:43

      Average standard deviation of split frequencies: 0.025580

      85500 -- [-323.184] (-322.434) (-322.594) (-321.057) * (-323.247) [-323.680] (-321.681) (-323.006) -- 0:00:42
      86000 -- (-323.362) [-322.146] (-324.585) (-328.313) * [-322.842] (-321.838) (-321.458) (-322.465) -- 0:00:42
      86500 -- [-321.062] (-323.651) (-323.703) (-323.512) * [-321.979] (-321.433) (-326.643) (-322.339) -- 0:00:42
      87000 -- (-322.253) (-323.484) (-321.847) [-320.943] * [-322.535] (-322.523) (-322.940) (-323.268) -- 0:00:41
      87500 -- (-320.947) [-324.505] (-323.033) (-323.842) * [-325.732] (-323.672) (-324.651) (-322.012) -- 0:00:41
      88000 -- [-321.909] (-321.064) (-326.046) (-325.298) * [-323.387] (-323.507) (-322.192) (-323.997) -- 0:00:41
      88500 -- (-322.929) (-322.366) (-321.131) [-321.808] * (-321.222) (-321.421) (-320.826) [-323.030] -- 0:00:41
      89000 -- (-323.138) (-324.534) (-321.031) [-323.123] * [-322.042] (-324.751) (-324.033) (-320.851) -- 0:00:40
      89500 -- (-326.988) (-321.578) (-321.019) [-326.402] * (-321.027) (-322.359) [-321.711] (-321.356) -- 0:00:40
      90000 -- [-325.323] (-322.111) (-322.800) (-321.410) * (-324.620) (-320.799) (-325.822) [-322.843] -- 0:00:40

      Average standard deviation of split frequencies: 0.006932

      90500 -- (-321.678) (-321.401) [-320.994] (-325.296) * [-322.982] (-323.198) (-322.539) (-323.164) -- 0:00:40
      91000 -- [-322.414] (-322.275) (-323.837) (-324.005) * (-322.613) (-321.621) (-324.591) [-322.712] -- 0:00:49
      91500 -- (-323.767) [-321.138] (-327.410) (-322.749) * (-324.614) (-322.860) (-321.704) [-325.141] -- 0:00:49
      92000 -- (-327.425) (-324.411) [-321.847] (-322.103) * (-320.751) (-320.846) (-324.398) [-322.935] -- 0:00:49
      92500 -- (-321.380) (-325.878) (-322.228) [-322.476] * (-326.116) [-324.565] (-322.997) (-322.790) -- 0:00:49
      93000 -- (-322.218) (-325.128) [-321.576] (-324.361) * (-322.527) (-325.984) [-324.707] (-322.619) -- 0:00:48
      93500 -- (-323.044) [-321.551] (-325.456) (-324.811) * (-324.895) [-323.403] (-325.488) (-321.982) -- 0:00:48
      94000 -- [-322.085] (-322.390) (-325.128) (-326.883) * [-324.406] (-322.851) (-321.401) (-322.973) -- 0:00:48
      94500 -- (-322.175) [-321.532] (-321.276) (-326.840) * [-324.718] (-322.722) (-323.203) (-321.657) -- 0:00:47
      95000 -- [-323.362] (-323.573) (-323.804) (-324.223) * (-321.699) (-321.620) (-326.686) [-322.598] -- 0:00:47

      Average standard deviation of split frequencies: 0.006547

      95500 -- [-323.731] (-320.711) (-322.686) (-321.176) * (-320.948) (-323.254) [-322.121] (-328.773) -- 0:00:47
      96000 -- (-322.528) (-322.783) [-321.875] (-322.689) * (-321.952) (-321.702) (-324.608) [-324.006] -- 0:00:47
      96500 -- (-322.437) (-324.742) [-328.882] (-327.107) * (-322.532) (-321.529) [-327.162] (-321.809) -- 0:00:46
      97000 -- (-323.613) [-322.854] (-329.023) (-325.539) * [-322.532] (-320.975) (-324.382) (-322.638) -- 0:00:46
      97500 -- [-324.110] (-323.008) (-323.765) (-321.142) * (-324.662) (-321.203) [-324.166] (-322.933) -- 0:00:46
      98000 -- (-321.339) (-321.839) [-323.064] (-320.797) * [-323.440] (-325.351) (-327.732) (-323.026) -- 0:00:46
      98500 -- (-321.110) (-322.181) (-326.588) [-326.124] * (-324.518) (-323.045) [-322.899] (-321.283) -- 0:00:45
      99000 -- (-323.872) [-325.125] (-327.972) (-321.958) * [-322.082] (-322.411) (-323.575) (-322.459) -- 0:00:45
      99500 -- (-324.910) [-323.567] (-324.414) (-320.690) * (-325.230) (-321.951) [-323.387] (-320.978) -- 0:00:45
      100000 -- (-321.747) (-326.200) (-321.890) [-322.493] * [-321.978] (-323.744) (-323.699) (-321.696) -- 0:00:45

      Average standard deviation of split frequencies: 0.006244

      100500 -- (-322.504) (-325.662) (-322.303) [-321.225] * (-322.226) [-322.887] (-324.511) (-322.445) -- 0:00:44
      101000 -- (-324.829) [-323.794] (-325.124) (-322.143) * (-325.100) (-324.961) (-323.678) [-325.002] -- 0:00:44
      101500 -- (-330.913) (-322.537) [-323.560] (-323.306) * (-321.109) [-321.778] (-321.820) (-323.879) -- 0:00:44
      102000 -- (-322.202) [-322.212] (-323.031) (-320.748) * (-322.309) [-322.540] (-322.826) (-322.941) -- 0:00:44
      102500 -- (-324.611) (-321.886) [-321.444] (-324.390) * (-322.088) (-327.096) (-321.783) [-322.356] -- 0:00:43
      103000 -- [-322.044] (-320.968) (-325.092) (-321.290) * (-321.402) (-322.304) (-322.147) [-324.402] -- 0:00:43
      103500 -- (-321.610) [-323.761] (-326.472) (-323.176) * [-321.860] (-322.945) (-321.977) (-322.657) -- 0:00:43
      104000 -- (-321.781) [-321.775] (-324.931) (-323.248) * (-322.767) (-321.107) [-323.148] (-325.030) -- 0:00:43
      104500 -- (-325.626) (-322.268) (-324.321) [-323.294] * (-323.025) (-321.270) (-324.105) [-322.990] -- 0:00:42
      105000 -- [-321.164] (-323.778) (-323.658) (-322.391) * (-321.510) [-322.652] (-322.413) (-323.575) -- 0:00:42

      Average standard deviation of split frequencies: 0.020754

      105500 -- (-327.716) (-320.827) (-321.488) [-321.972] * (-323.539) (-322.625) (-326.032) [-324.543] -- 0:00:42
      106000 -- [-326.098] (-321.403) (-324.668) (-322.078) * (-321.753) (-322.510) (-323.351) [-324.864] -- 0:00:42
      106500 -- (-329.800) [-321.910] (-322.052) (-326.505) * (-321.445) (-322.517) [-324.923] (-324.331) -- 0:00:41
      107000 -- [-320.911] (-323.039) (-320.932) (-322.595) * (-322.189) (-322.817) (-321.616) [-321.812] -- 0:00:41
      107500 -- [-321.836] (-324.347) (-321.710) (-321.395) * (-324.818) [-324.843] (-321.481) (-325.803) -- 0:00:41
      108000 -- (-324.374) (-326.401) [-322.748] (-325.952) * (-320.761) [-321.792] (-322.915) (-321.917) -- 0:00:41
      108500 -- (-329.319) [-323.034] (-326.915) (-321.003) * (-322.503) (-323.705) (-326.893) [-322.306] -- 0:00:41
      109000 -- (-324.807) [-322.620] (-324.759) (-322.756) * (-322.075) [-325.595] (-322.971) (-321.986) -- 0:00:40
      109500 -- (-322.760) [-324.584] (-321.208) (-322.162) * (-331.847) [-323.781] (-321.236) (-321.022) -- 0:00:40
      110000 -- [-324.554] (-322.234) (-321.844) (-320.446) * (-324.391) (-321.750) [-322.671] (-321.222) -- 0:00:40

      Average standard deviation of split frequencies: 0.011359

      110500 -- (-321.829) (-321.620) [-323.128] (-323.619) * [-325.264] (-321.379) (-326.186) (-324.485) -- 0:00:40
      111000 -- [-323.438] (-322.143) (-324.098) (-322.688) * (-327.211) (-323.835) [-321.308] (-321.351) -- 0:00:40
      111500 -- (-321.815) (-323.475) [-321.027] (-320.748) * (-323.538) (-323.355) [-320.906] (-323.032) -- 0:00:39
      112000 -- (-322.228) (-324.145) [-321.772] (-320.695) * [-325.703] (-321.420) (-322.269) (-320.838) -- 0:00:39
      112500 -- (-321.910) [-325.213] (-322.751) (-321.666) * (-320.606) [-323.679] (-323.939) (-322.340) -- 0:00:39
      113000 -- [-322.684] (-320.956) (-322.613) (-327.522) * [-321.697] (-320.653) (-325.633) (-325.313) -- 0:00:39
      113500 -- (-321.594) [-321.350] (-321.033) (-324.708) * (-322.416) (-322.639) [-326.007] (-322.574) -- 0:00:46
      114000 -- (-322.439) [-321.732] (-322.495) (-322.690) * [-321.023] (-324.490) (-324.042) (-321.803) -- 0:00:46
      114500 -- (-324.648) (-322.761) [-322.425] (-321.953) * [-322.777] (-323.929) (-324.586) (-323.788) -- 0:00:46
      115000 -- (-323.866) (-322.228) [-325.677] (-322.439) * (-324.522) (-322.129) (-321.876) [-321.687] -- 0:00:46

      Average standard deviation of split frequencies: 0.010837

      115500 -- (-323.160) (-324.082) [-321.206] (-321.583) * (-323.991) (-322.635) (-321.334) [-323.807] -- 0:00:45
      116000 -- (-325.279) (-325.112) (-321.917) [-322.435] * (-321.605) (-324.739) (-321.182) [-323.325] -- 0:00:45
      116500 -- (-320.894) (-326.798) (-327.062) [-325.707] * (-325.807) [-321.934] (-321.526) (-326.455) -- 0:00:45
      117000 -- (-322.199) (-323.502) [-324.035] (-322.230) * (-327.633) [-321.678] (-322.132) (-320.672) -- 0:00:45
      117500 -- (-321.983) (-322.130) [-322.610] (-324.608) * [-320.828] (-325.624) (-321.824) (-329.294) -- 0:00:45
      118000 -- (-322.166) (-325.393) [-322.841] (-323.666) * [-321.247] (-326.101) (-324.549) (-321.442) -- 0:00:44
      118500 -- [-323.173] (-325.245) (-323.739) (-323.793) * (-323.701) (-320.909) (-323.358) [-325.138] -- 0:00:44
      119000 -- (-323.543) (-325.523) (-326.678) [-326.184] * [-321.154] (-323.076) (-323.612) (-328.472) -- 0:00:44
      119500 -- (-322.174) [-325.100] (-323.624) (-323.672) * (-324.014) (-320.972) (-322.587) [-321.085] -- 0:00:44
      120000 -- (-321.806) (-326.691) (-322.646) [-321.812] * (-323.062) (-323.661) (-322.266) [-321.709] -- 0:00:44

      Average standard deviation of split frequencies: 0.007813

      120500 -- [-323.287] (-325.380) (-323.884) (-323.485) * (-324.685) (-324.662) (-324.962) [-322.554] -- 0:00:43
      121000 -- [-322.388] (-324.809) (-321.611) (-322.119) * (-323.335) [-321.175] (-323.967) (-323.374) -- 0:00:43
      121500 -- (-322.633) (-320.854) (-321.240) [-321.518] * [-326.457] (-323.099) (-321.341) (-327.825) -- 0:00:43
      122000 -- (-322.067) (-321.847) (-324.518) [-320.892] * (-326.818) (-321.407) (-324.600) [-322.064] -- 0:00:43
      122500 -- (-321.476) [-321.509] (-323.847) (-324.385) * (-329.927) [-321.497] (-324.655) (-323.237) -- 0:00:42
      123000 -- [-323.111] (-322.783) (-324.476) (-321.412) * (-322.652) [-320.936] (-321.510) (-325.121) -- 0:00:42
      123500 -- [-322.503] (-325.109) (-325.554) (-323.097) * [-322.040] (-322.237) (-324.122) (-325.626) -- 0:00:42
      124000 -- (-321.446) (-322.555) [-322.344] (-321.468) * (-326.551) (-321.328) [-323.065] (-324.600) -- 0:00:42
      124500 -- (-322.124) [-322.647] (-321.422) (-321.312) * (-322.859) (-321.626) (-325.699) [-322.030] -- 0:00:42
      125000 -- (-320.871) (-321.756) [-322.150] (-324.959) * [-321.654] (-323.370) (-322.138) (-323.261) -- 0:00:42

      Average standard deviation of split frequencies: 0.009977

      125500 -- (-322.414) [-321.729] (-324.462) (-327.064) * (-322.058) [-323.140] (-323.502) (-323.745) -- 0:00:41
      126000 -- (-325.528) (-324.781) [-322.021] (-321.983) * (-322.560) (-324.543) [-323.493] (-325.873) -- 0:00:41
      126500 -- (-325.109) [-325.290] (-323.332) (-321.549) * (-320.640) [-321.768] (-321.501) (-321.219) -- 0:00:41
      127000 -- [-321.559] (-323.733) (-326.064) (-321.176) * (-324.381) (-324.938) (-323.944) [-323.628] -- 0:00:41
      127500 -- (-328.712) (-327.378) [-324.956] (-324.166) * (-325.253) (-321.976) (-323.571) [-322.832] -- 0:00:41
      128000 -- (-325.203) [-322.024] (-324.583) (-323.516) * (-322.307) (-322.756) [-321.897] (-323.130) -- 0:00:40
      128500 -- (-324.826) (-321.025) (-326.717) [-323.678] * (-322.719) [-323.263] (-324.185) (-322.148) -- 0:00:40
      129000 -- (-323.817) (-320.927) [-324.287] (-323.882) * (-323.500) (-321.874) [-323.326] (-322.350) -- 0:00:40
      129500 -- [-325.347] (-321.262) (-320.820) (-320.890) * [-323.851] (-322.718) (-324.824) (-322.248) -- 0:00:40
      130000 -- (-321.834) (-326.831) (-320.943) [-322.710] * (-321.282) (-323.369) (-322.632) [-322.523] -- 0:00:40

      Average standard deviation of split frequencies: 0.004810

      130500 -- (-322.768) [-321.811] (-321.314) (-323.164) * (-322.820) (-322.647) (-323.530) [-324.600] -- 0:00:39
      131000 -- [-324.361] (-323.147) (-321.404) (-324.677) * (-324.999) [-321.392] (-322.261) (-328.310) -- 0:00:39
      131500 -- (-322.945) [-324.971] (-322.118) (-322.106) * (-327.820) [-323.495] (-322.099) (-322.684) -- 0:00:39
      132000 -- (-323.302) (-328.238) (-321.230) [-320.852] * (-324.291) (-321.687) [-322.003] (-323.074) -- 0:00:39
      132500 -- (-322.296) (-324.647) [-322.430] (-322.305) * (-327.469) (-322.907) [-322.873] (-320.640) -- 0:00:39
      133000 -- (-320.864) (-325.438) [-321.884] (-321.798) * (-328.323) (-322.815) [-322.251] (-324.371) -- 0:00:39
      133500 -- (-322.219) (-323.818) [-322.074] (-325.152) * (-325.976) (-322.922) (-323.194) [-321.051] -- 0:00:38
      134000 -- (-321.160) (-322.262) [-323.623] (-321.739) * [-323.890] (-321.677) (-323.055) (-322.114) -- 0:00:38
      134500 -- [-325.105] (-322.781) (-322.687) (-323.040) * (-327.295) (-321.272) [-321.634] (-324.122) -- 0:00:38
      135000 -- (-325.353) (-325.778) [-321.787] (-328.202) * (-324.289) (-320.967) (-322.211) [-321.773] -- 0:00:38

      Average standard deviation of split frequencies: 0.004622

      135500 -- (-325.706) [-323.994] (-329.687) (-323.122) * (-322.421) [-324.292] (-323.387) (-325.061) -- 0:00:38
      136000 -- (-326.879) [-322.164] (-325.075) (-324.102) * (-321.296) (-321.403) [-323.337] (-323.245) -- 0:00:38
      136500 -- (-324.773) (-321.912) [-322.276] (-324.451) * (-321.387) (-321.984) [-321.111] (-323.844) -- 0:00:44
      137000 -- (-321.687) (-321.881) (-323.502) [-322.975] * [-320.958] (-324.501) (-322.937) (-328.371) -- 0:00:44
      137500 -- (-322.948) (-321.857) [-323.599] (-323.512) * (-321.489) (-321.928) (-321.993) [-325.729] -- 0:00:43
      138000 -- (-321.414) [-325.107] (-322.643) (-321.930) * [-327.508] (-324.835) (-322.620) (-327.731) -- 0:00:43
      138500 -- (-326.823) (-334.004) (-328.957) [-321.466] * [-323.675] (-322.653) (-321.627) (-322.169) -- 0:00:43
      139000 -- [-321.471] (-324.939) (-322.558) (-321.776) * (-322.952) (-325.108) [-320.898] (-323.185) -- 0:00:43
      139500 -- (-321.339) (-324.376) [-321.240] (-322.814) * (-325.613) (-324.134) [-323.644] (-322.508) -- 0:00:43
      140000 -- (-324.197) [-322.406] (-325.127) (-323.247) * (-320.835) (-323.009) [-322.861] (-321.324) -- 0:00:43

      Average standard deviation of split frequencies: 0.004468

      140500 -- (-325.110) (-320.918) (-322.532) [-324.464] * (-325.789) (-323.506) (-324.128) [-322.597] -- 0:00:42
      141000 -- (-322.407) [-320.979] (-320.899) (-323.878) * [-321.484] (-325.475) (-322.365) (-321.080) -- 0:00:42
      141500 -- (-321.516) [-321.428] (-324.197) (-324.965) * (-321.660) [-322.428] (-321.644) (-321.495) -- 0:00:42
      142000 -- (-323.736) (-321.638) [-322.609] (-322.944) * (-322.731) [-323.032] (-323.782) (-326.211) -- 0:00:42
      142500 -- [-322.056] (-325.882) (-321.913) (-323.018) * (-323.887) [-323.598] (-322.330) (-323.940) -- 0:00:42
      143000 -- [-323.060] (-324.441) (-321.845) (-326.411) * [-322.146] (-325.592) (-323.329) (-322.595) -- 0:00:41
      143500 -- (-324.892) (-322.772) [-323.213] (-327.392) * (-321.845) (-322.694) [-323.752] (-324.634) -- 0:00:41
      144000 -- [-320.865] (-326.667) (-321.487) (-321.541) * (-325.971) [-322.057] (-324.188) (-322.333) -- 0:00:41
      144500 -- [-322.731] (-322.748) (-321.233) (-323.062) * (-321.092) [-324.454] (-321.867) (-322.537) -- 0:00:41
      145000 -- (-323.915) (-322.566) [-323.039] (-324.676) * (-324.969) (-321.452) [-320.720] (-322.384) -- 0:00:41

      Average standard deviation of split frequencies: 0.008610

      145500 -- (-322.793) (-324.010) (-322.323) [-322.554] * (-321.054) [-321.535] (-322.244) (-322.765) -- 0:00:41
      146000 -- (-326.414) (-323.300) [-323.372] (-321.882) * (-325.823) (-327.442) [-321.176] (-321.926) -- 0:00:40
      146500 -- [-323.009] (-322.138) (-322.746) (-323.525) * [-324.653] (-321.198) (-321.434) (-323.922) -- 0:00:40
      147000 -- (-323.119) [-326.350] (-323.107) (-322.802) * (-329.543) (-320.832) [-324.767] (-324.912) -- 0:00:40
      147500 -- (-322.528) (-324.281) (-327.311) [-322.854] * [-323.457] (-320.562) (-322.877) (-322.721) -- 0:00:40
      148000 -- [-321.325] (-331.457) (-331.780) (-326.608) * (-322.185) [-321.111] (-322.094) (-320.827) -- 0:00:40
      148500 -- (-325.131) (-322.981) [-322.279] (-322.364) * (-324.689) (-321.578) [-322.173] (-324.472) -- 0:00:40
      149000 -- (-322.584) (-322.646) [-324.680] (-323.925) * [-327.126] (-322.817) (-325.273) (-322.161) -- 0:00:39
      149500 -- (-321.684) [-325.209] (-324.050) (-327.195) * (-323.507) (-324.588) (-326.238) [-322.840] -- 0:00:39
      150000 -- [-322.959] (-321.213) (-324.854) (-322.390) * [-321.838] (-323.427) (-322.815) (-322.369) -- 0:00:39

      Average standard deviation of split frequencies: 0.008343

      150500 -- (-323.144) (-321.476) (-325.645) [-321.553] * (-324.741) (-322.056) (-323.287) [-324.020] -- 0:00:39
      151000 -- (-324.955) (-321.731) [-325.912] (-324.991) * (-322.201) (-321.897) [-321.358] (-321.239) -- 0:00:39
      151500 -- (-321.980) (-323.123) (-324.208) [-323.413] * [-321.988] (-320.959) (-322.951) (-327.736) -- 0:00:39
      152000 -- (-322.801) (-321.675) [-321.912] (-323.327) * [-327.227] (-322.518) (-327.018) (-331.403) -- 0:00:39
      152500 -- (-322.339) [-323.494] (-322.995) (-322.044) * (-322.113) (-323.438) [-323.985] (-325.725) -- 0:00:38
      153000 -- [-322.305] (-321.959) (-323.381) (-322.405) * (-321.580) (-326.104) (-323.173) [-325.832] -- 0:00:38
      153500 -- (-322.417) (-324.181) [-322.506] (-324.189) * (-322.239) (-322.118) (-323.029) [-325.813] -- 0:00:38
      154000 -- (-324.753) (-324.503) (-321.584) [-321.540] * (-323.336) (-322.771) (-323.096) [-321.744] -- 0:00:38
      154500 -- (-323.264) (-322.252) [-320.908] (-324.127) * (-326.105) (-321.093) [-322.947] (-324.160) -- 0:00:38
      155000 -- (-321.445) (-321.180) (-322.590) [-323.487] * (-326.169) [-321.724] (-323.677) (-321.501) -- 0:00:38

      Average standard deviation of split frequencies: 0.008058

      155500 -- [-325.689] (-327.286) (-321.519) (-323.139) * (-323.196) [-320.850] (-322.591) (-328.843) -- 0:00:38
      156000 -- (-322.364) (-322.853) [-322.352] (-321.859) * (-321.181) [-321.751] (-325.074) (-322.705) -- 0:00:37
      156500 -- [-323.208] (-323.871) (-323.000) (-323.705) * (-323.270) (-322.110) [-324.326] (-321.194) -- 0:00:37
      157000 -- (-320.703) (-323.068) (-321.446) [-321.743] * [-323.716] (-323.462) (-322.860) (-322.234) -- 0:00:37
      157500 -- (-324.638) (-326.309) [-321.606] (-323.851) * (-327.231) (-324.396) [-321.722] (-328.439) -- 0:00:37
      158000 -- (-322.455) (-323.615) [-322.431] (-322.191) * [-325.399] (-321.174) (-320.796) (-327.234) -- 0:00:37
      158500 -- (-325.193) (-321.983) (-320.708) [-322.102] * (-323.099) (-322.227) [-321.574] (-322.091) -- 0:00:37
      159000 -- (-322.007) (-323.017) [-321.077] (-322.641) * (-320.811) (-321.396) (-321.059) [-323.229] -- 0:00:37
      159500 -- [-321.271] (-322.849) (-322.533) (-322.667) * (-322.209) (-323.306) (-322.834) [-321.126] -- 0:00:42
      160000 -- (-321.428) [-322.965] (-320.836) (-327.644) * (-321.425) [-321.614] (-324.064) (-322.816) -- 0:00:42

      Average standard deviation of split frequencies: 0.009780

      160500 -- (-321.138) (-321.704) (-322.630) [-323.650] * (-320.937) (-322.147) [-322.478] (-325.083) -- 0:00:41
      161000 -- [-321.120] (-321.802) (-330.773) (-321.884) * (-322.355) (-323.736) [-321.460] (-325.413) -- 0:00:41
      161500 -- [-323.257] (-322.077) (-333.123) (-325.310) * (-323.788) (-322.246) [-322.141] (-323.937) -- 0:00:41
      162000 -- [-324.015] (-324.003) (-325.213) (-324.891) * (-324.879) [-322.016] (-321.979) (-322.575) -- 0:00:41
      162500 -- (-326.412) (-324.080) (-324.089) [-322.982] * (-322.316) (-322.851) (-320.640) [-326.063] -- 0:00:41
      163000 -- (-324.355) (-321.790) [-326.598] (-322.408) * (-322.700) (-322.542) (-321.970) [-321.344] -- 0:00:41
      163500 -- (-322.739) [-321.674] (-325.243) (-323.058) * [-322.063] (-324.538) (-323.894) (-323.345) -- 0:00:40
      164000 -- (-323.313) (-321.295) (-322.677) [-322.722] * (-323.493) (-322.849) (-321.150) [-321.472] -- 0:00:40
      164500 -- (-322.501) [-321.594] (-320.981) (-321.000) * (-321.371) (-321.565) (-328.268) [-322.026] -- 0:00:40
      165000 -- (-323.292) (-322.937) (-327.014) [-323.180] * [-326.593] (-324.751) (-321.817) (-323.140) -- 0:00:40

      Average standard deviation of split frequencies: 0.017039

      165500 -- (-329.460) (-324.013) (-323.393) [-323.889] * (-327.120) (-323.450) (-322.726) [-321.997] -- 0:00:40
      166000 -- (-323.583) [-322.232] (-323.523) (-322.250) * (-327.028) [-324.400] (-320.809) (-322.259) -- 0:00:40
      166500 -- [-322.700] (-323.755) (-322.185) (-322.486) * (-321.530) [-321.249] (-323.567) (-323.244) -- 0:00:40
      167000 -- (-326.566) (-323.129) (-324.918) [-323.361] * (-321.950) (-322.300) (-321.463) [-322.641] -- 0:00:39
      167500 -- [-322.739] (-322.732) (-322.427) (-322.791) * [-321.901] (-326.102) (-325.030) (-323.420) -- 0:00:39
      168000 -- (-326.933) (-321.629) (-321.393) [-323.624] * (-322.728) (-326.733) [-325.606] (-323.314) -- 0:00:39
      168500 -- [-322.232] (-321.527) (-323.138) (-324.528) * (-327.173) (-326.184) (-322.586) [-322.007] -- 0:00:39
      169000 -- [-322.716] (-322.194) (-321.660) (-324.209) * (-321.893) [-328.808] (-321.841) (-320.845) -- 0:00:39
      169500 -- [-322.257] (-325.452) (-322.171) (-322.426) * (-323.192) (-325.555) (-323.244) [-323.749] -- 0:00:39
      170000 -- (-321.441) (-329.999) (-321.754) [-320.928] * (-322.544) (-321.213) (-324.324) [-323.399] -- 0:00:39

      Average standard deviation of split frequencies: 0.022097

      170500 -- (-321.104) (-331.298) [-322.325] (-324.416) * (-322.341) (-322.232) [-322.543] (-322.697) -- 0:00:38
      171000 -- (-322.478) [-327.574] (-322.013) (-323.152) * (-320.817) (-323.079) (-323.738) [-321.449] -- 0:00:38
      171500 -- [-322.269] (-322.498) (-322.859) (-325.245) * (-324.239) (-323.364) [-323.817] (-322.906) -- 0:00:38
      172000 -- (-320.707) (-322.375) [-324.196] (-323.172) * (-325.011) [-320.957] (-321.449) (-329.116) -- 0:00:38
      172500 -- (-321.860) (-321.505) (-321.858) [-323.061] * (-325.425) [-322.996] (-321.082) (-326.332) -- 0:00:38
      173000 -- (-321.777) [-321.494] (-325.553) (-321.676) * [-322.885] (-321.829) (-321.369) (-321.890) -- 0:00:38
      173500 -- (-322.781) [-320.745] (-321.438) (-325.465) * (-321.190) (-323.563) (-321.992) [-322.469] -- 0:00:38
      174000 -- (-322.772) (-324.334) (-323.996) [-321.116] * (-320.958) (-324.632) (-326.442) [-320.870] -- 0:00:37
      174500 -- [-324.105] (-324.614) (-323.515) (-321.937) * (-322.450) (-320.498) (-322.683) [-321.306] -- 0:00:37
      175000 -- (-322.546) [-322.762] (-321.916) (-323.838) * (-324.391) (-325.022) (-323.008) [-320.975] -- 0:00:37

      Average standard deviation of split frequencies: 0.021427

      175500 -- (-322.065) (-321.133) (-324.167) [-321.341] * [-320.600] (-323.099) (-322.540) (-323.803) -- 0:00:37
      176000 -- (-322.513) (-327.016) [-322.422] (-321.549) * (-320.656) (-321.827) [-321.502] (-323.529) -- 0:00:37
      176500 -- [-323.722] (-323.225) (-321.879) (-323.530) * [-321.395] (-320.803) (-324.122) (-324.946) -- 0:00:37
      177000 -- (-322.311) (-320.684) [-322.484] (-322.098) * (-320.984) (-321.679) [-324.879] (-324.059) -- 0:00:37
      177500 -- (-326.009) (-324.052) [-323.956] (-324.081) * [-322.142] (-321.906) (-323.109) (-324.466) -- 0:00:37
      178000 -- (-322.518) [-322.951] (-323.481) (-323.973) * (-322.336) [-323.431] (-327.213) (-321.225) -- 0:00:36
      178500 -- (-322.883) (-320.663) (-320.717) [-323.714] * (-323.677) (-321.723) [-322.181] (-320.589) -- 0:00:36
      179000 -- (-323.084) [-322.870] (-323.950) (-322.966) * [-321.108] (-322.110) (-328.221) (-323.425) -- 0:00:36
      179500 -- (-322.264) [-323.743] (-328.761) (-324.832) * [-325.019] (-324.022) (-322.217) (-323.349) -- 0:00:36
      180000 -- [-322.347] (-321.754) (-324.115) (-322.999) * (-323.426) (-324.647) [-321.625] (-326.973) -- 0:00:36

      Average standard deviation of split frequencies: 0.017395

      180500 -- (-328.781) [-323.301] (-327.970) (-321.799) * (-321.856) [-322.593] (-321.825) (-327.380) -- 0:00:36
      181000 -- (-320.929) [-321.297] (-322.151) (-321.934) * (-322.349) (-325.143) (-322.415) [-325.553] -- 0:00:36
      181500 -- (-322.335) [-321.763] (-324.806) (-325.134) * (-322.100) (-325.532) [-323.071] (-321.916) -- 0:00:36
      182000 -- (-322.647) (-324.177) (-322.403) [-321.328] * (-324.500) (-325.933) (-320.650) [-323.746] -- 0:00:40
      182500 -- (-322.772) (-321.187) (-321.987) [-321.190] * (-323.544) (-323.332) (-322.189) [-326.471] -- 0:00:40
      183000 -- (-321.545) (-325.285) (-325.479) [-321.498] * [-324.597] (-323.152) (-321.582) (-327.641) -- 0:00:40
      183500 -- [-321.893] (-321.544) (-326.131) (-322.992) * (-322.637) [-321.664] (-320.989) (-323.088) -- 0:00:40
      184000 -- [-326.040] (-322.726) (-325.335) (-321.856) * (-321.753) (-323.890) (-321.740) [-321.129] -- 0:00:39
      184500 -- (-325.392) (-322.285) (-321.897) [-323.081] * (-324.003) [-321.843] (-321.635) (-325.878) -- 0:00:39
      185000 -- (-321.906) (-321.608) [-323.764] (-323.791) * [-323.339] (-327.124) (-321.657) (-322.572) -- 0:00:39

      Average standard deviation of split frequencies: 0.021965

      185500 -- (-321.045) [-321.388] (-321.547) (-322.915) * (-322.312) [-322.438] (-321.757) (-322.817) -- 0:00:39
      186000 -- (-322.892) [-321.552] (-321.579) (-325.116) * (-325.158) [-323.573] (-323.858) (-325.738) -- 0:00:39
      186500 -- (-323.505) [-321.552] (-323.053) (-325.874) * [-321.605] (-322.407) (-323.239) (-325.132) -- 0:00:39
      187000 -- (-323.970) [-321.071] (-321.474) (-323.171) * (-324.853) [-326.063] (-322.420) (-325.327) -- 0:00:39
      187500 -- [-323.079] (-328.496) (-324.263) (-321.900) * (-325.305) [-326.552] (-322.107) (-324.143) -- 0:00:39
      188000 -- (-322.429) [-325.561] (-322.697) (-327.308) * (-321.340) [-323.350] (-322.007) (-322.129) -- 0:00:38
      188500 -- (-321.431) (-329.080) (-325.788) [-320.693] * [-321.839] (-321.460) (-322.336) (-323.454) -- 0:00:38
      189000 -- (-325.068) (-324.115) [-321.411] (-322.122) * [-320.730] (-324.179) (-321.544) (-322.809) -- 0:00:38
      189500 -- (-321.583) (-324.878) (-321.088) [-323.740] * [-320.802] (-322.091) (-324.590) (-322.268) -- 0:00:38
      190000 -- (-320.707) (-321.879) (-320.807) [-325.375] * (-321.035) (-321.537) [-322.035] (-324.082) -- 0:00:38

      Average standard deviation of split frequencies: 0.023076

      190500 -- (-320.475) (-322.061) [-322.018] (-322.626) * [-323.014] (-326.056) (-323.813) (-321.606) -- 0:00:38
      191000 -- (-326.827) (-324.124) [-322.975] (-324.175) * (-321.262) [-323.130] (-324.352) (-321.702) -- 0:00:38
      191500 -- [-323.324] (-325.049) (-322.647) (-325.643) * (-321.424) (-320.573) (-323.662) [-325.527] -- 0:00:37
      192000 -- (-323.699) (-325.465) [-321.861] (-326.168) * (-321.814) [-321.839] (-325.982) (-323.621) -- 0:00:37
      192500 -- (-327.272) [-325.053] (-321.913) (-321.342) * (-324.938) (-322.503) (-324.713) [-323.530] -- 0:00:37
      193000 -- (-324.395) [-324.577] (-330.443) (-325.852) * (-325.098) (-323.289) (-327.264) [-322.379] -- 0:00:37
      193500 -- (-323.676) (-320.578) (-324.875) [-327.927] * (-321.775) [-323.786] (-323.959) (-322.869) -- 0:00:37
      194000 -- (-321.959) (-324.670) [-324.155] (-324.616) * (-323.636) [-325.090] (-328.398) (-324.930) -- 0:00:37
      194500 -- (-323.996) [-324.636] (-321.467) (-323.946) * (-322.309) [-322.352] (-325.725) (-321.942) -- 0:00:37
      195000 -- [-321.823] (-323.276) (-321.535) (-325.404) * (-322.804) [-322.321] (-321.675) (-322.660) -- 0:00:37

      Average standard deviation of split frequencies: 0.030465

      195500 -- (-320.927) (-323.614) [-321.725] (-323.346) * (-322.567) (-325.450) (-326.336) [-322.227] -- 0:00:37
      196000 -- (-322.925) [-322.872] (-322.922) (-324.892) * (-322.460) (-323.790) [-321.510] (-322.699) -- 0:00:36
      196500 -- (-324.398) (-324.586) (-323.674) [-325.260] * (-321.241) [-325.141] (-320.871) (-322.752) -- 0:00:36
      197000 -- (-325.880) [-321.722] (-328.004) (-324.389) * [-321.617] (-321.671) (-325.138) (-321.795) -- 0:00:36
      197500 -- [-322.991] (-320.900) (-327.043) (-323.453) * [-323.135] (-324.330) (-321.687) (-322.808) -- 0:00:36
      198000 -- (-321.685) (-324.617) [-326.392] (-325.446) * (-321.309) (-320.878) (-322.148) [-321.532] -- 0:00:36
      198500 -- (-323.020) (-326.625) (-323.155) [-321.632] * (-326.441) (-321.472) [-322.460] (-327.544) -- 0:00:36
      199000 -- (-325.475) [-322.932] (-323.014) (-324.101) * (-322.929) (-321.358) (-321.072) [-322.558] -- 0:00:36
      199500 -- (-325.828) (-324.627) [-325.669] (-321.912) * (-321.092) (-323.020) [-330.835] (-322.995) -- 0:00:36
      200000 -- [-324.965] (-322.692) (-321.867) (-324.723) * (-327.463) (-325.269) (-321.650) [-320.871] -- 0:00:36

      Average standard deviation of split frequencies: 0.028190

      200500 -- [-322.950] (-321.639) (-327.212) (-325.164) * (-324.908) (-321.622) [-320.783] (-322.715) -- 0:00:35
      201000 -- (-324.297) (-321.673) (-325.939) [-320.780] * [-322.945] (-322.946) (-322.108) (-328.648) -- 0:00:35
      201500 -- [-323.181] (-322.259) (-325.431) (-321.520) * [-321.943] (-321.224) (-321.997) (-321.736) -- 0:00:35
      202000 -- [-323.190] (-323.512) (-320.971) (-321.719) * (-321.025) (-321.118) [-322.443] (-325.307) -- 0:00:35
      202500 -- (-322.486) [-323.519] (-320.741) (-322.935) * (-324.417) (-322.352) (-320.609) [-327.627] -- 0:00:35
      203000 -- (-324.052) (-320.645) (-324.662) [-322.863] * (-323.156) [-321.309] (-323.700) (-325.949) -- 0:00:35
      203500 -- [-323.817] (-323.205) (-324.125) (-321.022) * (-322.531) (-321.210) [-321.980] (-321.289) -- 0:00:35
      204000 -- (-321.387) (-322.067) [-320.563] (-322.206) * (-325.890) [-321.190] (-321.817) (-322.229) -- 0:00:35
      204500 -- (-321.361) (-325.936) [-324.472] (-321.151) * (-323.779) (-320.689) [-323.638] (-325.231) -- 0:00:35
      205000 -- (-322.391) (-321.743) [-323.097] (-327.379) * (-323.050) (-322.107) [-321.171] (-320.974) -- 0:00:38

      Average standard deviation of split frequencies: 0.024409

      205500 -- (-322.806) (-323.176) (-323.093) [-325.071] * (-321.793) (-324.240) (-322.776) [-321.286] -- 0:00:38
      206000 -- (-324.286) (-322.120) [-320.690] (-321.225) * (-322.845) (-322.953) (-324.780) [-321.152] -- 0:00:38
      206500 -- (-320.589) (-323.784) [-322.268] (-324.403) * (-322.796) (-322.833) (-331.178) [-320.598] -- 0:00:38
      207000 -- (-321.266) [-323.042] (-325.384) (-323.791) * [-323.167] (-323.357) (-324.915) (-324.193) -- 0:00:38
      207500 -- (-328.501) (-322.494) (-323.086) [-324.044] * (-322.897) (-321.859) [-323.736] (-323.354) -- 0:00:38
      208000 -- [-320.883] (-322.775) (-323.533) (-320.473) * (-322.306) [-325.382] (-326.873) (-322.697) -- 0:00:38
      208500 -- [-322.422] (-328.978) (-322.142) (-325.457) * (-323.681) [-322.341] (-324.415) (-325.775) -- 0:00:37
      209000 -- (-328.210) (-323.082) (-322.298) [-323.466] * (-323.136) [-322.182] (-326.148) (-322.736) -- 0:00:37
      209500 -- (-325.045) (-327.314) (-323.746) [-324.736] * (-322.780) (-322.657) [-325.198] (-322.834) -- 0:00:37
      210000 -- (-324.848) [-323.073] (-321.427) (-321.081) * [-322.041] (-324.688) (-321.211) (-322.381) -- 0:00:37

      Average standard deviation of split frequencies: 0.029836

      210500 -- (-322.572) (-323.901) (-324.002) [-324.505] * [-320.923] (-323.190) (-322.220) (-323.064) -- 0:00:37
      211000 -- (-324.667) (-321.738) (-322.002) [-323.285] * (-324.752) [-321.549] (-323.172) (-321.750) -- 0:00:37
      211500 -- (-328.186) (-324.970) [-322.704] (-321.390) * (-321.773) [-324.727] (-321.410) (-327.961) -- 0:00:37
      212000 -- (-324.407) [-322.026] (-322.798) (-322.690) * [-321.094] (-322.148) (-322.446) (-325.158) -- 0:00:37
      212500 -- (-320.770) (-325.004) (-324.329) [-322.247] * (-324.546) (-323.849) (-323.205) [-322.180] -- 0:00:37
      213000 -- [-322.932] (-324.555) (-324.814) (-326.249) * (-326.035) (-323.970) [-321.242] (-322.524) -- 0:00:36
      213500 -- (-321.108) (-320.541) [-327.173] (-323.419) * [-324.986] (-321.737) (-321.405) (-321.694) -- 0:00:36
      214000 -- (-322.745) (-324.558) [-322.568] (-325.392) * (-324.479) (-322.502) [-326.267] (-324.261) -- 0:00:36
      214500 -- [-322.912] (-325.054) (-321.969) (-329.724) * (-324.158) [-320.644] (-321.601) (-322.149) -- 0:00:36
      215000 -- (-322.063) (-321.255) (-323.969) [-323.855] * (-325.199) (-320.779) (-326.798) [-322.547] -- 0:00:36

      Average standard deviation of split frequencies: 0.029099

      215500 -- (-326.803) (-325.690) [-321.107] (-325.651) * (-323.448) [-321.625] (-321.487) (-323.481) -- 0:00:36
      216000 -- (-323.165) [-322.585] (-321.945) (-321.230) * (-325.116) (-321.912) [-321.747] (-323.971) -- 0:00:36
      216500 -- (-323.650) (-321.354) [-321.111] (-324.325) * (-326.376) (-324.438) (-321.946) [-322.274] -- 0:00:36
      217000 -- (-322.800) (-323.709) [-325.497] (-323.695) * (-324.665) (-321.174) (-322.052) [-324.067] -- 0:00:36
      217500 -- (-322.742) [-323.361] (-324.839) (-321.504) * (-323.912) (-321.836) (-326.318) [-323.372] -- 0:00:35
      218000 -- (-321.894) (-324.033) [-326.712] (-322.544) * (-321.650) (-322.429) [-325.817] (-323.659) -- 0:00:35
      218500 -- (-326.706) [-321.785] (-322.733) (-324.175) * (-320.849) (-321.138) (-323.451) [-322.048] -- 0:00:35
      219000 -- [-322.100] (-321.912) (-321.228) (-321.133) * (-321.348) (-321.755) [-321.979] (-324.943) -- 0:00:35
      219500 -- [-325.972] (-321.915) (-322.975) (-324.037) * [-322.648] (-323.063) (-320.979) (-327.516) -- 0:00:35
      220000 -- [-323.924] (-322.954) (-322.363) (-325.578) * (-323.355) (-320.972) (-323.909) [-322.793] -- 0:00:35

      Average standard deviation of split frequencies: 0.032756

      220500 -- (-321.995) [-320.650] (-322.025) (-322.057) * (-324.805) (-323.478) (-323.005) [-324.349] -- 0:00:35
      221000 -- (-323.495) [-321.172] (-322.322) (-322.468) * (-323.844) [-324.209] (-322.451) (-323.373) -- 0:00:35
      221500 -- (-321.713) [-324.742] (-323.270) (-321.174) * (-322.027) [-322.718] (-325.020) (-321.243) -- 0:00:35
      222000 -- (-321.861) (-321.316) [-321.202] (-321.988) * [-323.465] (-322.865) (-323.573) (-327.253) -- 0:00:35
      222500 -- (-323.816) (-326.060) [-324.537] (-323.953) * (-325.528) (-321.496) [-322.830] (-324.269) -- 0:00:34
      223000 -- [-320.877] (-325.340) (-321.963) (-325.859) * (-321.616) (-323.394) [-324.355] (-322.688) -- 0:00:34
      223500 -- [-321.652] (-323.775) (-321.205) (-323.365) * (-321.782) (-324.829) (-322.785) [-322.420] -- 0:00:34
      224000 -- (-326.728) (-321.374) (-322.879) [-320.397] * [-322.890] (-323.537) (-325.368) (-322.414) -- 0:00:34
      224500 -- (-325.812) (-322.679) (-324.633) [-324.391] * (-322.921) (-325.935) [-322.227] (-321.890) -- 0:00:34
      225000 -- [-325.164] (-323.443) (-322.406) (-322.911) * (-323.658) (-323.071) (-324.259) [-321.851] -- 0:00:34

      Average standard deviation of split frequencies: 0.031983

      225500 -- [-323.435] (-320.998) (-323.954) (-321.775) * (-321.375) [-324.446] (-324.685) (-327.556) -- 0:00:34
      226000 -- (-322.518) (-324.636) (-322.087) [-321.948] * (-323.746) [-321.783] (-324.678) (-326.894) -- 0:00:34
      226500 -- [-322.620] (-321.630) (-324.815) (-323.468) * (-322.262) [-322.058] (-322.227) (-325.446) -- 0:00:34
      227000 -- (-321.447) [-323.327] (-321.629) (-327.045) * (-326.640) (-322.207) (-321.027) [-321.862] -- 0:00:34
      227500 -- (-321.757) (-324.169) (-322.743) [-320.892] * (-327.992) [-323.308] (-322.041) (-321.470) -- 0:00:37
      228000 -- (-322.917) (-331.781) (-327.415) [-324.368] * (-321.932) (-332.230) [-326.090] (-321.290) -- 0:00:37
      228500 -- (-323.470) [-322.979] (-328.739) (-324.284) * [-322.955] (-321.432) (-324.432) (-322.698) -- 0:00:37
      229000 -- [-325.833] (-327.823) (-322.902) (-322.297) * (-321.349) (-321.453) [-321.717] (-326.955) -- 0:00:37
      229500 -- [-324.270] (-322.328) (-326.248) (-323.828) * [-321.397] (-322.303) (-320.878) (-324.742) -- 0:00:36
      230000 -- (-321.903) [-324.595] (-326.203) (-329.105) * [-320.583] (-321.269) (-323.481) (-324.401) -- 0:00:36

      Average standard deviation of split frequencies: 0.028611

      230500 -- (-320.860) (-322.368) (-321.386) [-321.147] * [-323.569] (-323.185) (-323.961) (-322.421) -- 0:00:36
      231000 -- (-326.306) (-324.130) [-321.702] (-325.928) * (-322.426) [-322.432] (-321.368) (-323.404) -- 0:00:36
      231500 -- (-322.828) (-321.268) (-321.202) [-323.056] * (-323.116) (-325.085) (-322.600) [-320.994] -- 0:00:36
      232000 -- (-327.744) (-324.313) [-323.390] (-323.082) * (-322.533) [-320.651] (-321.006) (-322.981) -- 0:00:36
      232500 -- (-324.050) (-322.821) (-322.256) [-322.629] * (-321.405) [-326.397] (-324.741) (-322.510) -- 0:00:36
      233000 -- (-321.505) (-324.570) (-322.225) [-325.916] * (-321.655) [-322.718] (-323.859) (-322.840) -- 0:00:36
      233500 -- (-321.207) [-322.181] (-324.091) (-323.915) * (-323.941) (-322.236) (-324.730) [-323.340] -- 0:00:36
      234000 -- [-322.764] (-321.307) (-321.350) (-321.271) * (-327.827) (-322.510) [-326.108] (-323.897) -- 0:00:36
      234500 -- (-322.796) (-320.861) (-321.333) [-323.226] * (-321.810) (-322.525) (-324.561) [-323.777] -- 0:00:35
      235000 -- (-323.316) [-321.645] (-323.841) (-326.343) * [-321.869] (-322.721) (-324.455) (-321.633) -- 0:00:35

      Average standard deviation of split frequencies: 0.025301

      235500 -- (-322.790) (-321.237) [-320.770] (-323.594) * (-322.884) [-321.395] (-324.082) (-322.062) -- 0:00:35
      236000 -- (-324.697) (-325.181) (-325.052) [-323.609] * (-327.024) (-323.812) [-322.404] (-323.299) -- 0:00:35
      236500 -- (-321.387) [-322.306] (-322.809) (-321.229) * (-322.414) (-324.341) [-321.091] (-322.778) -- 0:00:35
      237000 -- (-321.142) (-322.223) (-325.045) [-323.775] * [-324.987] (-322.303) (-323.449) (-325.996) -- 0:00:35
      237500 -- (-322.150) (-323.811) (-323.199) [-321.234] * (-322.034) (-321.015) [-324.510] (-323.423) -- 0:00:35
      238000 -- (-322.932) [-323.088] (-321.842) (-321.463) * (-323.719) (-321.255) [-323.622] (-324.959) -- 0:00:35
      238500 -- (-322.496) [-322.750] (-322.739) (-323.548) * (-322.087) (-323.810) (-322.501) [-325.099] -- 0:00:35
      239000 -- [-321.455] (-322.600) (-325.576) (-323.445) * [-322.444] (-322.901) (-322.015) (-324.138) -- 0:00:35
      239500 -- [-322.016] (-323.684) (-321.649) (-325.461) * (-322.363) [-322.358] (-320.872) (-323.272) -- 0:00:34
      240000 -- (-324.836) [-321.513] (-321.444) (-323.687) * (-320.833) (-325.945) (-323.561) [-322.849] -- 0:00:34

      Average standard deviation of split frequencies: 0.024811

      240500 -- (-323.872) (-322.289) [-322.733] (-321.544) * (-322.780) [-322.424] (-323.305) (-323.946) -- 0:00:34
      241000 -- [-321.038] (-325.596) (-323.916) (-322.656) * (-325.648) (-323.531) (-325.710) [-321.401] -- 0:00:34
      241500 -- [-321.908] (-323.268) (-321.794) (-322.029) * (-324.297) (-325.728) (-321.102) [-322.995] -- 0:00:34
      242000 -- (-321.401) (-320.940) [-320.515] (-321.959) * (-323.644) (-328.287) [-324.523] (-322.036) -- 0:00:34
      242500 -- (-323.064) (-322.376) (-326.351) [-321.290] * (-322.304) (-323.253) [-321.744] (-323.364) -- 0:00:34
      243000 -- [-322.812] (-323.916) (-323.047) (-320.991) * (-321.628) [-324.411] (-324.199) (-324.008) -- 0:00:34
      243500 -- (-323.991) (-322.067) (-322.630) [-320.707] * (-323.977) (-323.842) [-322.929] (-325.437) -- 0:00:34
      244000 -- (-327.397) [-320.779] (-321.895) (-323.942) * [-325.153] (-323.412) (-322.984) (-323.891) -- 0:00:34
      244500 -- (-321.974) (-320.949) (-322.061) [-323.966] * (-323.699) (-322.202) [-321.039] (-321.096) -- 0:00:33
      245000 -- (-321.362) [-321.752] (-323.142) (-321.918) * (-321.573) [-321.726] (-323.786) (-320.997) -- 0:00:33

      Average standard deviation of split frequencies: 0.028105

      245500 -- (-323.794) (-323.968) [-321.724] (-322.649) * (-321.635) [-322.332] (-320.761) (-323.433) -- 0:00:33
      246000 -- [-323.981] (-324.587) (-322.286) (-321.547) * (-321.424) [-322.962] (-323.782) (-324.225) -- 0:00:33
      246500 -- (-321.683) [-322.140] (-321.434) (-323.755) * (-322.301) (-328.383) [-323.374] (-320.727) -- 0:00:33
      247000 -- (-321.962) (-323.958) [-321.827] (-322.066) * (-322.092) (-321.641) [-324.926] (-322.580) -- 0:00:33
      247500 -- (-324.668) (-322.466) [-322.894] (-322.256) * [-322.066] (-322.482) (-328.404) (-322.089) -- 0:00:33
      248000 -- (-323.061) [-321.967] (-323.726) (-323.233) * [-320.937] (-321.776) (-323.469) (-322.162) -- 0:00:33
      248500 -- (-322.369) [-325.123] (-322.359) (-322.535) * (-321.059) (-321.755) [-321.932] (-322.325) -- 0:00:33
      249000 -- [-322.163] (-322.263) (-321.350) (-331.057) * (-322.913) [-322.352] (-324.002) (-324.900) -- 0:00:36
      249500 -- [-324.662] (-320.898) (-322.647) (-321.974) * (-323.277) (-326.158) (-322.691) [-321.388] -- 0:00:36
      250000 -- (-321.884) (-321.912) (-323.924) [-322.742] * [-322.364] (-325.990) (-321.709) (-322.983) -- 0:00:36

      Average standard deviation of split frequencies: 0.027582

      250500 -- (-333.068) (-325.641) [-323.442] (-322.290) * (-323.733) [-321.827] (-323.640) (-321.950) -- 0:00:35
      251000 -- (-321.627) (-322.254) [-321.008] (-322.109) * (-323.642) [-322.248] (-321.073) (-335.074) -- 0:00:35
      251500 -- (-322.068) [-324.909] (-321.548) (-322.254) * (-323.213) [-321.545] (-320.721) (-323.811) -- 0:00:35
      252000 -- [-321.625] (-321.717) (-321.702) (-321.738) * (-322.332) [-322.304] (-323.038) (-325.257) -- 0:00:35
      252500 -- (-320.957) [-327.087] (-325.739) (-321.817) * (-323.057) (-330.155) (-320.940) [-324.269] -- 0:00:35
      253000 -- (-325.445) [-323.429] (-322.133) (-322.928) * (-322.492) [-322.445] (-322.205) (-321.720) -- 0:00:35
      253500 -- (-321.763) (-322.956) (-325.276) [-321.520] * [-322.047] (-321.337) (-329.588) (-323.196) -- 0:00:35
      254000 -- (-321.112) [-322.142] (-323.818) (-323.574) * (-323.709) [-323.328] (-322.606) (-322.791) -- 0:00:35
      254500 -- (-325.966) [-323.154] (-323.973) (-325.213) * (-323.729) (-322.852) [-321.194] (-321.273) -- 0:00:35
      255000 -- (-326.881) (-322.524) [-321.139] (-322.570) * (-321.294) [-321.642] (-323.399) (-322.719) -- 0:00:35

      Average standard deviation of split frequencies: 0.023325

      255500 -- (-325.889) (-323.980) [-325.661] (-321.783) * [-324.031] (-320.723) (-323.408) (-322.241) -- 0:00:34
      256000 -- (-320.650) [-322.270] (-321.408) (-323.498) * (-324.317) [-321.998] (-324.194) (-325.544) -- 0:00:34
      256500 -- (-322.267) (-322.814) [-324.017] (-322.738) * (-321.154) (-323.776) (-323.402) [-321.884] -- 0:00:34
      257000 -- (-321.818) [-325.450] (-325.091) (-321.833) * [-323.466] (-323.525) (-321.457) (-322.684) -- 0:00:34
      257500 -- (-322.560) [-323.676] (-323.607) (-322.932) * (-323.598) [-321.053] (-327.666) (-321.738) -- 0:00:34
      258000 -- [-327.250] (-323.007) (-325.210) (-323.356) * [-322.377] (-322.280) (-325.814) (-321.658) -- 0:00:34
      258500 -- (-322.971) (-322.142) (-323.529) [-323.553] * [-322.207] (-321.714) (-323.266) (-327.524) -- 0:00:34
      259000 -- (-324.436) (-324.909) (-323.054) [-321.178] * (-323.083) (-322.026) [-323.952] (-326.322) -- 0:00:34
      259500 -- (-322.722) [-321.627] (-323.915) (-324.136) * (-329.232) (-324.000) [-323.441] (-322.477) -- 0:00:34
      260000 -- (-325.437) (-322.966) [-321.569] (-322.217) * [-322.287] (-323.079) (-322.937) (-321.626) -- 0:00:34

      Average standard deviation of split frequencies: 0.025318

      260500 -- (-323.677) [-322.250] (-322.972) (-321.563) * (-323.311) (-323.056) [-321.335] (-323.297) -- 0:00:34
      261000 -- (-324.901) (-329.423) (-322.951) [-322.206] * (-323.188) (-324.912) (-323.686) [-322.338] -- 0:00:33
      261500 -- (-321.932) (-321.756) (-320.539) [-321.671] * (-328.455) [-324.738] (-324.237) (-324.462) -- 0:00:33
      262000 -- (-321.780) [-323.331] (-321.685) (-322.432) * (-323.289) (-327.354) [-320.658] (-322.864) -- 0:00:33
      262500 -- (-322.054) (-326.722) [-323.674] (-321.750) * [-321.499] (-322.941) (-321.024) (-322.848) -- 0:00:33
      263000 -- (-323.651) (-321.978) [-323.951] (-325.097) * (-328.103) (-328.801) [-323.364] (-328.719) -- 0:00:33
      263500 -- (-321.224) [-321.853] (-325.043) (-322.313) * (-326.270) (-324.634) [-322.730] (-328.618) -- 0:00:33
      264000 -- (-323.133) (-322.728) [-323.219] (-321.716) * (-324.602) (-320.908) (-321.384) [-323.004] -- 0:00:33
      264500 -- (-323.684) (-321.267) (-323.832) [-322.065] * (-322.647) (-321.524) (-322.772) [-322.845] -- 0:00:33
      265000 -- (-324.150) [-324.545] (-325.373) (-322.061) * [-323.640] (-322.577) (-321.368) (-322.579) -- 0:00:33

      Average standard deviation of split frequencies: 0.022448

      265500 -- (-323.436) (-322.380) (-322.822) [-322.857] * (-321.330) (-327.670) [-323.153] (-321.820) -- 0:00:33
      266000 -- (-324.668) [-323.971] (-320.917) (-323.359) * (-323.795) [-328.474] (-321.805) (-324.853) -- 0:00:33
      266500 -- [-321.875] (-323.708) (-323.198) (-323.358) * (-322.766) (-322.611) (-326.964) [-325.820] -- 0:00:33
      267000 -- [-322.011] (-321.529) (-322.594) (-322.699) * (-328.058) (-327.059) [-321.739] (-321.250) -- 0:00:32
      267500 -- (-323.108) (-323.352) (-324.242) [-320.580] * (-323.039) [-324.943] (-322.579) (-324.734) -- 0:00:32
      268000 -- [-323.023] (-324.132) (-323.603) (-324.583) * (-323.204) [-323.297] (-322.393) (-323.323) -- 0:00:32
      268500 -- (-325.163) (-321.964) (-324.825) [-321.239] * (-322.271) (-324.882) (-322.658) [-321.352] -- 0:00:32
      269000 -- (-327.146) (-323.609) [-325.913] (-322.487) * (-321.951) (-323.351) (-321.465) [-322.330] -- 0:00:32
      269500 -- (-321.737) (-323.474) [-321.884] (-324.309) * [-321.798] (-324.226) (-324.571) (-327.077) -- 0:00:32
      270000 -- (-324.132) (-325.457) [-322.826] (-323.169) * [-323.233] (-322.263) (-326.092) (-321.728) -- 0:00:35

      Average standard deviation of split frequencies: 0.015094

      270500 -- [-323.743] (-326.990) (-325.056) (-323.967) * (-322.146) (-324.549) [-324.044] (-326.481) -- 0:00:35
      271000 -- (-322.995) (-325.617) (-327.130) [-326.763] * [-325.809] (-322.075) (-322.642) (-320.889) -- 0:00:34
      271500 -- (-324.639) (-323.679) (-320.483) [-322.622] * [-324.599] (-323.405) (-323.739) (-328.856) -- 0:00:34
      272000 -- (-322.923) (-325.020) [-323.179] (-324.114) * (-322.539) (-323.574) [-324.940] (-324.438) -- 0:00:34
      272500 -- [-321.788] (-327.783) (-321.242) (-322.787) * (-321.271) (-325.859) [-322.212] (-323.309) -- 0:00:34
      273000 -- (-325.446) [-323.850] (-324.760) (-321.392) * (-323.908) (-322.392) [-324.996] (-322.102) -- 0:00:34
      273500 -- (-321.777) (-321.328) (-325.476) [-322.855] * (-324.835) [-323.343] (-323.937) (-327.266) -- 0:00:34
      274000 -- [-323.536] (-324.875) (-327.396) (-323.319) * (-321.065) (-321.639) (-326.216) [-324.971] -- 0:00:34
      274500 -- (-322.366) (-322.890) (-327.187) [-322.129] * [-322.448] (-323.316) (-323.433) (-323.167) -- 0:00:34
      275000 -- (-320.666) (-321.111) (-326.338) [-321.547] * (-327.128) (-322.540) [-322.102] (-322.936) -- 0:00:34

      Average standard deviation of split frequencies: 0.017080

      275500 -- (-321.949) [-323.711] (-321.817) (-323.714) * (-324.963) (-329.046) (-330.408) [-321.486] -- 0:00:34
      276000 -- [-321.025] (-324.610) (-325.790) (-323.338) * (-323.982) (-324.298) [-322.669] (-321.586) -- 0:00:34
      276500 -- (-321.054) (-323.181) [-322.182] (-324.713) * [-323.841] (-322.461) (-323.847) (-321.849) -- 0:00:34
      277000 -- (-323.906) (-327.924) (-323.062) [-324.102] * (-321.024) (-321.200) (-322.277) [-322.606] -- 0:00:33
      277500 -- (-327.335) (-322.919) (-323.185) [-323.739] * (-320.954) (-323.781) (-320.694) [-323.557] -- 0:00:33
      278000 -- [-322.631] (-322.388) (-321.107) (-325.448) * (-325.059) (-321.318) (-324.617) [-323.221] -- 0:00:33
      278500 -- (-322.004) (-324.654) (-323.811) [-325.652] * (-321.921) (-325.239) (-320.696) [-322.564] -- 0:00:33
      279000 -- (-323.119) [-324.624] (-326.955) (-321.720) * (-322.750) [-321.546] (-321.816) (-324.323) -- 0:00:33
      279500 -- [-322.931] (-322.669) (-322.153) (-321.817) * (-321.969) [-322.285] (-322.582) (-323.482) -- 0:00:33
      280000 -- (-325.078) (-324.244) (-320.851) [-321.741] * [-323.188] (-323.067) (-323.189) (-321.963) -- 0:00:33

      Average standard deviation of split frequencies: 0.013437

      280500 -- [-322.564] (-321.401) (-322.288) (-321.629) * [-325.416] (-323.906) (-322.458) (-322.487) -- 0:00:33
      281000 -- (-325.158) [-321.455] (-325.064) (-322.716) * (-327.718) [-323.066] (-325.348) (-322.556) -- 0:00:33
      281500 -- (-322.742) (-324.993) (-325.307) [-320.952] * (-326.019) (-323.700) (-324.357) [-322.182] -- 0:00:33
      282000 -- [-321.870] (-321.799) (-324.158) (-324.436) * [-322.753] (-321.833) (-322.443) (-324.200) -- 0:00:33
      282500 -- (-323.131) [-322.350] (-327.081) (-321.069) * (-327.775) [-321.812] (-322.898) (-321.704) -- 0:00:33
      283000 -- (-321.854) [-326.251] (-324.433) (-322.974) * (-328.168) (-320.782) (-322.567) [-321.195] -- 0:00:32
      283500 -- [-322.195] (-327.074) (-322.840) (-323.784) * [-324.779] (-321.709) (-321.784) (-323.903) -- 0:00:32
      284000 -- [-321.376] (-324.378) (-322.921) (-320.560) * (-320.588) (-321.652) (-324.530) [-322.563] -- 0:00:32
      284500 -- (-321.899) (-325.555) (-323.761) [-321.801] * [-321.146] (-321.630) (-329.290) (-321.412) -- 0:00:32
      285000 -- (-321.036) [-321.778] (-322.917) (-322.628) * (-321.010) (-321.946) [-326.615] (-321.204) -- 0:00:32

      Average standard deviation of split frequencies: 0.012087

      285500 -- (-323.163) [-321.753] (-323.044) (-325.223) * [-323.849] (-323.733) (-328.189) (-325.537) -- 0:00:32
      286000 -- [-321.432] (-324.962) (-326.692) (-327.515) * (-324.117) [-320.728] (-324.093) (-324.377) -- 0:00:32
      286500 -- [-320.637] (-322.212) (-323.881) (-322.783) * [-323.367] (-323.155) (-323.876) (-320.653) -- 0:00:32
      287000 -- (-321.523) (-321.395) [-322.847] (-322.723) * [-322.193] (-324.213) (-322.118) (-322.929) -- 0:00:32
      287500 -- (-322.416) [-322.910] (-323.854) (-321.323) * (-321.261) [-321.197] (-323.978) (-325.213) -- 0:00:32
      288000 -- (-322.863) (-322.738) [-322.334] (-322.054) * (-324.432) (-320.918) [-325.758] (-322.269) -- 0:00:32
      288500 -- (-322.486) (-326.298) [-322.432] (-321.451) * (-323.446) [-321.857] (-322.009) (-322.100) -- 0:00:32
      289000 -- [-322.963] (-323.079) (-324.080) (-321.158) * (-322.855) (-322.434) (-325.437) [-320.464] -- 0:00:31
      289500 -- (-324.246) (-321.613) [-321.897] (-324.249) * (-320.926) (-326.934) (-322.418) [-321.727] -- 0:00:31
      290000 -- (-322.044) (-326.334) (-323.010) [-322.441] * (-322.254) (-322.835) [-321.917] (-324.950) -- 0:00:31

      Average standard deviation of split frequencies: 0.010812

      290500 -- [-324.489] (-325.527) (-322.257) (-321.430) * (-320.633) (-320.983) [-321.941] (-326.186) -- 0:00:31
      291000 -- (-332.053) (-324.452) (-321.666) [-323.997] * (-321.488) (-324.637) [-322.530] (-325.806) -- 0:00:31
      291500 -- [-324.317] (-325.760) (-322.783) (-328.303) * (-324.269) (-326.720) [-322.062] (-323.179) -- 0:00:31
      292000 -- (-324.199) (-329.165) (-325.684) [-322.615] * (-323.835) (-323.084) (-321.017) [-322.421] -- 0:00:31
      292500 -- (-324.798) (-323.549) [-323.869] (-325.883) * (-321.309) [-324.081] (-322.432) (-321.817) -- 0:00:33
      293000 -- (-323.932) [-330.667] (-321.410) (-322.158) * [-322.886] (-324.011) (-321.931) (-324.820) -- 0:00:33
      293500 -- [-320.906] (-321.245) (-321.324) (-325.604) * (-322.242) [-325.118] (-321.576) (-321.922) -- 0:00:33
      294000 -- (-322.391) (-322.746) (-321.749) [-323.925] * [-320.570] (-324.247) (-322.493) (-325.525) -- 0:00:33
      294500 -- [-321.394] (-321.766) (-323.720) (-324.489) * [-322.066] (-321.004) (-322.113) (-321.558) -- 0:00:33
      295000 -- (-321.148) (-326.598) [-322.105] (-324.062) * (-322.198) (-320.598) [-324.699] (-323.182) -- 0:00:33

      Average standard deviation of split frequencies: 0.007432

      295500 -- (-323.760) (-324.219) (-325.996) [-322.615] * [-325.342] (-321.590) (-321.395) (-320.472) -- 0:00:33
      296000 -- [-323.718] (-320.487) (-323.000) (-323.925) * (-322.691) [-321.250] (-322.484) (-322.247) -- 0:00:33
      296500 -- [-322.463] (-324.292) (-323.705) (-325.142) * (-322.178) (-323.361) (-323.816) [-323.046] -- 0:00:33
      297000 -- (-321.063) (-323.077) [-323.618] (-326.346) * (-327.753) [-323.150] (-323.355) (-323.451) -- 0:00:33
      297500 -- (-324.351) (-321.809) [-328.599] (-321.672) * (-323.147) (-322.436) (-323.202) [-321.805] -- 0:00:33
      298000 -- (-323.356) [-324.386] (-322.224) (-322.828) * (-326.841) [-322.731] (-321.095) (-322.882) -- 0:00:32
      298500 -- (-325.858) (-323.152) [-325.840] (-323.086) * [-321.284] (-329.609) (-325.175) (-324.033) -- 0:00:32
      299000 -- (-324.978) (-325.059) (-322.118) [-325.666] * (-322.968) (-323.793) [-323.207] (-323.237) -- 0:00:32
      299500 -- [-323.902] (-322.658) (-325.103) (-322.841) * (-324.521) [-321.688] (-327.090) (-323.027) -- 0:00:32
      300000 -- [-323.072] (-326.368) (-324.536) (-322.839) * (-320.589) (-324.362) [-323.293] (-324.931) -- 0:00:32

      Average standard deviation of split frequencies: 0.012543

      300500 -- (-323.081) [-321.259] (-326.849) (-329.992) * [-322.450] (-323.642) (-324.597) (-330.793) -- 0:00:32
      301000 -- (-321.424) (-323.346) (-323.745) [-324.340] * (-321.100) [-322.084] (-326.253) (-321.393) -- 0:00:32
      301500 -- (-321.863) (-324.245) [-321.391] (-321.983) * (-321.863) (-324.541) [-326.297] (-322.834) -- 0:00:32
      302000 -- (-320.921) (-321.200) (-321.981) [-323.840] * (-322.294) (-327.997) (-321.732) [-322.455] -- 0:00:32
      302500 -- (-325.660) (-321.306) [-322.107] (-321.237) * (-320.977) [-324.800] (-322.495) (-320.968) -- 0:00:32
      303000 -- [-322.360] (-324.184) (-324.101) (-321.743) * (-325.606) (-324.589) (-323.126) [-321.068] -- 0:00:32
      303500 -- (-322.951) [-322.357] (-321.101) (-327.176) * [-322.789] (-324.598) (-321.853) (-322.657) -- 0:00:32
      304000 -- [-324.800] (-323.463) (-324.595) (-321.188) * (-324.094) (-321.279) [-325.608] (-322.999) -- 0:00:32
      304500 -- (-321.575) (-321.747) (-325.585) [-323.671] * (-324.270) (-323.216) (-325.501) [-324.099] -- 0:00:31
      305000 -- [-322.853] (-322.892) (-321.960) (-322.102) * (-322.804) (-327.509) [-322.003] (-322.876) -- 0:00:31

      Average standard deviation of split frequencies: 0.012324

      305500 -- (-326.846) (-325.027) [-321.212] (-322.148) * [-324.309] (-325.840) (-322.122) (-321.337) -- 0:00:31
      306000 -- [-325.933] (-321.864) (-325.983) (-321.785) * (-325.251) (-324.241) [-322.421] (-321.356) -- 0:00:31
      306500 -- [-322.694] (-323.826) (-321.975) (-321.053) * (-323.707) (-323.431) (-323.333) [-322.028] -- 0:00:31
      307000 -- [-321.643] (-322.900) (-323.674) (-325.934) * (-322.065) (-329.954) [-321.273] (-324.290) -- 0:00:31
      307500 -- (-326.849) (-321.118) (-322.781) [-322.356] * (-323.261) [-322.427] (-322.837) (-323.285) -- 0:00:31
      308000 -- (-324.779) (-325.077) (-322.079) [-324.284] * (-323.711) (-321.549) [-326.940] (-323.418) -- 0:00:31
      308500 -- (-321.259) (-320.910) (-321.154) [-325.470] * (-322.547) (-322.927) [-323.043] (-323.404) -- 0:00:31
      309000 -- [-322.433] (-321.140) (-322.872) (-322.504) * (-322.973) [-321.514] (-322.525) (-320.937) -- 0:00:31
      309500 -- (-323.523) (-322.502) [-322.158] (-323.118) * (-321.606) (-323.059) [-321.596] (-323.366) -- 0:00:31
      310000 -- (-325.282) (-325.777) [-321.896] (-322.944) * [-321.074] (-324.358) (-322.282) (-323.165) -- 0:00:31

      Average standard deviation of split frequencies: 0.014162

      310500 -- [-321.882] (-324.212) (-324.605) (-322.739) * (-323.769) [-323.067] (-322.507) (-322.634) -- 0:00:31
      311000 -- [-322.246] (-326.961) (-322.691) (-322.345) * (-324.917) (-323.239) (-321.802) [-324.639] -- 0:00:31
      311500 -- (-323.923) [-324.930] (-321.480) (-322.832) * (-325.747) (-321.253) (-324.757) [-325.369] -- 0:00:30
      312000 -- (-321.984) [-323.959] (-322.505) (-322.493) * (-326.022) (-323.220) (-324.381) [-324.555] -- 0:00:30
      312500 -- (-323.077) (-323.626) [-324.424] (-323.043) * [-323.611] (-321.131) (-324.611) (-321.461) -- 0:00:30
      313000 -- [-322.765] (-323.113) (-323.139) (-325.745) * [-320.737] (-325.778) (-324.867) (-321.285) -- 0:00:30
      313500 -- (-321.252) (-321.222) (-322.011) [-323.864] * (-323.519) (-323.352) (-325.173) [-322.533] -- 0:00:30
      314000 -- [-321.152] (-322.869) (-321.029) (-324.040) * (-324.688) (-325.832) (-322.003) [-321.839] -- 0:00:30
      314500 -- [-321.138] (-323.532) (-321.708) (-323.891) * (-325.946) (-323.155) (-321.270) [-322.763] -- 0:00:30
      315000 -- [-321.328] (-322.533) (-323.830) (-324.728) * (-323.105) (-320.611) [-324.480] (-325.942) -- 0:00:30

      Average standard deviation of split frequencies: 0.012929

      315500 -- [-320.775] (-321.236) (-320.873) (-323.301) * (-322.287) (-324.779) (-323.796) [-322.937] -- 0:00:32
      316000 -- [-321.704] (-324.534) (-325.056) (-321.777) * [-324.424] (-322.764) (-320.823) (-322.755) -- 0:00:32
      316500 -- (-323.096) [-325.408] (-327.395) (-323.588) * (-325.346) [-322.921] (-322.020) (-327.842) -- 0:00:32
      317000 -- (-324.820) (-322.574) [-321.364] (-322.750) * (-320.483) [-320.861] (-322.350) (-327.950) -- 0:00:32
      317500 -- (-324.021) (-324.354) [-320.828] (-323.533) * (-323.820) [-322.365] (-323.175) (-323.780) -- 0:00:32
      318000 -- (-322.028) [-325.219] (-321.809) (-321.535) * (-324.660) (-325.944) (-324.200) [-325.034] -- 0:00:32
      318500 -- (-321.316) (-323.205) [-321.708] (-323.076) * (-324.147) [-321.560] (-323.204) (-320.739) -- 0:00:32
      319000 -- (-326.336) (-322.771) [-323.031] (-324.070) * (-324.934) (-323.115) (-322.772) [-322.645] -- 0:00:32
      319500 -- (-322.695) (-323.330) [-322.179] (-321.314) * (-322.662) (-321.466) [-324.572] (-322.118) -- 0:00:31
      320000 -- [-322.480] (-325.472) (-325.656) (-321.607) * [-322.558] (-322.085) (-321.940) (-324.446) -- 0:00:31

      Average standard deviation of split frequencies: 0.014701

      320500 -- (-323.387) [-324.608] (-321.621) (-322.421) * (-323.496) [-324.117] (-323.314) (-322.747) -- 0:00:31
      321000 -- (-323.718) [-322.128] (-321.059) (-323.698) * [-320.629] (-322.908) (-321.955) (-324.431) -- 0:00:31
      321500 -- (-321.332) (-321.035) (-322.538) [-327.119] * (-321.007) (-325.948) [-322.825] (-324.667) -- 0:00:31
      322000 -- (-323.141) (-323.232) (-322.805) [-322.947] * (-322.083) (-321.498) (-321.605) [-321.358] -- 0:00:31
      322500 -- (-324.877) [-322.426] (-323.802) (-321.714) * (-325.721) [-323.631] (-322.682) (-323.285) -- 0:00:31
      323000 -- (-326.078) (-321.984) (-323.565) [-321.153] * (-323.924) (-321.960) [-321.369] (-322.453) -- 0:00:31
      323500 -- (-323.204) (-323.223) (-327.891) [-322.829] * [-321.760] (-324.051) (-324.243) (-324.963) -- 0:00:31
      324000 -- [-321.842] (-322.097) (-328.248) (-321.084) * [-324.012] (-321.124) (-322.620) (-322.983) -- 0:00:31
      324500 -- (-323.456) (-321.402) (-322.989) [-321.102] * (-322.421) (-322.979) [-326.748] (-322.012) -- 0:00:31
      325000 -- [-322.197] (-327.211) (-321.071) (-324.403) * (-321.505) [-321.951] (-321.948) (-325.589) -- 0:00:31

      Average standard deviation of split frequencies: 0.015424

      325500 -- (-325.542) (-322.677) (-322.112) [-324.866] * (-329.523) [-325.132] (-324.209) (-325.356) -- 0:00:31
      326000 -- [-321.135] (-325.291) (-321.345) (-322.451) * (-322.493) (-320.455) [-327.682] (-323.233) -- 0:00:31
      326500 -- (-322.143) (-323.891) [-321.903] (-322.318) * (-325.221) (-320.918) (-322.018) [-323.786] -- 0:00:30
      327000 -- (-321.797) [-322.046] (-322.453) (-323.511) * (-322.301) (-320.680) [-322.172] (-323.188) -- 0:00:30
      327500 -- (-323.775) [-321.241] (-321.730) (-326.481) * (-324.371) (-325.383) (-323.000) [-323.293] -- 0:00:30
      328000 -- [-322.426] (-322.564) (-321.597) (-322.977) * (-324.428) (-324.128) (-322.722) [-322.217] -- 0:00:30
      328500 -- (-323.037) (-323.440) [-322.186] (-322.423) * [-322.328] (-322.617) (-321.160) (-322.114) -- 0:00:30
      329000 -- (-320.875) (-324.623) [-323.730] (-325.817) * (-323.155) [-321.527] (-326.823) (-321.357) -- 0:00:30
      329500 -- (-322.560) (-321.567) [-321.390] (-322.378) * (-321.133) [-322.223] (-321.118) (-321.789) -- 0:00:30
      330000 -- (-324.318) [-327.221] (-322.194) (-321.556) * [-323.021] (-322.324) (-321.252) (-322.740) -- 0:00:30

      Average standard deviation of split frequencies: 0.018058

      330500 -- (-322.624) (-322.803) [-323.418] (-321.928) * (-322.484) (-328.375) [-323.017] (-324.284) -- 0:00:30
      331000 -- [-323.215] (-321.244) (-322.371) (-324.392) * (-322.713) (-320.982) (-328.426) [-320.823] -- 0:00:30
      331500 -- (-321.834) [-320.405] (-323.015) (-324.853) * (-326.570) (-325.952) [-322.937] (-322.435) -- 0:00:30
      332000 -- (-324.608) [-321.814] (-324.574) (-323.651) * (-323.166) [-321.368] (-322.490) (-323.060) -- 0:00:30
      332500 -- (-321.047) (-325.858) [-321.601] (-320.753) * (-324.386) (-323.357) (-322.918) [-327.778] -- 0:00:30
      333000 -- (-320.962) (-325.814) (-322.796) [-323.554] * [-321.223] (-325.902) (-326.923) (-328.027) -- 0:00:30
      333500 -- (-322.687) (-323.221) (-326.466) [-326.123] * (-321.293) (-322.836) (-327.118) [-326.390] -- 0:00:29
      334000 -- (-321.478) (-321.640) [-322.490] (-320.968) * (-322.385) (-321.841) (-327.561) [-321.371] -- 0:00:29
      334500 -- (-321.312) [-324.023] (-323.412) (-322.160) * (-323.971) (-322.143) (-321.725) [-322.168] -- 0:00:29
      335000 -- (-325.481) (-322.469) (-321.859) [-321.433] * (-322.234) [-322.294] (-324.289) (-322.240) -- 0:00:29

      Average standard deviation of split frequencies: 0.017771

      335500 -- (-326.524) [-322.287] (-325.251) (-321.605) * [-323.336] (-329.164) (-322.844) (-322.473) -- 0:00:29
      336000 -- [-325.733] (-325.313) (-321.080) (-323.094) * [-321.805] (-321.266) (-321.522) (-326.296) -- 0:00:29
      336500 -- (-324.419) [-321.415] (-322.007) (-321.712) * (-325.496) (-322.226) [-322.954] (-324.516) -- 0:00:29
      337000 -- (-325.640) (-322.615) [-321.699] (-321.452) * (-322.925) (-322.528) [-320.564] (-321.283) -- 0:00:29
      337500 -- (-325.225) [-322.622] (-324.863) (-323.152) * [-323.194] (-323.967) (-324.073) (-320.713) -- 0:00:29
      338000 -- [-324.706] (-328.163) (-322.356) (-322.210) * [-321.297] (-324.972) (-323.112) (-321.148) -- 0:00:31
      338500 -- [-321.721] (-326.666) (-322.264) (-322.597) * [-325.696] (-325.033) (-323.033) (-321.839) -- 0:00:31
      339000 -- [-321.783] (-325.464) (-324.477) (-324.583) * [-324.188] (-321.179) (-326.332) (-321.937) -- 0:00:31
      339500 -- (-322.341) (-327.239) [-322.938] (-323.707) * (-321.995) (-322.073) (-323.421) [-327.719] -- 0:00:31
      340000 -- (-323.493) (-323.590) [-322.743] (-324.553) * (-320.897) (-321.761) (-325.886) [-324.499] -- 0:00:31

      Average standard deviation of split frequencies: 0.016605

      340500 -- [-323.568] (-326.322) (-323.228) (-323.620) * (-322.617) [-322.790] (-323.871) (-323.096) -- 0:00:30
      341000 -- (-321.863) (-321.887) (-321.441) [-322.204] * (-326.258) (-323.344) [-325.081] (-323.615) -- 0:00:30
      341500 -- (-320.695) (-322.692) [-323.030] (-325.487) * (-321.650) (-322.242) (-325.901) [-323.307] -- 0:00:30
      342000 -- (-321.127) (-326.276) (-323.203) [-324.104] * [-320.826] (-323.041) (-324.521) (-325.262) -- 0:00:30
      342500 -- [-321.932] (-325.892) (-322.302) (-322.758) * [-323.720] (-321.550) (-325.485) (-324.418) -- 0:00:30
      343000 -- (-323.635) (-321.181) (-322.504) [-328.189] * (-324.238) (-321.578) [-320.982] (-323.238) -- 0:00:30
      343500 -- [-321.705] (-323.985) (-321.575) (-325.037) * (-320.820) (-321.363) [-320.787] (-322.834) -- 0:00:30
      344000 -- (-325.413) (-327.104) (-324.765) [-323.923] * (-321.940) (-323.170) (-325.500) [-326.730] -- 0:00:30
      344500 -- (-323.235) (-324.236) (-321.970) [-321.318] * (-322.163) (-323.670) (-321.789) [-322.958] -- 0:00:30
      345000 -- (-323.321) (-323.430) (-321.303) [-322.081] * (-322.280) [-321.736] (-324.161) (-323.058) -- 0:00:30

      Average standard deviation of split frequencies: 0.015441

      345500 -- (-321.039) [-322.188] (-321.806) (-321.466) * (-321.375) (-321.990) (-322.864) [-324.371] -- 0:00:30
      346000 -- (-320.508) (-322.348) (-325.868) [-324.269] * [-322.500] (-322.426) (-322.062) (-322.605) -- 0:00:30
      346500 -- [-320.426] (-322.225) (-320.874) (-323.792) * [-325.516] (-322.405) (-323.505) (-323.460) -- 0:00:30
      347000 -- [-321.562] (-322.801) (-321.412) (-323.935) * (-325.942) (-320.991) (-322.924) [-321.891] -- 0:00:30
      347500 -- (-320.672) [-322.578] (-321.085) (-321.015) * [-322.125] (-323.067) (-325.040) (-323.354) -- 0:00:30
      348000 -- (-322.220) (-326.018) [-321.899] (-320.931) * (-320.808) (-323.969) (-321.240) [-321.092] -- 0:00:29
      348500 -- (-322.916) [-321.479] (-325.192) (-325.357) * (-323.556) (-321.733) (-323.131) [-323.304] -- 0:00:29
      349000 -- [-322.196] (-322.204) (-324.089) (-321.628) * (-322.776) (-320.721) (-321.300) [-321.969] -- 0:00:29
      349500 -- (-321.146) [-320.971] (-321.382) (-321.862) * (-323.751) (-322.813) (-321.042) [-320.715] -- 0:00:29
      350000 -- (-320.853) (-324.151) (-324.913) [-323.551] * [-327.342] (-327.497) (-326.045) (-320.580) -- 0:00:29

      Average standard deviation of split frequencies: 0.016132

      350500 -- (-325.794) [-322.033] (-323.059) (-322.554) * (-326.868) (-328.817) (-321.350) [-322.368] -- 0:00:29
      351000 -- [-321.750] (-320.967) (-325.838) (-321.751) * [-322.321] (-322.128) (-325.531) (-324.600) -- 0:00:29
      351500 -- [-322.689] (-321.835) (-328.912) (-321.221) * (-324.483) (-323.759) (-324.039) [-322.224] -- 0:00:29
      352000 -- (-323.866) (-321.760) (-323.342) [-323.794] * (-320.900) [-321.791] (-321.476) (-322.917) -- 0:00:29
      352500 -- (-321.008) [-324.333] (-324.356) (-322.309) * [-323.174] (-321.395) (-324.268) (-325.383) -- 0:00:29
      353000 -- [-321.619] (-322.219) (-326.448) (-322.846) * [-321.612] (-323.686) (-323.981) (-323.414) -- 0:00:29
      353500 -- (-327.129) [-320.914] (-328.631) (-321.739) * (-323.461) (-324.138) [-321.621] (-326.137) -- 0:00:29
      354000 -- (-326.649) [-323.591] (-322.250) (-322.927) * (-321.064) (-322.628) (-325.267) [-321.835] -- 0:00:29
      354500 -- (-321.462) (-322.765) [-322.877] (-322.693) * (-323.563) (-322.193) [-324.389] (-323.268) -- 0:00:29
      355000 -- (-320.906) (-324.504) (-326.800) [-321.363] * (-322.682) (-321.096) [-322.591] (-321.222) -- 0:00:29

      Average standard deviation of split frequencies: 0.016773

      355500 -- (-326.299) (-323.998) (-324.204) [-321.855] * [-321.638] (-322.198) (-321.602) (-324.941) -- 0:00:29
      356000 -- (-324.548) (-324.850) [-323.875] (-323.343) * (-322.697) (-328.492) [-323.197] (-322.317) -- 0:00:28
      356500 -- (-321.041) (-324.291) [-324.775] (-325.030) * [-322.125] (-326.116) (-321.494) (-323.846) -- 0:00:28
      357000 -- [-321.801] (-321.111) (-323.640) (-323.524) * (-321.750) (-323.925) [-322.068] (-326.042) -- 0:00:28
      357500 -- [-322.808] (-320.905) (-324.236) (-322.152) * (-326.623) (-321.222) [-321.937] (-322.892) -- 0:00:28
      358000 -- [-322.875] (-321.667) (-324.551) (-322.017) * (-322.915) [-322.513] (-321.469) (-322.182) -- 0:00:28
      358500 -- [-324.459] (-325.059) (-320.940) (-324.258) * (-321.278) (-324.412) (-321.421) [-324.120] -- 0:00:28
      359000 -- [-322.097] (-322.707) (-322.561) (-322.801) * (-322.393) (-325.119) (-321.954) [-322.619] -- 0:00:28
      359500 -- (-320.998) (-321.825) [-322.577] (-321.221) * (-320.935) (-331.776) [-323.288] (-322.028) -- 0:00:28
      360000 -- [-320.824] (-324.876) (-323.454) (-323.731) * (-322.082) [-324.668] (-322.934) (-323.304) -- 0:00:28

      Average standard deviation of split frequencies: 0.016556

      360500 -- (-328.498) (-320.556) (-321.214) [-325.334] * (-321.277) [-326.332] (-321.016) (-324.519) -- 0:00:28
      361000 -- (-323.917) (-336.661) (-323.348) [-321.602] * [-322.948] (-321.889) (-321.266) (-321.181) -- 0:00:30
      361500 -- [-325.284] (-332.470) (-322.592) (-322.264) * (-323.178) [-322.661] (-327.005) (-323.204) -- 0:00:30
      362000 -- (-322.544) (-325.222) [-324.351] (-322.739) * [-322.468] (-321.245) (-323.587) (-324.234) -- 0:00:29
      362500 -- [-320.672] (-320.827) (-322.359) (-322.203) * (-322.538) [-322.440] (-322.809) (-323.175) -- 0:00:29
      363000 -- (-322.168) [-323.344] (-321.582) (-324.310) * (-321.232) (-321.222) (-321.423) [-325.904] -- 0:00:29
      363500 -- [-325.295] (-321.908) (-323.974) (-325.518) * (-323.346) (-322.895) (-322.134) [-322.715] -- 0:00:29
      364000 -- (-322.084) (-323.853) (-323.818) [-321.482] * (-324.834) (-321.983) [-322.037] (-328.963) -- 0:00:29
      364500 -- (-322.587) (-322.199) [-321.778] (-323.757) * (-325.101) [-322.233] (-321.015) (-322.352) -- 0:00:29
      365000 -- (-324.837) (-324.974) (-323.174) [-321.535] * (-322.555) (-322.418) [-323.073] (-321.422) -- 0:00:29

      Average standard deviation of split frequencies: 0.017173

      365500 -- (-324.311) [-324.657] (-322.970) (-324.349) * (-324.228) (-322.157) [-321.518] (-325.747) -- 0:00:29
      366000 -- (-323.289) [-322.038] (-324.028) (-325.650) * (-321.025) (-325.767) [-321.783] (-323.629) -- 0:00:29
      366500 -- (-323.095) [-322.746] (-322.709) (-321.218) * (-324.694) [-324.879] (-322.415) (-322.427) -- 0:00:29
      367000 -- (-324.710) (-322.793) (-321.773) [-325.696] * (-326.438) (-322.045) [-322.857] (-321.853) -- 0:00:29
      367500 -- (-324.283) [-326.770] (-321.087) (-322.471) * [-323.928] (-323.557) (-321.402) (-325.352) -- 0:00:29
      368000 -- (-323.283) [-323.506] (-326.270) (-321.492) * (-321.647) (-323.513) [-324.285] (-327.587) -- 0:00:29
      368500 -- (-325.023) [-321.556] (-322.272) (-322.910) * (-330.543) (-323.736) [-322.655] (-323.659) -- 0:00:29
      369000 -- [-322.463] (-321.637) (-321.402) (-322.049) * [-323.879] (-324.065) (-326.776) (-323.329) -- 0:00:29
      369500 -- [-322.625] (-322.367) (-323.806) (-321.085) * (-321.311) (-328.620) (-323.919) [-321.633] -- 0:00:29
      370000 -- (-324.755) (-322.743) (-321.493) [-321.079] * (-324.894) [-324.745] (-323.708) (-321.832) -- 0:00:28

      Average standard deviation of split frequencies: 0.015261

      370500 -- (-326.148) (-323.815) [-321.251] (-328.172) * (-323.837) [-324.277] (-323.038) (-321.465) -- 0:00:28
      371000 -- [-320.512] (-324.062) (-322.391) (-329.757) * (-324.294) (-323.556) (-328.653) [-322.409] -- 0:00:28
      371500 -- (-323.509) (-323.225) [-323.853] (-323.297) * [-323.190] (-328.918) (-321.410) (-321.867) -- 0:00:28
      372000 -- [-322.618] (-325.792) (-323.805) (-323.890) * (-324.153) (-322.387) [-321.079] (-323.318) -- 0:00:28
      372500 -- (-321.759) (-326.802) [-323.228] (-327.887) * [-322.550] (-322.322) (-321.830) (-324.081) -- 0:00:28
      373000 -- (-321.579) (-321.122) (-322.631) [-322.335] * (-323.168) (-322.508) [-325.981] (-327.567) -- 0:00:28
      373500 -- (-322.140) (-322.851) (-323.048) [-320.770] * (-320.954) [-322.038] (-321.254) (-324.568) -- 0:00:28
      374000 -- [-321.866] (-326.873) (-324.201) (-321.407) * (-321.341) [-323.984] (-322.588) (-322.878) -- 0:00:28
      374500 -- (-326.264) [-324.209] (-322.643) (-325.233) * (-328.094) (-331.038) [-324.014] (-322.393) -- 0:00:28
      375000 -- (-324.683) [-322.191] (-325.861) (-323.121) * (-323.162) (-323.389) (-321.858) [-321.624] -- 0:00:28

      Average standard deviation of split frequencies: 0.014209

      375500 -- (-323.576) [-321.648] (-329.512) (-323.152) * [-322.318] (-323.104) (-325.829) (-323.385) -- 0:00:28
      376000 -- (-325.330) [-321.283] (-328.610) (-324.114) * (-323.279) (-322.022) (-324.182) [-322.607] -- 0:00:28
      376500 -- (-321.660) [-321.187] (-327.665) (-323.942) * [-320.730] (-320.695) (-325.070) (-320.767) -- 0:00:28
      377000 -- (-322.290) (-322.820) [-321.019] (-326.734) * (-322.386) (-323.583) (-326.823) [-323.619] -- 0:00:28
      377500 -- [-327.143] (-322.182) (-322.438) (-325.400) * (-325.320) (-324.692) [-323.801] (-321.069) -- 0:00:28
      378000 -- (-325.108) (-323.930) (-323.089) [-322.442] * (-324.444) [-322.382] (-323.745) (-323.064) -- 0:00:27
      378500 -- (-324.310) (-321.213) [-321.592] (-320.673) * [-322.072] (-324.901) (-320.964) (-322.121) -- 0:00:27
      379000 -- (-321.690) (-323.090) (-323.449) [-323.133] * [-321.853] (-323.421) (-320.849) (-322.581) -- 0:00:27
      379500 -- (-323.433) (-322.141) (-322.946) [-323.080] * (-325.639) (-324.105) [-321.219] (-326.773) -- 0:00:27
      380000 -- (-323.601) (-321.532) (-321.765) [-321.220] * [-321.474] (-327.580) (-321.710) (-326.046) -- 0:00:27

      Average standard deviation of split frequencies: 0.016512

      380500 -- (-321.377) [-322.999] (-322.198) (-324.343) * (-322.495) (-323.766) [-321.582] (-324.090) -- 0:00:27
      381000 -- (-323.508) (-324.041) (-322.428) [-322.585] * (-322.294) (-323.482) (-324.158) [-322.186] -- 0:00:27
      381500 -- (-321.311) [-320.827] (-320.769) (-322.418) * (-322.487) (-325.457) (-320.890) [-325.082] -- 0:00:27
      382000 -- (-324.567) [-324.358] (-323.010) (-326.373) * (-322.945) (-324.052) (-321.249) [-320.872] -- 0:00:27
      382500 -- (-321.672) [-321.874] (-323.966) (-321.927) * (-322.953) [-321.948] (-323.210) (-326.149) -- 0:00:27
      383000 -- [-323.563] (-327.175) (-321.004) (-322.436) * (-326.572) [-322.880] (-323.678) (-321.042) -- 0:00:27
      383500 -- (-325.633) (-325.430) (-320.722) [-322.130] * (-324.332) (-324.236) (-322.132) [-325.182] -- 0:00:27
      384000 -- (-325.090) [-322.770] (-321.909) (-322.586) * (-329.855) (-321.972) [-321.860] (-321.480) -- 0:00:28
      384500 -- (-323.564) [-320.943] (-322.954) (-324.210) * (-323.598) (-321.447) [-323.763] (-329.226) -- 0:00:28
      385000 -- (-321.076) [-321.698] (-324.892) (-321.138) * (-322.805) (-322.056) (-323.199) [-322.462] -- 0:00:28

      Average standard deviation of split frequencies: 0.015469

      385500 -- (-323.498) (-322.401) [-320.942] (-321.326) * [-322.115] (-322.659) (-325.288) (-324.099) -- 0:00:28
      386000 -- (-320.951) (-327.134) (-322.435) [-321.069] * [-323.025] (-326.151) (-323.149) (-321.548) -- 0:00:28
      386500 -- (-323.621) (-325.258) (-323.588) [-320.706] * (-322.099) (-326.535) [-325.314] (-322.742) -- 0:00:28
      387000 -- (-325.413) (-324.126) [-321.671] (-324.912) * (-322.034) (-324.719) [-323.489] (-324.234) -- 0:00:28
      387500 -- [-322.692] (-323.398) (-322.633) (-322.789) * (-321.036) (-320.539) (-322.386) [-323.153] -- 0:00:28
      388000 -- (-322.642) (-323.558) [-322.401] (-323.032) * (-322.980) (-323.677) (-321.241) [-325.523] -- 0:00:28
      388500 -- [-321.618] (-322.940) (-322.562) (-320.765) * (-324.207) (-322.899) (-322.063) [-323.046] -- 0:00:28
      389000 -- [-324.542] (-324.086) (-324.095) (-323.148) * (-320.855) (-325.311) (-321.509) [-322.127] -- 0:00:28
      389500 -- (-322.617) (-324.442) [-323.641] (-321.550) * (-324.799) (-322.342) (-323.235) [-327.674] -- 0:00:28
      390000 -- (-324.983) (-322.657) [-321.317] (-322.763) * (-325.067) (-321.350) (-328.381) [-321.524] -- 0:00:28

      Average standard deviation of split frequencies: 0.014480

      390500 -- (-322.558) (-323.459) [-322.608] (-322.147) * (-320.994) [-322.621] (-324.866) (-327.931) -- 0:00:28
      391000 -- [-324.025] (-325.843) (-325.070) (-324.186) * [-322.525] (-323.805) (-322.543) (-322.265) -- 0:00:28
      391500 -- (-321.160) [-320.874] (-324.238) (-324.250) * (-321.587) (-325.326) [-323.154] (-322.859) -- 0:00:27
      392000 -- (-323.859) (-322.834) [-323.569] (-321.918) * (-322.021) [-322.168] (-321.621) (-321.210) -- 0:00:27
      392500 -- (-323.419) (-322.244) [-321.054] (-323.759) * (-324.423) (-323.302) [-324.892] (-323.686) -- 0:00:27
      393000 -- [-321.795] (-322.345) (-325.246) (-323.392) * (-323.778) (-328.442) (-324.248) [-324.354] -- 0:00:27
      393500 -- (-322.616) (-321.073) [-322.765] (-325.184) * (-325.817) (-323.075) [-323.558] (-323.924) -- 0:00:27
      394000 -- (-322.180) (-323.629) [-321.734] (-322.053) * (-326.468) (-322.611) [-320.840] (-321.821) -- 0:00:27
      394500 -- (-323.868) [-325.724] (-324.951) (-322.259) * [-322.983] (-322.885) (-322.814) (-321.013) -- 0:00:27
      395000 -- [-324.136] (-327.815) (-326.020) (-322.443) * [-323.680] (-323.949) (-322.726) (-323.135) -- 0:00:27

      Average standard deviation of split frequencies: 0.011904

      395500 -- (-329.186) (-322.598) (-322.404) [-323.654] * (-322.335) (-321.800) (-324.163) [-323.395] -- 0:00:27
      396000 -- (-323.829) [-321.272] (-324.142) (-320.758) * (-322.284) [-323.150] (-325.833) (-321.884) -- 0:00:27
      396500 -- [-323.070] (-322.530) (-321.124) (-321.924) * (-321.673) (-326.078) [-322.684] (-322.676) -- 0:00:27
      397000 -- (-322.844) [-322.929] (-321.501) (-325.348) * (-326.244) (-322.756) (-322.277) [-322.729] -- 0:00:27
      397500 -- (-322.473) (-324.014) (-322.068) [-322.617] * [-322.715] (-324.284) (-324.198) (-323.345) -- 0:00:27
      398000 -- (-325.472) (-323.649) [-321.485] (-324.630) * (-322.661) (-327.091) (-322.787) [-322.459] -- 0:00:27
      398500 -- (-322.851) (-328.258) (-322.182) [-322.926] * (-323.667) (-323.647) (-323.029) [-323.556] -- 0:00:27
      399000 -- (-324.510) (-329.899) (-324.388) [-322.515] * (-324.435) (-323.933) [-324.364] (-321.699) -- 0:00:27
      399500 -- (-324.374) (-329.170) (-322.332) [-321.598] * (-323.849) [-323.592] (-328.353) (-320.970) -- 0:00:27
      400000 -- (-325.672) (-324.222) [-326.297] (-324.951) * (-322.289) (-323.711) (-321.502) [-321.508] -- 0:00:27

      Average standard deviation of split frequencies: 0.011766

      400500 -- (-324.232) [-321.462] (-323.846) (-323.135) * (-322.468) [-322.500] (-324.998) (-321.623) -- 0:00:26
      401000 -- (-327.557) (-324.004) [-321.799] (-321.088) * (-323.305) (-322.197) [-330.527] (-321.686) -- 0:00:26
      401500 -- [-322.860] (-324.065) (-321.170) (-323.125) * (-324.038) (-325.347) (-330.795) [-322.654] -- 0:00:26
      402000 -- (-323.021) (-322.931) [-323.048] (-324.467) * (-321.121) (-323.550) [-324.495] (-324.136) -- 0:00:26
      402500 -- (-321.299) (-322.931) (-322.401) [-321.585] * [-321.198] (-323.862) (-320.547) (-328.488) -- 0:00:26
      403000 -- (-322.577) (-322.018) (-322.380) [-321.620] * [-326.063] (-322.575) (-322.053) (-327.766) -- 0:00:26
      403500 -- (-323.448) (-321.557) [-324.638] (-326.552) * (-322.524) (-324.634) [-322.601] (-323.791) -- 0:00:26
      404000 -- (-324.655) [-321.346] (-326.109) (-323.335) * (-323.066) [-324.087] (-329.605) (-321.826) -- 0:00:26
      404500 -- (-327.476) [-322.298] (-328.772) (-321.839) * [-323.066] (-321.803) (-321.932) (-321.745) -- 0:00:26
      405000 -- (-324.118) [-328.340] (-326.170) (-320.877) * (-322.664) (-321.690) [-321.087] (-323.400) -- 0:00:26

      Average standard deviation of split frequencies: 0.011611

      405500 -- [-323.539] (-320.688) (-323.913) (-323.440) * [-322.670] (-325.411) (-321.757) (-323.500) -- 0:00:26
      406000 -- (-321.720) [-321.943] (-326.631) (-321.868) * (-323.004) (-321.471) [-321.737] (-321.806) -- 0:00:27
      406500 -- (-322.602) (-323.049) (-323.903) [-321.348] * [-328.751] (-322.575) (-322.268) (-322.292) -- 0:00:27
      407000 -- (-320.770) (-324.082) (-329.468) [-321.022] * [-323.430] (-325.845) (-323.462) (-322.971) -- 0:00:27
      407500 -- (-321.565) [-324.477] (-321.923) (-326.531) * (-323.762) (-328.296) [-323.457] (-323.820) -- 0:00:27
      408000 -- (-320.506) (-322.771) (-320.814) [-323.328] * (-330.006) (-322.483) [-322.645] (-321.108) -- 0:00:27
      408500 -- [-322.107] (-327.061) (-325.806) (-322.320) * (-324.252) [-320.658] (-320.480) (-321.145) -- 0:00:27
      409000 -- (-322.241) (-323.742) (-325.748) [-327.759] * (-323.377) [-324.904] (-321.082) (-322.773) -- 0:00:27
      409500 -- (-321.890) (-324.939) [-326.376] (-321.230) * (-321.787) (-321.640) [-323.387] (-323.948) -- 0:00:27
      410000 -- (-325.204) (-323.975) [-325.478] (-328.536) * (-325.508) (-323.541) (-322.410) [-322.945] -- 0:00:27

      Average standard deviation of split frequencies: 0.011479

      410500 -- [-324.349] (-330.623) (-328.306) (-326.345) * (-321.061) [-322.840] (-322.591) (-323.550) -- 0:00:27
      411000 -- (-322.640) [-327.008] (-329.822) (-324.073) * [-322.958] (-323.205) (-322.123) (-321.171) -- 0:00:27
      411500 -- (-324.200) (-321.792) (-324.171) [-320.953] * [-322.515] (-325.914) (-321.488) (-323.333) -- 0:00:27
      412000 -- [-323.950] (-324.218) (-322.251) (-327.452) * (-323.507) [-324.723] (-323.333) (-321.741) -- 0:00:27
      412500 -- (-329.421) (-321.578) [-322.846] (-325.674) * (-326.842) [-322.336] (-324.687) (-322.788) -- 0:00:27
      413000 -- (-323.013) (-322.314) [-321.230] (-321.597) * (-322.775) [-321.673] (-326.485) (-327.380) -- 0:00:27
      413500 -- (-328.683) (-324.446) (-321.758) [-322.703] * [-320.552] (-323.388) (-323.849) (-321.734) -- 0:00:26
      414000 -- [-325.341] (-321.183) (-321.400) (-322.139) * (-321.317) (-323.087) [-323.577] (-321.939) -- 0:00:26
      414500 -- (-325.152) [-321.086] (-322.041) (-328.353) * (-322.952) (-322.084) [-323.436] (-322.373) -- 0:00:26
      415000 -- [-325.237] (-323.800) (-324.090) (-324.424) * (-325.140) (-327.187) (-321.839) [-322.333] -- 0:00:26

      Average standard deviation of split frequencies: 0.009065

      415500 -- [-323.716] (-322.859) (-324.165) (-326.257) * (-322.897) (-323.231) (-321.777) [-323.208] -- 0:00:26
      416000 -- (-322.037) (-331.882) [-324.364] (-322.528) * [-324.720] (-321.874) (-325.150) (-323.344) -- 0:00:26
      416500 -- (-322.048) [-323.263] (-323.275) (-323.416) * (-323.484) (-321.247) (-324.408) [-321.126] -- 0:00:26
      417000 -- (-321.913) (-325.764) (-325.997) [-322.795] * (-325.163) [-321.571] (-321.634) (-322.420) -- 0:00:26
      417500 -- (-324.538) [-322.982] (-323.945) (-323.207) * [-322.290] (-321.365) (-322.619) (-320.728) -- 0:00:26
      418000 -- [-321.499] (-322.720) (-322.679) (-321.808) * [-322.983] (-326.218) (-321.340) (-322.047) -- 0:00:26
      418500 -- (-325.110) [-323.522] (-322.385) (-325.663) * (-322.859) [-322.277] (-322.352) (-323.551) -- 0:00:26
      419000 -- (-327.165) [-326.905] (-322.551) (-321.208) * (-322.887) (-322.696) [-322.572] (-326.384) -- 0:00:26
      419500 -- (-328.085) (-320.686) (-322.946) [-321.647] * (-327.032) (-326.419) [-321.913] (-322.050) -- 0:00:26
      420000 -- [-323.751] (-322.022) (-325.922) (-329.995) * (-320.941) [-322.631] (-322.125) (-321.384) -- 0:00:26

      Average standard deviation of split frequencies: 0.007471

      420500 -- (-322.057) (-321.109) [-327.445] (-323.778) * (-321.252) (-321.516) [-322.487] (-325.690) -- 0:00:26
      421000 -- (-322.733) [-321.109] (-320.888) (-325.186) * (-324.420) [-324.190] (-320.768) (-321.303) -- 0:00:26
      421500 -- (-321.723) (-322.000) (-322.351) [-321.068] * (-323.851) [-324.438] (-321.780) (-324.387) -- 0:00:26
      422000 -- [-321.180] (-322.470) (-320.982) (-321.942) * (-322.973) (-325.511) [-321.706] (-322.121) -- 0:00:26
      422500 -- [-322.017] (-322.891) (-323.912) (-322.018) * (-321.322) [-322.213] (-322.067) (-322.846) -- 0:00:25
      423000 -- [-324.376] (-324.042) (-323.200) (-321.837) * [-323.781] (-324.404) (-321.456) (-322.986) -- 0:00:25
      423500 -- [-321.917] (-322.352) (-325.057) (-323.863) * (-322.034) (-327.776) [-321.541] (-321.220) -- 0:00:25
      424000 -- (-321.395) [-321.390] (-322.791) (-326.405) * (-324.086) (-324.379) [-321.843] (-323.467) -- 0:00:25
      424500 -- (-322.091) [-322.759] (-321.584) (-325.092) * (-324.744) (-321.744) (-322.700) [-322.603] -- 0:00:25
      425000 -- (-324.278) (-321.470) (-326.311) [-321.715] * (-322.548) (-321.198) [-321.370] (-320.787) -- 0:00:25

      Average standard deviation of split frequencies: 0.011804

      425500 -- (-322.453) (-322.877) [-321.924] (-324.188) * (-321.264) [-326.230] (-321.294) (-323.171) -- 0:00:25
      426000 -- (-322.940) (-322.850) (-322.097) [-324.757] * (-322.952) (-329.805) (-321.866) [-321.291] -- 0:00:25
      426500 -- (-324.011) (-321.591) [-321.690] (-321.979) * (-325.521) [-320.524] (-321.501) (-322.741) -- 0:00:25
      427000 -- (-322.333) (-323.652) (-321.048) [-321.709] * [-323.564] (-321.099) (-324.474) (-327.490) -- 0:00:25
      427500 -- (-320.831) (-322.567) [-321.100] (-325.082) * [-320.959] (-320.691) (-323.123) (-323.218) -- 0:00:25
      428000 -- (-323.131) (-323.864) [-327.479] (-323.671) * (-323.616) [-322.419] (-323.612) (-322.963) -- 0:00:25
      428500 -- (-321.747) [-322.107] (-328.437) (-324.047) * (-321.731) [-322.296] (-322.452) (-322.779) -- 0:00:25
      429000 -- (-321.241) [-322.694] (-322.146) (-324.230) * (-322.133) [-323.773] (-323.096) (-323.136) -- 0:00:26
      429500 -- (-323.323) (-322.042) (-323.121) [-321.584] * (-325.581) (-325.258) [-322.772] (-324.952) -- 0:00:26
      430000 -- (-323.722) (-323.651) (-321.561) [-322.832] * (-323.072) (-324.465) [-322.232] (-320.939) -- 0:00:26

      Average standard deviation of split frequencies: 0.014595

      430500 -- (-323.943) [-320.917] (-321.673) (-322.427) * (-323.886) (-323.844) [-323.358] (-321.924) -- 0:00:26
      431000 -- (-325.876) (-325.758) [-323.344] (-322.063) * (-321.032) (-323.971) (-322.452) [-322.879] -- 0:00:26
      431500 -- [-323.580] (-321.901) (-321.028) (-325.460) * [-323.422] (-322.150) (-322.064) (-324.384) -- 0:00:26
      432000 -- (-323.345) [-321.385] (-321.490) (-321.300) * (-322.190) (-322.065) [-322.279] (-323.171) -- 0:00:26
      432500 -- (-321.161) (-324.630) (-321.821) [-324.525] * (-320.927) (-321.293) [-321.603] (-322.874) -- 0:00:26
      433000 -- (-326.295) [-322.963] (-322.574) (-323.621) * [-323.067] (-322.217) (-323.550) (-320.909) -- 0:00:26
      433500 -- (-321.927) (-325.761) [-323.321] (-322.042) * (-322.322) (-325.605) (-322.276) [-321.138] -- 0:00:26
      434000 -- [-329.156] (-323.114) (-324.771) (-322.163) * (-324.478) [-323.935] (-323.695) (-324.585) -- 0:00:26
      434500 -- (-325.203) [-322.008] (-322.178) (-323.527) * (-322.840) [-325.407] (-323.453) (-325.546) -- 0:00:26
      435000 -- (-325.014) (-320.872) [-323.849] (-323.793) * [-326.948] (-323.555) (-322.606) (-324.606) -- 0:00:25

      Average standard deviation of split frequencies: 0.016578

      435500 -- (-324.053) [-325.452] (-322.108) (-323.899) * (-331.229) (-324.252) (-322.039) [-321.779] -- 0:00:25
      436000 -- (-323.282) (-321.472) [-323.284] (-323.760) * (-322.951) (-322.791) [-322.042] (-323.176) -- 0:00:25
      436500 -- (-327.679) [-322.451] (-321.634) (-321.894) * (-324.783) [-321.009] (-321.744) (-322.053) -- 0:00:25
      437000 -- (-323.010) (-324.603) [-321.738] (-321.815) * [-321.469] (-322.163) (-322.036) (-321.357) -- 0:00:25
      437500 -- (-323.458) [-321.504] (-325.326) (-322.309) * (-322.673) [-321.773] (-321.719) (-322.302) -- 0:00:25
      438000 -- (-323.614) (-321.475) (-321.720) [-324.335] * (-322.069) (-322.117) [-323.170] (-323.448) -- 0:00:25
      438500 -- (-324.111) (-322.708) [-321.729] (-323.096) * [-321.168] (-325.493) (-322.995) (-322.144) -- 0:00:25
      439000 -- (-323.714) (-325.636) (-324.669) [-326.162] * (-322.690) [-323.734] (-324.099) (-323.594) -- 0:00:25
      439500 -- (-321.559) (-322.602) [-321.194] (-323.753) * (-325.495) (-324.245) (-324.202) [-323.409] -- 0:00:25
      440000 -- (-322.028) (-322.177) [-324.821] (-321.250) * (-322.571) (-322.065) [-320.965] (-322.165) -- 0:00:25

      Average standard deviation of split frequencies: 0.016403

      440500 -- [-323.151] (-326.256) (-322.496) (-324.528) * (-321.350) (-321.139) (-326.205) [-320.537] -- 0:00:25
      441000 -- (-324.865) (-323.616) (-321.487) [-325.145] * (-323.048) (-323.095) [-321.558] (-322.931) -- 0:00:25
      441500 -- [-322.179] (-323.121) (-325.489) (-323.152) * [-320.804] (-324.075) (-321.595) (-321.039) -- 0:00:25
      442000 -- (-322.512) (-324.045) (-323.954) [-324.300] * (-321.001) (-321.053) [-321.769] (-324.171) -- 0:00:25
      442500 -- (-325.210) [-325.212] (-325.125) (-324.274) * (-322.091) [-321.471] (-322.812) (-325.231) -- 0:00:25
      443000 -- (-324.858) [-321.781] (-323.325) (-324.785) * (-324.038) [-321.063] (-324.011) (-323.362) -- 0:00:25
      443500 -- [-325.686] (-323.714) (-324.405) (-323.691) * (-325.966) [-321.120] (-323.599) (-324.022) -- 0:00:25
      444000 -- (-324.513) (-322.927) [-323.131] (-332.095) * (-322.584) (-322.609) [-321.936] (-321.631) -- 0:00:25
      444500 -- [-321.695] (-324.395) (-321.047) (-327.795) * (-321.106) (-321.593) [-322.874] (-321.896) -- 0:00:24
      445000 -- (-322.892) (-325.217) [-322.378] (-326.224) * (-322.840) [-321.310] (-321.436) (-323.560) -- 0:00:24

      Average standard deviation of split frequencies: 0.014797

      445500 -- (-324.268) (-322.792) (-322.510) [-323.507] * (-321.729) [-324.960] (-324.458) (-324.541) -- 0:00:24
      446000 -- (-322.704) [-324.811] (-324.680) (-323.725) * (-323.944) [-326.914] (-322.880) (-325.274) -- 0:00:24
      446500 -- (-323.081) (-322.122) [-323.467] (-325.470) * (-326.344) [-321.783] (-321.378) (-321.368) -- 0:00:24
      447000 -- (-322.666) (-322.829) (-321.052) [-321.722] * (-325.320) (-322.738) [-321.336] (-321.968) -- 0:00:24
      447500 -- (-322.106) (-321.953) [-321.373] (-326.867) * [-323.928] (-325.105) (-322.353) (-321.147) -- 0:00:24
      448000 -- [-322.199] (-324.998) (-322.333) (-324.281) * (-322.764) (-324.214) [-321.186] (-325.518) -- 0:00:24
      448500 -- (-322.865) (-322.729) [-322.244] (-322.428) * (-323.808) (-321.740) (-324.678) [-324.249] -- 0:00:24
      449000 -- (-322.774) (-322.830) (-324.209) [-320.939] * (-326.703) (-324.579) [-322.542] (-321.594) -- 0:00:24
      449500 -- (-325.396) (-322.604) [-321.909] (-324.353) * (-321.558) (-322.122) [-322.303] (-323.591) -- 0:00:24
      450000 -- (-323.389) (-321.706) [-321.206] (-322.668) * (-324.483) [-324.488] (-321.758) (-320.806) -- 0:00:24

      Average standard deviation of split frequencies: 0.016039

      450500 -- (-321.824) (-325.333) [-324.254] (-323.097) * (-322.910) (-324.022) [-321.277] (-321.879) -- 0:00:24
      451000 -- (-323.176) (-323.022) [-321.364] (-325.240) * (-324.634) (-323.784) [-321.841] (-322.400) -- 0:00:24
      451500 -- (-322.146) [-324.684] (-321.645) (-322.975) * (-320.989) (-322.068) (-321.154) [-323.483] -- 0:00:24
      452000 -- (-327.428) (-325.543) [-324.076] (-323.364) * [-321.699] (-323.690) (-325.322) (-321.249) -- 0:00:25
      452500 -- [-324.188] (-324.159) (-324.011) (-325.693) * (-321.787) (-323.015) (-324.377) [-321.532] -- 0:00:25
      453000 -- [-327.208] (-322.416) (-325.351) (-323.646) * [-321.287] (-321.915) (-321.214) (-322.090) -- 0:00:25
      453500 -- (-322.453) (-322.400) [-323.350] (-321.574) * (-325.365) (-323.176) (-321.413) [-321.311] -- 0:00:25
      454000 -- (-321.520) [-322.799] (-324.559) (-321.085) * [-323.130] (-322.906) (-322.002) (-322.403) -- 0:00:25
      454500 -- (-322.107) [-325.690] (-323.763) (-321.908) * (-321.136) (-323.315) (-322.904) [-323.643] -- 0:00:25
      455000 -- (-320.493) [-322.693] (-322.015) (-326.661) * (-324.853) [-326.718] (-323.614) (-323.551) -- 0:00:25

      Average standard deviation of split frequencies: 0.016541

      455500 -- [-323.766] (-322.088) (-325.910) (-324.079) * [-321.768] (-324.583) (-323.626) (-321.786) -- 0:00:25
      456000 -- [-323.853] (-321.589) (-323.832) (-327.106) * [-321.185] (-321.422) (-321.603) (-322.436) -- 0:00:25
      456500 -- [-321.481] (-323.839) (-324.885) (-325.806) * (-327.181) (-320.573) (-323.712) [-324.710] -- 0:00:25
      457000 -- [-322.292] (-321.990) (-323.330) (-325.259) * (-324.468) [-321.291] (-323.490) (-323.372) -- 0:00:24
      457500 -- [-321.761] (-320.973) (-323.602) (-321.397) * (-321.314) (-321.526) [-321.536] (-324.920) -- 0:00:24
      458000 -- (-325.229) [-320.942] (-321.295) (-324.446) * (-325.843) (-321.571) [-321.043] (-323.655) -- 0:00:24
      458500 -- [-324.333] (-326.504) (-323.318) (-322.894) * (-322.401) (-322.619) (-323.225) [-321.249] -- 0:00:24
      459000 -- (-322.725) (-322.532) [-323.131] (-323.240) * (-326.198) [-325.160] (-322.252) (-321.897) -- 0:00:24
      459500 -- (-324.479) [-325.141] (-323.203) (-324.105) * (-324.166) [-322.755] (-324.484) (-322.963) -- 0:00:24
      460000 -- (-322.890) (-324.204) [-321.645] (-323.713) * (-320.815) (-324.641) (-322.895) [-326.374] -- 0:00:24

      Average standard deviation of split frequencies: 0.016373

      460500 -- (-322.134) [-321.576] (-321.261) (-322.871) * (-322.019) (-329.400) (-326.223) [-325.918] -- 0:00:24
      461000 -- (-322.620) [-321.397] (-323.786) (-324.287) * [-323.798] (-324.549) (-322.648) (-320.895) -- 0:00:24
      461500 -- (-323.169) (-321.344) [-322.370] (-323.222) * (-327.761) [-321.023] (-320.690) (-322.033) -- 0:00:24
      462000 -- (-321.227) (-322.544) [-323.009] (-323.579) * (-325.828) [-321.365] (-322.227) (-322.909) -- 0:00:24
      462500 -- [-323.690] (-323.704) (-328.486) (-321.097) * (-321.726) (-320.906) (-321.552) [-326.052] -- 0:00:24
      463000 -- (-322.474) [-321.195] (-324.929) (-326.434) * (-326.666) (-328.418) [-321.354] (-323.431) -- 0:00:24
      463500 -- (-321.486) [-326.158] (-323.188) (-323.340) * (-327.207) [-324.966] (-322.759) (-321.610) -- 0:00:24
      464000 -- (-324.325) (-321.896) (-326.217) [-321.744] * (-323.972) (-323.473) [-321.709] (-321.759) -- 0:00:24
      464500 -- (-321.967) (-324.090) (-323.770) [-324.543] * (-322.836) (-321.542) (-322.760) [-324.774] -- 0:00:24
      465000 -- (-321.439) (-323.300) [-321.331] (-328.684) * [-320.942] (-323.513) (-327.374) (-323.275) -- 0:00:24

      Average standard deviation of split frequencies: 0.015511

      465500 -- (-325.056) [-322.773] (-323.528) (-320.806) * (-323.459) [-322.203] (-321.374) (-323.518) -- 0:00:24
      466000 -- [-326.041] (-323.802) (-323.589) (-320.637) * (-321.977) (-322.582) (-322.214) [-324.939] -- 0:00:24
      466500 -- (-324.872) (-328.776) (-322.201) [-323.143] * [-323.650] (-322.955) (-323.907) (-322.612) -- 0:00:24
      467000 -- [-321.334] (-326.842) (-323.153) (-323.181) * [-324.569] (-321.692) (-324.169) (-321.058) -- 0:00:23
      467500 -- (-323.542) [-320.980] (-321.792) (-321.752) * [-322.553] (-321.773) (-324.296) (-320.909) -- 0:00:23
      468000 -- [-327.157] (-322.367) (-323.172) (-324.638) * (-324.338) [-323.894] (-321.423) (-321.401) -- 0:00:23
      468500 -- (-323.719) (-321.106) [-322.772] (-321.944) * (-325.862) (-323.721) [-323.404] (-321.848) -- 0:00:23
      469000 -- (-321.760) [-325.143] (-323.158) (-323.084) * (-321.694) [-324.311] (-325.255) (-322.110) -- 0:00:23
      469500 -- [-323.320] (-325.548) (-320.965) (-324.090) * [-323.244] (-322.648) (-323.562) (-321.390) -- 0:00:24
      470000 -- (-324.720) (-321.001) [-322.879] (-324.195) * (-326.950) (-321.429) (-320.670) [-322.125] -- 0:00:24

      Average standard deviation of split frequencies: 0.015357

      470500 -- (-324.407) (-330.907) (-321.909) [-321.377] * (-323.206) (-324.878) [-320.921] (-324.119) -- 0:00:24
      471000 -- (-326.588) (-321.803) (-321.086) [-324.376] * [-322.368] (-326.156) (-323.224) (-324.105) -- 0:00:24
      471500 -- (-323.445) (-321.572) [-322.161] (-324.397) * (-322.231) [-321.824] (-322.704) (-321.546) -- 0:00:24
      472000 -- (-324.221) (-324.257) (-322.989) [-320.804] * (-321.360) (-321.655) (-321.432) [-324.979] -- 0:00:24
      472500 -- (-322.048) (-321.746) (-320.767) [-322.615] * (-325.077) (-321.653) [-324.381] (-324.823) -- 0:00:24
      473000 -- [-320.805] (-321.959) (-325.596) (-323.738) * (-322.341) (-321.649) [-325.027] (-324.974) -- 0:00:24
      473500 -- (-326.486) (-321.190) (-321.543) [-323.347] * (-322.403) (-322.879) (-321.409) [-321.477] -- 0:00:24
      474000 -- [-321.883] (-326.158) (-320.801) (-323.166) * (-326.068) [-323.717] (-321.752) (-323.215) -- 0:00:24
      474500 -- (-323.181) (-322.458) [-323.019] (-323.884) * (-323.241) (-324.122) [-322.899] (-324.236) -- 0:00:24
      475000 -- (-321.674) (-321.750) [-323.447] (-323.159) * (-327.795) [-322.583] (-321.726) (-321.171) -- 0:00:24

      Average standard deviation of split frequencies: 0.016506

      475500 -- (-330.045) [-325.923] (-323.867) (-322.592) * [-328.338] (-322.256) (-320.911) (-323.302) -- 0:00:24
      476000 -- (-325.745) (-323.350) [-328.616] (-322.355) * (-330.134) (-323.787) (-322.060) [-322.542] -- 0:00:24
      476500 -- (-327.835) (-322.147) [-320.759] (-321.064) * (-324.590) [-322.147] (-326.364) (-322.757) -- 0:00:24
      477000 -- (-321.346) [-320.661] (-323.528) (-321.860) * (-324.608) (-326.355) [-321.916] (-323.633) -- 0:00:24
      477500 -- [-321.222] (-323.347) (-321.524) (-321.225) * (-325.816) (-325.215) (-323.999) [-322.423] -- 0:00:24
      478000 -- (-324.126) (-321.204) (-326.416) [-321.652] * [-323.545] (-325.589) (-323.993) (-326.908) -- 0:00:24
      478500 -- (-323.368) (-322.246) [-323.549] (-323.029) * (-322.412) (-324.054) [-323.328] (-323.502) -- 0:00:23
      479000 -- (-322.300) [-321.433] (-325.766) (-323.492) * (-322.814) (-322.210) (-324.150) [-321.895] -- 0:00:23
      479500 -- (-326.879) (-320.877) [-320.689] (-322.088) * [-324.859] (-326.271) (-322.378) (-323.672) -- 0:00:23
      480000 -- (-324.645) (-323.137) [-321.857] (-325.846) * (-325.446) [-322.348] (-323.222) (-324.393) -- 0:00:23

      Average standard deviation of split frequencies: 0.016346

      480500 -- (-322.313) (-325.548) (-324.772) [-324.606] * (-323.536) (-321.815) (-327.759) [-322.532] -- 0:00:23
      481000 -- (-323.207) (-323.877) (-322.855) [-321.160] * [-323.622] (-321.239) (-322.863) (-321.634) -- 0:00:23
      481500 -- [-324.866] (-322.463) (-323.651) (-324.303) * (-321.020) [-321.235] (-321.066) (-322.101) -- 0:00:23
      482000 -- (-324.204) (-324.234) [-324.569] (-321.097) * [-321.931] (-328.902) (-323.207) (-322.391) -- 0:00:23
      482500 -- (-322.520) [-321.868] (-325.021) (-322.600) * [-321.584] (-324.440) (-321.741) (-330.639) -- 0:00:23
      483000 -- (-324.714) [-322.496] (-331.870) (-321.816) * (-323.174) (-321.551) [-321.175] (-321.310) -- 0:00:23
      483500 -- (-328.416) (-321.876) [-324.204] (-324.023) * [-327.974] (-323.354) (-321.305) (-321.526) -- 0:00:23
      484000 -- (-323.782) [-321.880] (-324.855) (-323.664) * (-323.784) (-322.377) [-322.483] (-325.952) -- 0:00:23
      484500 -- (-323.327) [-323.709] (-327.454) (-323.500) * (-323.519) (-322.020) [-323.569] (-321.831) -- 0:00:23
      485000 -- (-321.673) (-322.623) [-325.850] (-326.526) * (-321.277) (-323.501) [-323.714] (-323.305) -- 0:00:23

      Average standard deviation of split frequencies: 0.014873

      485500 -- [-320.829] (-323.480) (-323.013) (-324.714) * (-324.227) [-321.176] (-322.753) (-321.182) -- 0:00:23
      486000 -- [-323.532] (-322.730) (-322.458) (-323.043) * [-325.132] (-327.040) (-321.920) (-320.983) -- 0:00:23
      486500 -- [-322.278] (-326.883) (-320.994) (-324.924) * (-320.899) (-321.460) (-321.741) [-324.852] -- 0:00:23
      487000 -- (-323.825) [-326.832] (-321.750) (-322.584) * (-322.113) (-322.537) (-321.642) [-325.217] -- 0:00:23
      487500 -- [-326.483] (-324.051) (-324.237) (-324.540) * [-321.812] (-322.636) (-321.298) (-326.793) -- 0:00:23
      488000 -- [-323.835] (-324.227) (-323.728) (-323.537) * (-323.411) [-322.124] (-323.983) (-321.347) -- 0:00:23
      488500 -- [-322.994] (-324.799) (-324.785) (-321.154) * [-324.121] (-323.877) (-320.920) (-323.037) -- 0:00:24
      489000 -- (-323.568) (-325.119) (-323.975) [-321.920] * [-324.180] (-322.002) (-321.167) (-322.651) -- 0:00:24
      489500 -- [-322.081] (-323.657) (-322.846) (-323.567) * [-323.383] (-322.248) (-322.250) (-321.281) -- 0:00:23
      490000 -- (-321.505) (-322.461) (-323.964) [-320.734] * (-321.607) (-322.812) (-322.374) [-323.109] -- 0:00:23

      Average standard deviation of split frequencies: 0.014091

      490500 -- (-322.461) (-321.094) [-321.648] (-322.169) * (-322.403) (-321.535) [-321.405] (-322.251) -- 0:00:23
      491000 -- (-323.271) (-322.679) [-325.445] (-321.535) * [-321.189] (-320.776) (-320.869) (-321.949) -- 0:00:23
      491500 -- (-320.750) (-322.020) (-320.601) [-321.424] * (-322.127) (-321.770) (-320.819) [-322.222] -- 0:00:23
      492000 -- (-322.591) [-321.345] (-323.172) (-323.221) * (-324.595) [-321.776] (-328.535) (-321.259) -- 0:00:23
      492500 -- (-322.037) [-322.966] (-323.949) (-321.646) * (-321.820) [-323.984] (-324.793) (-322.073) -- 0:00:23
      493000 -- (-323.127) [-322.775] (-325.922) (-321.889) * (-322.531) (-322.594) (-325.731) [-323.045] -- 0:00:23
      493500 -- (-322.934) (-326.139) (-324.767) [-321.961] * (-322.218) (-323.145) (-321.889) [-322.294] -- 0:00:23
      494000 -- [-321.195] (-323.742) (-323.500) (-324.509) * [-321.603] (-321.472) (-323.414) (-321.634) -- 0:00:23
      494500 -- (-323.724) (-324.026) [-321.895] (-326.376) * (-329.005) [-321.883] (-322.861) (-322.890) -- 0:00:23
      495000 -- (-321.546) (-322.671) (-321.417) [-322.512] * (-322.242) [-322.242] (-323.196) (-321.835) -- 0:00:23

      Average standard deviation of split frequencies: 0.015207

      495500 -- [-323.284] (-321.845) (-321.438) (-321.440) * (-321.694) (-323.258) [-322.868] (-323.186) -- 0:00:23
      496000 -- (-322.354) [-320.887] (-323.869) (-324.243) * (-324.603) (-322.436) [-322.449] (-322.116) -- 0:00:23
      496500 -- (-321.496) [-320.858] (-327.529) (-326.101) * [-322.064] (-323.468) (-321.256) (-324.005) -- 0:00:23
      497000 -- (-321.141) (-325.425) (-324.302) [-323.355] * (-326.311) (-327.793) [-324.716] (-325.258) -- 0:00:23
      497500 -- [-331.223] (-322.638) (-324.423) (-325.263) * [-322.538] (-322.893) (-324.766) (-326.910) -- 0:00:23
      498000 -- (-323.818) (-321.796) (-323.151) [-324.994] * [-324.409] (-322.250) (-322.868) (-322.803) -- 0:00:23
      498500 -- (-322.140) (-321.536) [-322.076] (-326.692) * (-324.699) (-321.528) [-321.556] (-323.333) -- 0:00:23
      499000 -- (-321.682) (-320.994) [-324.501] (-324.009) * (-321.957) (-320.564) [-322.770] (-321.947) -- 0:00:23
      499500 -- (-321.064) (-321.283) (-324.159) [-321.487] * (-324.375) [-323.213] (-324.186) (-324.439) -- 0:00:23
      500000 -- (-321.225) [-321.953] (-324.044) (-323.620) * (-321.050) (-326.613) (-323.920) [-322.040] -- 0:00:23

      Average standard deviation of split frequencies: 0.013182

      500500 -- (-322.072) (-322.078) (-323.876) [-321.673] * [-322.140] (-322.163) (-322.427) (-322.173) -- 0:00:22
      501000 -- (-323.276) [-325.471] (-320.946) (-326.693) * (-323.371) [-322.264] (-321.652) (-321.212) -- 0:00:22
      501500 -- [-321.758] (-326.408) (-322.246) (-321.388) * (-323.145) (-322.683) (-322.888) [-322.090] -- 0:00:22
      502000 -- [-322.276] (-325.482) (-323.191) (-321.817) * (-321.581) (-321.296) (-323.782) [-322.137] -- 0:00:22
      502500 -- (-323.068) (-322.881) (-324.923) [-331.319] * (-322.210) (-325.897) (-323.410) [-321.912] -- 0:00:22
      503000 -- (-324.009) [-324.946] (-322.198) (-323.149) * [-322.878] (-331.016) (-323.512) (-322.093) -- 0:00:22
      503500 -- (-323.217) [-321.207] (-320.597) (-321.828) * [-323.161] (-322.162) (-320.801) (-333.616) -- 0:00:22
      504000 -- (-320.671) (-321.950) (-323.184) [-320.907] * (-324.476) (-324.532) (-322.375) [-321.276] -- 0:00:22
      504500 -- (-323.037) [-322.822] (-326.082) (-321.922) * (-322.478) (-322.284) [-320.944] (-323.334) -- 0:00:22
      505000 -- (-321.946) (-323.409) [-322.071] (-323.373) * (-322.923) (-321.428) [-320.879] (-323.035) -- 0:00:22

      Average standard deviation of split frequencies: 0.014906

      505500 -- (-321.607) (-323.157) [-321.916] (-323.381) * (-320.702) (-328.079) (-321.754) [-321.370] -- 0:00:22
      506000 -- [-320.700] (-325.790) (-324.095) (-323.225) * (-323.945) (-322.941) (-321.394) [-322.361] -- 0:00:22
      506500 -- (-322.099) (-325.896) [-321.698] (-322.399) * [-321.125] (-323.597) (-321.971) (-323.370) -- 0:00:22
      507000 -- (-321.275) (-324.132) [-322.751] (-321.231) * [-321.284] (-322.438) (-322.190) (-323.124) -- 0:00:22
      507500 -- [-321.804] (-324.401) (-321.078) (-322.460) * [-321.753] (-325.229) (-325.119) (-323.633) -- 0:00:22
      508000 -- (-321.471) (-322.946) [-322.109] (-321.965) * (-323.758) (-323.886) [-321.554] (-321.792) -- 0:00:22
      508500 -- [-325.380] (-324.747) (-320.964) (-322.235) * (-322.219) (-323.331) [-321.452] (-324.075) -- 0:00:22
      509000 -- [-320.699] (-323.231) (-323.022) (-325.669) * (-324.492) (-322.587) [-320.770] (-323.801) -- 0:00:22
      509500 -- (-322.034) (-326.324) (-324.592) [-320.923] * [-324.268] (-321.494) (-323.224) (-324.542) -- 0:00:22
      510000 -- [-321.258] (-326.092) (-322.339) (-323.320) * [-323.078] (-322.891) (-324.781) (-321.891) -- 0:00:22

      Average standard deviation of split frequencies: 0.016001

      510500 -- (-321.660) (-321.045) [-323.553] (-323.144) * (-323.051) (-325.703) (-325.436) [-321.449] -- 0:00:23
      511000 -- (-324.469) (-321.753) (-321.723) [-322.086] * [-323.408] (-325.251) (-322.799) (-321.807) -- 0:00:22
      511500 -- (-324.088) (-321.390) (-322.698) [-321.096] * (-324.178) [-323.015] (-325.874) (-320.922) -- 0:00:22
      512000 -- (-321.545) (-321.007) [-322.711] (-322.994) * (-324.083) [-322.943] (-324.027) (-324.970) -- 0:00:22
      512500 -- (-323.091) (-323.938) (-324.761) [-325.176] * (-324.725) (-321.770) (-324.100) [-322.748] -- 0:00:22
      513000 -- (-330.447) (-322.663) (-323.562) [-321.886] * (-322.611) [-323.741] (-323.431) (-323.658) -- 0:00:22
      513500 -- (-322.403) [-322.964] (-322.892) (-322.766) * [-322.463] (-320.749) (-322.545) (-324.160) -- 0:00:22
      514000 -- (-323.496) (-322.000) (-321.910) [-323.770] * (-322.408) (-322.431) [-321.302] (-320.862) -- 0:00:22
      514500 -- (-321.332) [-322.696] (-322.226) (-322.303) * (-323.062) [-320.702] (-324.543) (-324.776) -- 0:00:22
      515000 -- (-322.164) [-322.889] (-322.451) (-321.450) * [-321.513] (-322.187) (-323.243) (-324.848) -- 0:00:22

      Average standard deviation of split frequencies: 0.016444

      515500 -- (-322.794) [-321.052] (-323.820) (-322.033) * (-324.102) (-323.694) [-321.154] (-322.844) -- 0:00:22
      516000 -- (-321.969) (-321.024) (-325.523) [-321.556] * (-323.267) (-322.655) (-323.403) [-324.049] -- 0:00:22
      516500 -- [-322.727] (-320.376) (-322.435) (-331.362) * (-321.563) (-323.791) (-323.899) [-321.281] -- 0:00:22
      517000 -- [-320.874] (-323.645) (-325.046) (-329.880) * (-322.874) (-326.609) (-321.792) [-321.245] -- 0:00:22
      517500 -- [-324.170] (-325.659) (-321.026) (-327.374) * (-323.488) [-322.536] (-321.021) (-325.503) -- 0:00:22
      518000 -- [-323.430] (-330.851) (-323.791) (-325.343) * [-322.625] (-325.963) (-322.494) (-325.841) -- 0:00:22
      518500 -- [-322.304] (-323.906) (-328.445) (-325.910) * (-326.808) (-321.003) (-323.628) [-323.268] -- 0:00:22
      519000 -- (-322.179) (-325.231) (-321.612) [-324.158] * (-321.852) (-328.001) [-322.209] (-322.973) -- 0:00:22
      519500 -- (-322.295) (-322.307) (-325.231) [-326.022] * (-321.322) (-323.525) [-324.272] (-324.428) -- 0:00:22
      520000 -- [-322.244] (-328.184) (-323.118) (-324.733) * (-321.914) (-322.409) [-323.866] (-322.288) -- 0:00:22

      Average standard deviation of split frequencies: 0.016297

      520500 -- (-325.273) (-322.119) (-321.418) [-322.130] * (-323.518) (-323.629) (-323.007) [-322.061] -- 0:00:22
      521000 -- (-323.526) (-324.950) (-323.154) [-323.160] * (-324.867) [-320.836] (-326.611) (-322.615) -- 0:00:22
      521500 -- (-322.675) (-329.179) [-320.764] (-322.307) * [-322.117] (-322.858) (-322.612) (-321.275) -- 0:00:22
      522000 -- (-323.674) [-329.901] (-321.745) (-322.106) * (-321.883) (-321.682) (-322.012) [-323.282] -- 0:00:21
      522500 -- (-328.023) (-322.023) [-321.784] (-320.942) * [-321.224] (-324.866) (-322.945) (-320.626) -- 0:00:21
      523000 -- (-324.035) (-322.822) (-320.697) [-321.299] * (-323.581) [-326.477] (-324.350) (-327.144) -- 0:00:21
      523500 -- [-322.689] (-328.182) (-322.590) (-321.829) * (-326.888) [-322.507] (-322.480) (-332.768) -- 0:00:21
      524000 -- (-324.640) (-326.153) (-320.726) [-323.109] * (-327.757) [-323.726] (-323.457) (-327.241) -- 0:00:21
      524500 -- (-321.478) [-322.838] (-321.792) (-327.566) * (-320.646) (-326.031) (-326.715) [-325.516] -- 0:00:21
      525000 -- (-323.021) (-322.823) [-324.025] (-325.704) * (-321.425) (-325.924) (-322.889) [-323.774] -- 0:00:21

      Average standard deviation of split frequencies: 0.018522

      525500 -- (-323.907) [-321.171] (-323.315) (-325.663) * [-321.834] (-328.457) (-323.961) (-321.059) -- 0:00:21
      526000 -- (-324.673) (-322.456) (-324.089) [-323.262] * (-323.725) (-323.160) [-323.232] (-326.162) -- 0:00:21
      526500 -- [-323.900] (-322.787) (-323.610) (-322.473) * [-322.742] (-321.454) (-322.427) (-323.131) -- 0:00:21
      527000 -- (-323.049) (-321.500) [-322.087] (-323.020) * (-322.745) [-321.526] (-321.501) (-321.238) -- 0:00:21
      527500 -- (-321.167) [-321.209] (-322.411) (-324.488) * (-324.921) [-322.949] (-322.119) (-323.500) -- 0:00:21
      528000 -- [-321.657] (-325.466) (-322.061) (-323.110) * [-323.092] (-324.986) (-326.236) (-327.014) -- 0:00:21
      528500 -- (-323.903) (-323.611) (-321.281) [-323.360] * (-322.112) (-324.566) (-320.899) [-324.465] -- 0:00:21
      529000 -- (-324.508) [-322.720] (-326.896) (-321.157) * [-322.838] (-321.811) (-320.988) (-322.274) -- 0:00:21
      529500 -- (-323.365) (-320.759) (-324.039) [-322.639] * (-321.876) [-321.700] (-322.030) (-321.869) -- 0:00:21
      530000 -- [-321.842] (-323.777) (-323.608) (-325.445) * [-327.026] (-321.942) (-322.652) (-322.865) -- 0:00:21

      Average standard deviation of split frequencies: 0.018359

      530500 -- (-324.113) (-325.059) (-321.415) [-322.389] * (-321.064) (-322.790) [-321.190] (-331.657) -- 0:00:21
      531000 -- (-322.133) [-321.733] (-320.747) (-324.643) * (-320.831) (-323.150) (-323.143) [-323.220] -- 0:00:21
      531500 -- [-320.456] (-322.963) (-322.727) (-321.907) * [-326.276] (-327.927) (-322.205) (-321.411) -- 0:00:21
      532000 -- (-322.077) (-322.364) (-321.878) [-320.734] * (-321.005) (-328.296) [-320.930] (-320.796) -- 0:00:21
      532500 -- (-322.089) (-323.091) [-321.142] (-321.556) * (-323.447) [-324.825] (-322.153) (-322.409) -- 0:00:21
      533000 -- [-322.806] (-325.896) (-322.452) (-323.577) * [-321.678] (-324.659) (-322.718) (-322.475) -- 0:00:21
      533500 -- (-325.301) [-321.814] (-324.618) (-321.094) * (-323.287) (-323.493) (-321.300) [-322.592] -- 0:00:21
      534000 -- (-321.185) (-322.414) (-322.391) [-321.291] * [-323.153] (-322.841) (-327.649) (-324.690) -- 0:00:21
      534500 -- (-323.650) [-322.124] (-323.501) (-321.481) * (-326.678) [-321.651] (-323.779) (-320.967) -- 0:00:21
      535000 -- (-326.110) (-322.780) [-323.975] (-321.899) * [-322.769] (-321.870) (-323.282) (-329.724) -- 0:00:21

      Average standard deviation of split frequencies: 0.017590

      535500 -- (-324.201) (-324.221) (-326.793) [-323.880] * [-322.249] (-321.896) (-322.823) (-321.994) -- 0:00:21
      536000 -- (-322.784) (-322.857) (-323.289) [-322.739] * [-322.773] (-321.580) (-322.178) (-323.475) -- 0:00:21
      536500 -- (-330.583) [-324.977] (-324.621) (-321.759) * (-322.848) (-326.433) (-323.596) [-323.215] -- 0:00:21
      537000 -- [-323.043] (-323.625) (-327.538) (-324.954) * (-322.715) (-322.302) (-321.643) [-322.085] -- 0:00:21
      537500 -- (-323.017) [-321.698] (-324.689) (-328.614) * (-321.352) (-326.294) [-322.423] (-320.879) -- 0:00:21
      538000 -- [-321.848] (-326.001) (-324.924) (-321.177) * (-323.697) (-322.005) [-321.927] (-320.827) -- 0:00:21
      538500 -- (-323.981) (-324.776) (-322.776) [-322.580] * (-326.210) [-324.442] (-322.155) (-321.847) -- 0:00:21
      539000 -- (-322.492) (-321.481) (-323.873) [-320.976] * (-321.254) [-321.322] (-323.394) (-323.313) -- 0:00:21
      539500 -- [-322.459] (-324.424) (-322.520) (-321.125) * (-325.125) [-321.118] (-323.820) (-320.915) -- 0:00:21
      540000 -- [-321.784] (-325.708) (-322.607) (-322.075) * [-327.542] (-322.638) (-323.352) (-321.324) -- 0:00:21

      Average standard deviation of split frequencies: 0.018600

      540500 -- (-323.505) (-320.983) (-324.366) [-320.967] * (-322.890) [-324.699] (-321.389) (-328.618) -- 0:00:21
      541000 -- (-322.876) (-322.371) [-322.564] (-322.327) * (-322.388) (-323.750) [-320.977] (-324.383) -- 0:00:21
      541500 -- [-326.073] (-322.286) (-321.093) (-326.380) * [-324.280] (-322.067) (-321.329) (-322.363) -- 0:00:21
      542000 -- (-326.691) (-322.664) [-321.984] (-322.229) * (-323.451) [-323.693] (-325.084) (-323.882) -- 0:00:21
      542500 -- (-323.311) [-322.201] (-323.021) (-322.720) * (-326.062) (-321.129) [-321.862] (-321.503) -- 0:00:21
      543000 -- (-324.625) (-328.428) [-327.670] (-322.858) * [-322.518] (-321.649) (-321.337) (-322.020) -- 0:00:21
      543500 -- (-322.435) (-323.588) [-322.659] (-322.924) * [-325.631] (-323.084) (-322.185) (-323.339) -- 0:00:20
      544000 -- [-324.046] (-326.812) (-321.924) (-321.581) * (-327.826) [-321.309] (-322.427) (-322.754) -- 0:00:20
      544500 -- (-321.489) (-321.990) (-321.015) [-322.147] * (-321.632) (-322.559) [-323.055] (-322.759) -- 0:00:20
      545000 -- (-321.587) [-320.880] (-320.990) (-324.474) * [-331.062] (-320.673) (-321.473) (-322.963) -- 0:00:20

      Average standard deviation of split frequencies: 0.020145

      545500 -- (-321.705) [-321.413] (-321.274) (-324.163) * (-324.950) (-326.598) (-325.447) [-322.879] -- 0:00:20
      546000 -- [-323.555] (-322.703) (-322.413) (-323.196) * (-322.129) [-324.520] (-321.952) (-324.093) -- 0:00:20
      546500 -- (-322.022) [-320.771] (-322.835) (-321.967) * (-321.203) (-323.756) (-322.661) [-321.866] -- 0:00:20
      547000 -- (-323.539) (-322.269) [-321.482] (-321.438) * (-320.781) (-322.288) (-323.185) [-320.878] -- 0:00:20
      547500 -- (-326.074) [-321.766] (-324.742) (-323.621) * (-321.998) (-321.381) [-322.267] (-322.213) -- 0:00:20
      548000 -- (-325.155) (-322.639) [-322.608] (-321.816) * (-322.414) [-321.682] (-322.035) (-321.795) -- 0:00:20
      548500 -- (-322.992) (-326.043) (-324.015) [-321.915] * (-322.658) [-324.339] (-323.515) (-321.779) -- 0:00:20
      549000 -- (-322.449) [-321.643] (-321.265) (-328.064) * (-321.799) [-321.102] (-325.110) (-322.008) -- 0:00:20
      549500 -- (-323.035) [-322.819] (-320.803) (-328.050) * [-325.764] (-323.793) (-323.592) (-321.853) -- 0:00:20
      550000 -- (-321.813) (-322.697) [-321.116] (-323.251) * (-325.340) (-321.812) (-322.339) [-324.084] -- 0:00:20

      Average standard deviation of split frequencies: 0.018263

      550500 -- [-323.720] (-325.639) (-324.654) (-325.047) * [-320.845] (-320.749) (-322.746) (-324.332) -- 0:00:20
      551000 -- [-323.101] (-323.354) (-323.027) (-323.004) * (-323.502) (-321.981) [-321.462] (-322.347) -- 0:00:20
      551500 -- (-322.058) (-321.881) [-322.618] (-323.566) * [-323.699] (-321.674) (-321.183) (-324.395) -- 0:00:20
      552000 -- [-322.205] (-323.771) (-323.285) (-322.087) * (-322.668) (-320.679) (-323.751) [-326.754] -- 0:00:20
      552500 -- (-322.328) (-322.409) [-321.931] (-321.801) * (-323.364) (-321.871) [-323.803] (-322.023) -- 0:00:20
      553000 -- (-322.869) [-322.441] (-325.313) (-322.957) * (-322.257) (-325.949) (-326.211) [-321.694] -- 0:00:20
      553500 -- [-324.786] (-325.974) (-321.548) (-322.292) * (-321.138) (-325.339) (-325.003) [-324.608] -- 0:00:20
      554000 -- (-322.751) (-326.321) (-321.635) [-322.665] * (-323.067) [-324.599] (-321.975) (-322.891) -- 0:00:20
      554500 -- (-323.896) (-322.257) (-322.901) [-323.696] * (-323.924) (-324.618) (-322.388) [-322.398] -- 0:00:20
      555000 -- (-323.525) [-320.662] (-321.660) (-321.279) * (-322.674) [-322.245] (-325.777) (-321.919) -- 0:00:20

      Average standard deviation of split frequencies: 0.015827

      555500 -- (-321.748) [-320.711] (-321.566) (-321.295) * [-321.890] (-323.004) (-321.204) (-324.045) -- 0:00:20
      556000 -- (-325.920) (-323.889) (-324.514) [-322.125] * [-321.147] (-327.592) (-321.081) (-322.057) -- 0:00:20
      556500 -- (-322.322) (-322.413) (-324.754) [-321.892] * (-322.400) (-322.216) [-322.461] (-322.832) -- 0:00:20
      557000 -- [-326.263] (-322.938) (-321.559) (-321.309) * (-326.694) (-321.930) [-322.573] (-322.336) -- 0:00:20
      557500 -- (-325.604) (-324.808) [-323.652] (-322.640) * (-325.460) [-322.526] (-322.275) (-322.984) -- 0:00:20
      558000 -- (-321.864) [-323.803] (-322.927) (-326.677) * (-320.902) (-325.111) [-323.751] (-330.642) -- 0:00:20
      558500 -- (-322.090) [-322.501] (-324.172) (-323.092) * (-321.228) (-322.232) (-322.833) [-321.830] -- 0:00:20
      559000 -- (-322.183) [-322.394] (-325.873) (-324.612) * (-327.067) [-321.307] (-322.713) (-321.759) -- 0:00:20
      559500 -- (-321.884) (-321.951) (-325.924) [-322.833] * (-325.925) (-322.784) (-323.123) [-320.462] -- 0:00:20
      560000 -- (-327.188) (-320.892) [-324.088] (-323.303) * (-322.193) (-324.326) (-322.149) [-324.829] -- 0:00:20

      Average standard deviation of split frequencies: 0.013453

      560500 -- [-325.295] (-324.333) (-331.392) (-321.705) * (-322.604) (-321.764) [-320.788] (-324.560) -- 0:00:20
      561000 -- (-325.962) [-322.690] (-323.554) (-321.741) * (-321.576) (-326.811) (-323.916) [-321.536] -- 0:00:20
      561500 -- (-326.979) (-326.536) [-322.764] (-323.998) * (-323.325) (-324.432) [-321.362] (-322.839) -- 0:00:20
      562000 -- (-323.209) (-333.197) (-326.109) [-322.448] * [-320.996] (-321.696) (-320.524) (-323.613) -- 0:00:20
      562500 -- (-324.402) [-327.000] (-326.779) (-323.618) * [-322.899] (-321.744) (-321.959) (-323.408) -- 0:00:20
      563000 -- [-321.541] (-326.701) (-325.991) (-324.170) * [-323.117] (-324.290) (-327.354) (-325.248) -- 0:00:20
      563500 -- (-323.593) (-326.253) (-323.033) [-320.752] * (-323.083) (-323.507) [-324.927] (-324.938) -- 0:00:20
      564000 -- (-329.398) (-324.641) [-324.668] (-325.315) * [-323.053] (-322.685) (-325.448) (-322.951) -- 0:00:20
      564500 -- (-324.557) (-321.679) (-323.046) [-321.637] * (-321.868) (-324.373) [-321.485] (-321.596) -- 0:00:20
      565000 -- (-321.497) (-323.832) [-321.518] (-326.961) * [-321.394] (-323.973) (-322.001) (-323.095) -- 0:00:20

      Average standard deviation of split frequencies: 0.012771

      565500 -- [-324.092] (-322.185) (-320.841) (-328.183) * (-324.607) [-328.909] (-321.244) (-322.788) -- 0:00:19
      566000 -- [-321.864] (-323.539) (-322.502) (-322.146) * (-324.367) (-326.865) [-321.576] (-321.473) -- 0:00:19
      566500 -- (-321.936) (-322.830) [-322.535] (-322.448) * (-321.825) (-328.378) (-326.877) [-322.155] -- 0:00:19
      567000 -- (-321.295) [-322.787] (-323.633) (-325.122) * (-322.491) (-321.844) (-322.971) [-321.292] -- 0:00:19
      567500 -- [-327.799] (-321.667) (-322.851) (-322.905) * (-325.049) (-322.509) (-321.322) [-321.409] -- 0:00:19
      568000 -- (-323.945) (-325.558) (-321.137) [-321.835] * (-320.874) [-321.998] (-325.556) (-322.829) -- 0:00:19
      568500 -- (-325.936) (-324.370) (-323.171) [-322.055] * (-324.296) (-320.706) (-323.727) [-322.785] -- 0:00:19
      569000 -- (-323.167) (-322.289) (-320.779) [-322.346] * (-323.399) (-320.953) [-321.776] (-324.790) -- 0:00:19
      569500 -- (-323.096) [-322.674] (-322.608) (-321.348) * (-322.084) (-330.738) (-324.891) [-322.725] -- 0:00:19
      570000 -- (-321.659) [-321.495] (-322.514) (-321.349) * [-322.760] (-325.153) (-324.937) (-321.393) -- 0:00:19

      Average standard deviation of split frequencies: 0.012116

      570500 -- (-323.703) [-322.192] (-323.391) (-325.730) * (-323.706) (-322.947) [-320.869] (-323.918) -- 0:00:19
      571000 -- (-321.136) (-324.714) [-322.609] (-322.888) * (-325.361) (-323.844) (-322.695) [-324.305] -- 0:00:19
      571500 -- [-322.179] (-320.815) (-322.474) (-324.551) * (-322.748) (-324.313) [-321.899] (-325.294) -- 0:00:19
      572000 -- [-321.960] (-321.987) (-322.377) (-324.730) * (-326.791) [-323.309] (-320.857) (-325.205) -- 0:00:19
      572500 -- (-321.176) (-323.157) (-322.235) [-323.136] * [-321.227] (-325.926) (-323.730) (-326.462) -- 0:00:19
      573000 -- (-324.761) [-325.199] (-321.641) (-322.313) * (-321.892) (-323.593) [-324.589] (-323.560) -- 0:00:19
      573500 -- (-325.551) (-323.467) [-321.925] (-323.578) * (-322.859) (-321.908) [-325.437] (-322.302) -- 0:00:19
      574000 -- (-322.093) (-322.226) (-324.630) [-324.112] * (-323.992) (-322.521) (-322.819) [-324.312] -- 0:00:19
      574500 -- [-322.348] (-325.731) (-326.146) (-321.019) * [-323.694] (-323.335) (-323.274) (-323.372) -- 0:00:19
      575000 -- (-320.956) (-322.587) (-324.613) [-322.289] * (-323.402) [-321.183] (-323.138) (-322.856) -- 0:00:19

      Average standard deviation of split frequencies: 0.011458

      575500 -- (-322.642) (-322.663) (-322.305) [-322.172] * (-322.412) (-321.870) [-324.189] (-322.846) -- 0:00:19
      576000 -- (-322.896) (-323.659) (-322.521) [-324.135] * (-323.509) [-321.645] (-321.403) (-320.894) -- 0:00:19
      576500 -- [-323.864] (-320.913) (-321.109) (-323.205) * (-321.460) (-324.852) [-324.234] (-320.901) -- 0:00:19
      577000 -- [-323.771] (-325.604) (-324.707) (-323.421) * (-323.148) [-322.691] (-322.259) (-322.751) -- 0:00:19
      577500 -- (-327.133) (-322.345) [-323.428] (-321.717) * (-323.312) [-321.385] (-323.129) (-324.003) -- 0:00:19
      578000 -- [-325.322] (-321.410) (-325.182) (-323.343) * (-321.629) (-322.118) (-322.787) [-322.352] -- 0:00:18
      578500 -- (-323.102) (-324.784) (-323.762) [-322.813] * (-325.251) [-322.308] (-322.897) (-323.879) -- 0:00:18
      579000 -- (-323.667) (-325.950) (-321.581) [-322.596] * (-322.430) (-322.858) (-321.539) [-323.228] -- 0:00:19
      579500 -- (-321.447) (-322.583) (-322.030) [-323.853] * (-325.020) (-323.276) [-322.505] (-321.536) -- 0:00:19
      580000 -- (-326.201) [-321.473] (-323.168) (-321.609) * (-321.701) (-322.912) (-325.004) [-323.332] -- 0:00:19

      Average standard deviation of split frequencies: 0.012448

      580500 -- (-323.185) (-330.857) (-327.040) [-322.422] * [-320.743] (-320.890) (-323.172) (-322.622) -- 0:00:19
      581000 -- (-323.196) (-325.341) [-326.190] (-325.612) * (-322.032) [-321.186] (-321.730) (-326.423) -- 0:00:19
      581500 -- [-322.044] (-321.415) (-320.775) (-321.020) * (-324.896) (-324.433) [-323.867] (-323.232) -- 0:00:19
      582000 -- (-324.707) (-322.989) [-321.329] (-323.192) * (-323.827) [-322.806] (-326.830) (-322.488) -- 0:00:19
      582500 -- (-327.395) [-324.889] (-322.891) (-332.333) * (-322.503) [-323.762] (-320.607) (-320.978) -- 0:00:19
      583000 -- (-323.192) (-322.585) [-326.288] (-321.754) * (-322.174) (-322.599) (-322.444) [-323.485] -- 0:00:19
      583500 -- (-322.451) (-321.507) [-323.085] (-323.523) * (-328.335) [-322.542] (-326.089) (-321.982) -- 0:00:19
      584000 -- (-326.895) (-322.151) (-323.906) [-322.485] * (-328.688) [-322.465] (-321.656) (-322.375) -- 0:00:19
      584500 -- (-321.690) [-322.364] (-322.361) (-321.190) * (-322.308) [-325.920] (-322.149) (-322.047) -- 0:00:19
      585000 -- (-322.228) (-323.587) (-324.521) [-323.329] * (-322.836) [-321.545] (-322.978) (-321.598) -- 0:00:19

      Average standard deviation of split frequencies: 0.011262

      585500 -- (-322.340) (-325.640) (-323.076) [-323.505] * (-322.575) (-326.178) (-325.346) [-322.126] -- 0:00:19
      586000 -- (-324.271) (-324.271) [-321.743] (-321.695) * (-327.028) [-324.065] (-324.035) (-323.243) -- 0:00:19
      586500 -- (-322.089) [-321.851] (-322.407) (-323.310) * [-323.756] (-322.099) (-329.405) (-322.231) -- 0:00:19
      587000 -- (-322.057) (-325.061) (-322.832) [-321.043] * [-325.603] (-325.746) (-329.375) (-322.629) -- 0:00:18
      587500 -- (-324.701) [-322.167] (-322.883) (-322.168) * (-323.536) [-324.243] (-321.242) (-323.010) -- 0:00:18
      588000 -- [-322.233] (-320.969) (-323.327) (-321.406) * (-321.242) (-322.938) (-322.750) [-322.466] -- 0:00:18
      588500 -- (-322.645) (-321.597) (-321.847) [-327.184] * (-321.611) [-322.018] (-324.414) (-323.317) -- 0:00:18
      589000 -- [-320.499] (-323.622) (-322.540) (-321.807) * [-321.332] (-323.893) (-324.357) (-323.923) -- 0:00:18
      589500 -- [-321.502] (-323.138) (-321.487) (-320.652) * [-321.748] (-323.494) (-322.705) (-325.856) -- 0:00:18
      590000 -- (-322.366) (-324.381) [-324.917] (-324.803) * (-325.049) [-323.587] (-325.428) (-324.228) -- 0:00:18

      Average standard deviation of split frequencies: 0.011173

      590500 -- [-323.245] (-321.395) (-322.481) (-322.262) * (-322.651) (-323.468) (-325.150) [-320.643] -- 0:00:18
      591000 -- (-324.174) (-322.454) [-321.870] (-322.337) * (-321.382) (-323.986) (-323.896) [-323.609] -- 0:00:18
      591500 -- (-323.428) (-322.220) [-322.992] (-322.955) * (-322.969) [-323.021] (-322.273) (-322.222) -- 0:00:18
      592000 -- (-323.996) [-322.020] (-322.142) (-322.534) * (-323.380) (-326.970) (-326.307) [-321.999] -- 0:00:18
      592500 -- (-321.379) (-321.252) [-323.206] (-322.014) * [-324.212] (-324.934) (-321.567) (-321.066) -- 0:00:18
      593000 -- (-324.225) (-322.529) (-322.207) [-321.376] * [-324.462] (-321.749) (-322.829) (-324.071) -- 0:00:18
      593500 -- (-324.113) [-325.067] (-321.695) (-321.520) * (-324.215) (-323.053) (-322.006) [-324.752] -- 0:00:18
      594000 -- [-325.426] (-322.849) (-322.833) (-323.902) * (-322.597) (-324.987) [-324.959] (-329.206) -- 0:00:18
      594500 -- (-321.555) [-322.339] (-321.103) (-321.664) * (-328.103) (-332.417) [-324.784] (-326.607) -- 0:00:18
      595000 -- (-322.770) (-322.067) [-322.813] (-324.538) * (-320.565) [-322.430] (-322.910) (-320.805) -- 0:00:18

      Average standard deviation of split frequencies: 0.012655

      595500 -- (-322.761) (-321.519) (-321.440) [-323.205] * (-321.690) (-324.670) (-321.310) [-322.080] -- 0:00:18
      596000 -- (-322.678) [-322.192] (-324.622) (-324.177) * (-321.269) [-322.389] (-324.236) (-321.339) -- 0:00:18
      596500 -- (-322.184) (-324.834) (-321.137) [-321.871] * (-325.241) [-326.949] (-323.049) (-324.324) -- 0:00:18
      597000 -- (-322.744) (-322.191) (-321.875) [-323.541] * [-323.557] (-326.999) (-321.427) (-322.783) -- 0:00:18
      597500 -- (-324.100) (-322.555) (-326.061) [-320.549] * [-321.044] (-326.790) (-322.929) (-324.964) -- 0:00:18
      598000 -- (-324.011) (-322.111) (-321.921) [-321.185] * (-325.825) (-322.923) [-323.570] (-324.191) -- 0:00:18
      598500 -- [-321.652] (-323.114) (-321.819) (-322.114) * (-325.626) [-323.662] (-322.002) (-322.992) -- 0:00:18
      599000 -- (-321.488) [-321.029] (-322.036) (-322.787) * (-323.844) [-323.732] (-323.385) (-322.264) -- 0:00:18
      599500 -- (-322.106) [-323.190] (-321.396) (-324.198) * (-322.282) (-322.150) [-321.678] (-322.154) -- 0:00:18
      600000 -- (-320.878) (-321.778) (-321.368) [-323.942] * (-322.781) [-321.832] (-322.739) (-324.372) -- 0:00:18

      Average standard deviation of split frequencies: 0.012034

      600500 -- (-321.682) (-324.346) (-323.367) [-322.756] * (-322.017) [-321.491] (-323.791) (-321.771) -- 0:00:17
      601000 -- (-321.421) (-323.957) [-322.440] (-322.482) * [-325.043] (-327.340) (-324.459) (-323.236) -- 0:00:17
      601500 -- [-321.804] (-327.007) (-321.923) (-322.992) * [-321.122] (-327.527) (-325.141) (-321.441) -- 0:00:18
      602000 -- [-323.484] (-324.411) (-321.736) (-321.631) * (-323.865) (-323.814) [-326.645] (-323.832) -- 0:00:18
      602500 -- (-322.744) (-326.188) [-321.244] (-324.697) * (-323.411) (-323.992) (-325.122) [-323.155] -- 0:00:18
      603000 -- (-323.179) (-324.834) (-320.867) [-326.030] * (-321.028) (-327.704) [-321.065] (-322.000) -- 0:00:18
      603500 -- (-322.944) [-322.350] (-320.991) (-322.378) * (-321.651) (-326.178) [-320.821] (-325.044) -- 0:00:18
      604000 -- (-323.050) (-321.627) (-322.791) [-321.838] * (-321.828) (-321.692) [-321.833] (-323.667) -- 0:00:18
      604500 -- (-320.980) (-324.830) [-323.864] (-322.155) * (-326.353) [-321.798] (-323.285) (-326.323) -- 0:00:18
      605000 -- (-324.476) (-321.673) (-325.097) [-320.942] * (-326.521) (-322.090) [-324.717] (-323.624) -- 0:00:18

      Average standard deviation of split frequencies: 0.012446

      605500 -- (-321.189) (-325.008) (-324.367) [-323.041] * (-321.250) [-321.231] (-325.775) (-322.734) -- 0:00:18
      606000 -- (-323.913) (-322.229) [-323.355] (-323.432) * (-321.365) (-322.382) (-324.558) [-322.117] -- 0:00:18
      606500 -- (-323.757) (-320.559) [-322.641] (-320.698) * (-326.944) (-322.100) [-322.230] (-323.335) -- 0:00:18
      607000 -- (-324.795) (-321.956) [-321.832] (-323.261) * [-327.172] (-323.021) (-323.222) (-321.618) -- 0:00:18
      607500 -- (-326.832) (-322.190) [-323.563] (-326.399) * (-321.211) (-325.663) [-323.520] (-325.718) -- 0:00:18
      608000 -- (-323.783) (-322.420) [-324.088] (-321.451) * (-323.620) [-323.905] (-323.127) (-323.531) -- 0:00:18
      608500 -- (-323.273) (-322.377) [-320.761] (-321.246) * (-323.086) (-324.233) (-322.508) [-322.258] -- 0:00:18
      609000 -- (-324.476) (-323.997) (-327.054) [-321.297] * [-323.399] (-321.827) (-320.931) (-321.243) -- 0:00:17
      609500 -- [-325.076] (-321.824) (-323.422) (-321.741) * (-325.009) (-324.865) (-323.207) [-322.219] -- 0:00:17
      610000 -- (-323.857) (-322.677) (-330.725) [-325.211] * [-323.248] (-321.345) (-323.535) (-328.337) -- 0:00:17

      Average standard deviation of split frequencies: 0.012351

      610500 -- (-323.251) (-322.087) [-326.147] (-321.482) * (-323.788) [-322.715] (-322.144) (-325.859) -- 0:00:17
      611000 -- [-321.507] (-321.786) (-324.308) (-325.064) * (-324.672) [-321.332] (-325.432) (-327.077) -- 0:00:17
      611500 -- (-322.127) (-323.013) (-321.437) [-326.449] * (-322.266) [-321.145] (-323.980) (-321.679) -- 0:00:17
      612000 -- (-323.579) [-322.849] (-322.983) (-323.364) * (-325.075) (-321.581) [-323.658] (-321.989) -- 0:00:17
      612500 -- [-322.938] (-322.791) (-321.722) (-322.252) * [-324.545] (-322.613) (-325.184) (-322.231) -- 0:00:17
      613000 -- (-323.214) [-324.904] (-322.270) (-322.286) * (-323.725) (-321.579) (-321.115) [-323.256] -- 0:00:17
      613500 -- (-323.458) (-321.786) (-323.787) [-321.844] * (-322.723) (-320.840) [-322.266] (-322.973) -- 0:00:17
      614000 -- (-323.711) [-321.870] (-322.796) (-323.312) * (-320.763) (-321.561) [-323.016] (-322.963) -- 0:00:17
      614500 -- (-320.655) (-326.003) [-322.491] (-325.554) * (-320.855) (-322.067) [-321.280] (-321.669) -- 0:00:17
      615000 -- (-322.904) (-326.955) (-324.275) [-327.782] * (-324.602) [-323.405] (-322.451) (-322.934) -- 0:00:17

      Average standard deviation of split frequencies: 0.011734

      615500 -- (-321.427) (-325.899) (-323.495) [-321.867] * (-322.552) (-324.265) (-323.551) [-321.740] -- 0:00:17
      616000 -- (-322.554) (-326.130) (-322.844) [-326.219] * [-322.380] (-324.052) (-322.965) (-320.656) -- 0:00:17
      616500 -- (-324.915) [-325.827] (-323.009) (-325.167) * (-327.079) (-322.290) (-323.010) [-322.489] -- 0:00:17
      617000 -- (-322.155) (-322.950) (-320.744) [-320.851] * (-323.609) (-323.914) (-322.880) [-323.330] -- 0:00:17
      617500 -- [-320.765] (-322.997) (-320.786) (-320.923) * [-324.698] (-324.775) (-323.650) (-323.404) -- 0:00:17
      618000 -- (-322.714) [-322.584] (-322.873) (-323.957) * (-323.864) (-321.342) [-322.293] (-321.626) -- 0:00:17
      618500 -- [-321.590] (-325.141) (-321.859) (-322.624) * (-322.915) [-322.309] (-324.629) (-321.186) -- 0:00:17
      619000 -- (-320.999) (-320.918) (-321.238) [-322.206] * [-324.316] (-322.393) (-326.936) (-323.750) -- 0:00:17
      619500 -- (-320.848) [-321.551] (-321.695) (-329.378) * (-322.509) (-322.787) (-322.995) [-322.404] -- 0:00:17
      620000 -- (-321.686) [-323.872] (-323.931) (-323.589) * [-321.678] (-326.318) (-321.236) (-324.099) -- 0:00:17

      Average standard deviation of split frequencies: 0.012659

      620500 -- (-323.612) (-326.965) [-321.116] (-327.075) * (-322.738) [-322.694] (-320.928) (-321.342) -- 0:00:17
      621000 -- [-322.158] (-320.939) (-321.527) (-321.266) * [-323.329] (-322.799) (-324.775) (-321.261) -- 0:00:17
      621500 -- (-324.241) (-322.928) [-320.851] (-323.563) * (-321.482) (-321.636) (-320.877) [-326.505] -- 0:00:17
      622000 -- [-327.327] (-321.322) (-321.070) (-322.038) * (-322.568) (-321.165) (-322.074) [-321.710] -- 0:00:17
      622500 -- (-324.327) (-322.523) [-321.403] (-321.918) * (-323.789) (-323.387) (-323.064) [-323.407] -- 0:00:16
      623000 -- (-321.125) [-322.648] (-322.685) (-323.904) * [-325.004] (-321.918) (-321.897) (-323.992) -- 0:00:16
      623500 -- (-323.779) (-321.242) (-322.455) [-325.032] * [-320.766] (-323.111) (-321.393) (-324.074) -- 0:00:16
      624000 -- (-321.618) (-323.822) [-321.275] (-324.676) * (-326.798) [-321.016] (-323.221) (-320.898) -- 0:00:16
      624500 -- (-321.130) [-323.630] (-324.508) (-320.789) * (-325.459) (-323.499) (-320.929) [-321.746] -- 0:00:17
      625000 -- [-323.876] (-326.225) (-322.262) (-321.603) * [-323.591] (-322.743) (-324.765) (-324.787) -- 0:00:17

      Average standard deviation of split frequencies: 0.013555

      625500 -- (-320.989) (-323.400) (-324.398) [-321.524] * [-322.566] (-325.050) (-322.405) (-323.242) -- 0:00:17
      626000 -- (-327.482) [-322.274] (-324.001) (-322.712) * (-320.537) [-321.658] (-321.194) (-323.182) -- 0:00:17
      626500 -- [-321.632] (-323.548) (-322.224) (-321.542) * (-322.967) (-326.369) (-322.748) [-325.384] -- 0:00:17
      627000 -- (-324.027) [-324.391] (-321.354) (-322.284) * (-322.916) (-325.117) (-324.018) [-322.275] -- 0:00:17
      627500 -- (-324.467) (-322.046) [-321.558] (-322.561) * (-323.122) (-323.647) (-324.799) [-323.545] -- 0:00:17
      628000 -- (-324.824) [-321.642] (-322.901) (-330.138) * (-321.122) (-322.646) [-323.684] (-323.455) -- 0:00:17
      628500 -- (-322.510) (-323.243) (-321.109) [-321.614] * (-323.205) [-320.807] (-324.144) (-327.526) -- 0:00:17
      629000 -- [-323.114] (-321.655) (-323.633) (-321.082) * [-321.502] (-321.793) (-321.317) (-323.845) -- 0:00:17
      629500 -- (-321.524) [-321.093] (-325.254) (-322.490) * (-322.225) (-321.320) (-324.261) [-323.254] -- 0:00:17
      630000 -- (-320.585) (-322.034) (-323.308) [-322.202] * (-322.414) (-321.957) (-322.250) [-322.680] -- 0:00:17

      Average standard deviation of split frequencies: 0.012956

      630500 -- (-322.438) (-322.321) (-326.489) [-321.336] * (-321.464) [-321.675] (-325.991) (-323.408) -- 0:00:16
      631000 -- (-323.961) [-321.497] (-324.726) (-323.658) * (-322.251) [-322.441] (-324.251) (-322.276) -- 0:00:16
      631500 -- (-323.647) (-324.869) (-324.854) [-322.047] * (-322.943) (-321.709) [-326.052] (-322.752) -- 0:00:16
      632000 -- [-324.327] (-322.909) (-321.580) (-323.019) * [-327.344] (-321.441) (-322.196) (-321.750) -- 0:00:16
      632500 -- (-324.117) (-324.856) (-321.315) [-322.680] * (-325.737) (-324.068) [-323.567] (-321.730) -- 0:00:16
      633000 -- [-324.089] (-323.733) (-321.446) (-322.085) * (-323.662) (-322.510) (-325.387) [-325.919] -- 0:00:16
      633500 -- [-321.856] (-322.898) (-321.277) (-324.595) * (-323.672) (-322.373) [-323.757] (-323.251) -- 0:00:16
      634000 -- [-321.674] (-326.214) (-322.303) (-321.627) * (-324.328) [-321.374] (-323.336) (-322.042) -- 0:00:16
      634500 -- [-321.914] (-323.368) (-321.995) (-323.265) * (-323.289) [-321.718] (-322.765) (-322.654) -- 0:00:16
      635000 -- (-324.217) (-321.723) (-324.061) [-322.906] * (-325.083) (-324.463) (-326.703) [-320.931] -- 0:00:16

      Average standard deviation of split frequencies: 0.011859

      635500 -- (-322.280) (-322.239) [-325.056] (-324.265) * [-324.587] (-321.873) (-324.197) (-321.895) -- 0:00:16
      636000 -- (-325.820) [-322.263] (-321.893) (-329.380) * (-322.776) (-321.272) [-321.899] (-321.676) -- 0:00:16
      636500 -- (-323.065) (-322.527) (-321.409) [-325.214] * (-323.719) [-322.061] (-321.233) (-323.555) -- 0:00:16
      637000 -- (-323.945) [-322.175] (-326.199) (-321.183) * (-324.879) (-326.074) (-322.980) [-326.118] -- 0:00:16
      637500 -- (-321.349) [-321.655] (-327.677) (-321.556) * (-322.164) [-321.709] (-321.783) (-324.499) -- 0:00:16
      638000 -- [-321.115] (-324.088) (-328.380) (-322.535) * (-322.116) (-321.535) (-322.980) [-324.682] -- 0:00:16
      638500 -- (-322.390) (-324.769) (-323.087) [-322.625] * (-323.194) [-321.924] (-324.506) (-323.633) -- 0:00:16
      639000 -- (-320.853) (-328.913) (-326.383) [-321.832] * (-322.766) (-321.212) (-324.590) [-329.797] -- 0:00:16
      639500 -- [-322.463] (-321.749) (-323.800) (-322.504) * (-321.218) (-323.439) [-321.446] (-324.547) -- 0:00:16
      640000 -- (-321.330) (-322.295) [-323.573] (-321.860) * (-322.432) (-322.659) (-321.426) [-324.208] -- 0:00:16

      Average standard deviation of split frequencies: 0.011282

      640500 -- [-320.768] (-321.268) (-328.172) (-321.581) * (-321.815) (-327.571) (-321.362) [-320.771] -- 0:00:16
      641000 -- (-320.760) (-322.962) (-323.400) [-320.811] * (-322.285) [-323.094] (-322.127) (-323.569) -- 0:00:16
      641500 -- [-320.577] (-321.450) (-324.033) (-324.572) * [-323.998] (-322.946) (-320.796) (-322.247) -- 0:00:16
      642000 -- (-322.363) (-322.398) (-321.783) [-324.278] * (-321.782) [-321.643] (-324.325) (-324.528) -- 0:00:16
      642500 -- (-321.423) (-324.312) (-324.046) [-322.670] * (-323.451) [-323.584] (-322.562) (-323.769) -- 0:00:16
      643000 -- (-320.475) (-321.319) [-321.357] (-322.824) * [-321.927] (-320.981) (-321.969) (-321.483) -- 0:00:16
      643500 -- (-323.791) (-323.721) [-320.602] (-323.078) * [-323.529] (-322.247) (-321.539) (-320.833) -- 0:00:16
      644000 -- (-333.255) (-322.135) [-321.268] (-322.812) * (-321.966) [-321.582] (-321.725) (-321.864) -- 0:00:16
      644500 -- [-325.131] (-322.526) (-321.991) (-322.020) * (-325.897) (-328.295) (-322.670) [-321.674] -- 0:00:15
      645000 -- (-324.502) (-323.830) [-322.290] (-322.230) * [-324.878] (-325.368) (-328.392) (-322.906) -- 0:00:15

      Average standard deviation of split frequencies: 0.012162

      645500 -- (-322.042) (-324.697) (-321.819) [-325.538] * (-328.186) (-323.798) [-321.404] (-325.108) -- 0:00:15
      646000 -- [-321.996] (-326.049) (-324.457) (-327.754) * (-323.611) (-322.094) [-321.699] (-325.666) -- 0:00:15
      646500 -- (-325.640) (-324.247) [-324.907] (-327.843) * (-323.325) [-323.280] (-321.742) (-322.427) -- 0:00:15
      647000 -- (-322.958) [-321.752] (-328.097) (-320.560) * (-321.572) [-322.215] (-324.466) (-322.578) -- 0:00:15
      647500 -- (-323.080) (-322.971) [-322.607] (-328.480) * (-322.578) [-323.213] (-322.868) (-322.345) -- 0:00:16
      648000 -- (-321.132) (-322.111) [-323.956] (-323.878) * (-323.939) [-323.774] (-322.825) (-323.050) -- 0:00:16
      648500 -- (-326.226) [-322.922] (-322.926) (-322.153) * (-323.875) [-320.991] (-325.123) (-323.072) -- 0:00:16
      649000 -- (-323.466) [-322.223] (-323.580) (-322.511) * (-322.001) (-320.890) (-324.053) [-322.341] -- 0:00:16
      649500 -- (-324.789) [-321.932] (-323.903) (-321.455) * (-323.865) (-321.398) [-323.772] (-320.755) -- 0:00:16
      650000 -- (-323.717) [-321.026] (-323.639) (-323.522) * [-321.632] (-322.925) (-321.693) (-322.397) -- 0:00:16

      Average standard deviation of split frequencies: 0.014007

      650500 -- (-323.536) [-321.931] (-322.027) (-323.984) * [-321.587] (-322.760) (-322.457) (-324.465) -- 0:00:16
      651000 -- (-321.786) (-322.696) [-321.210] (-323.864) * (-321.252) (-324.316) [-322.046] (-322.540) -- 0:00:16
      651500 -- (-324.608) (-322.979) [-321.759] (-321.485) * [-321.784] (-321.818) (-323.022) (-323.065) -- 0:00:16
      652000 -- [-326.846] (-321.275) (-323.173) (-322.279) * (-323.990) [-320.989] (-325.211) (-321.398) -- 0:00:16
      652500 -- [-322.265] (-320.908) (-321.199) (-326.208) * (-324.863) [-322.774] (-321.395) (-322.505) -- 0:00:15
      653000 -- (-323.216) [-324.947] (-323.797) (-321.437) * (-322.878) (-326.975) [-322.685] (-321.278) -- 0:00:15
      653500 -- (-323.837) (-323.706) (-326.505) [-320.844] * (-324.570) (-322.185) [-323.078] (-324.342) -- 0:00:15
      654000 -- (-324.414) (-323.122) (-326.823) [-323.387] * (-322.207) (-322.206) [-322.390] (-320.836) -- 0:00:15
      654500 -- (-323.039) (-323.625) (-322.535) [-323.181] * (-321.835) [-322.596] (-322.414) (-323.687) -- 0:00:15
      655000 -- [-322.635] (-324.200) (-323.103) (-321.845) * [-320.939] (-321.757) (-325.383) (-321.744) -- 0:00:15

      Average standard deviation of split frequencies: 0.012456

      655500 -- (-324.106) [-323.472] (-326.870) (-323.803) * (-323.085) [-322.363] (-325.574) (-327.899) -- 0:00:15
      656000 -- (-322.989) (-323.416) (-323.512) [-325.512] * [-324.358] (-320.574) (-321.289) (-326.626) -- 0:00:15
      656500 -- [-323.374] (-321.596) (-323.313) (-324.139) * (-321.323) (-323.914) [-321.568] (-323.185) -- 0:00:15
      657000 -- (-321.242) (-324.371) [-326.585] (-322.437) * [-322.093] (-321.476) (-321.777) (-322.009) -- 0:00:15
      657500 -- (-323.015) (-321.868) (-322.676) [-324.798] * [-322.454] (-324.772) (-321.852) (-321.882) -- 0:00:15
      658000 -- (-323.143) [-325.313] (-321.162) (-325.335) * (-323.797) (-322.979) (-321.387) [-320.844] -- 0:00:15
      658500 -- (-323.244) [-322.802] (-323.213) (-324.500) * (-322.452) (-326.012) (-324.469) [-321.181] -- 0:00:15
      659000 -- (-325.249) (-324.070) (-323.628) [-321.361] * (-324.704) [-321.416] (-323.213) (-321.381) -- 0:00:15
      659500 -- (-324.410) (-326.524) (-324.901) [-325.325] * (-324.091) [-325.259] (-322.643) (-322.422) -- 0:00:15
      660000 -- (-326.124) (-322.693) (-321.401) [-322.703] * (-325.044) (-321.105) (-323.339) [-321.778] -- 0:00:15

      Average standard deviation of split frequencies: 0.011892

      660500 -- (-323.755) [-324.585] (-323.587) (-322.971) * (-322.872) (-321.857) [-321.550] (-321.627) -- 0:00:15
      661000 -- (-322.777) (-322.846) [-324.656] (-327.648) * (-322.462) (-324.150) (-323.258) [-323.200] -- 0:00:15
      661500 -- (-321.897) (-322.950) (-321.920) [-322.551] * (-322.454) (-320.719) [-321.964] (-320.986) -- 0:00:15
      662000 -- [-322.011] (-333.151) (-326.534) (-322.288) * [-321.124] (-321.811) (-322.275) (-326.201) -- 0:00:15
      662500 -- (-321.790) (-322.874) (-322.428) [-321.297] * [-321.979] (-321.874) (-323.367) (-326.517) -- 0:00:15
      663000 -- (-325.062) [-321.490] (-326.828) (-322.750) * [-322.544] (-321.383) (-321.640) (-321.877) -- 0:00:15
      663500 -- (-327.243) (-322.736) [-325.875] (-322.718) * (-323.955) [-323.066] (-320.845) (-321.313) -- 0:00:15
      664000 -- [-323.824] (-326.843) (-323.811) (-321.349) * [-326.194] (-325.039) (-325.166) (-322.244) -- 0:00:15
      664500 -- (-323.583) [-324.778] (-320.761) (-321.274) * (-321.840) [-322.896] (-323.096) (-325.109) -- 0:00:15
      665000 -- (-327.310) (-324.210) [-324.909] (-323.605) * (-325.966) (-324.151) [-326.949] (-325.921) -- 0:00:15

      Average standard deviation of split frequencies: 0.011797

      665500 -- (-322.487) [-321.381] (-321.414) (-323.222) * (-323.393) (-321.483) [-321.227] (-326.460) -- 0:00:15
      666000 -- (-323.457) (-322.909) (-321.351) [-321.752] * (-322.544) (-320.507) [-325.186] (-325.003) -- 0:00:15
      666500 -- (-325.002) [-321.665] (-321.805) (-321.733) * [-320.572] (-324.962) (-321.232) (-323.826) -- 0:00:15
      667000 -- (-325.113) (-322.508) [-320.911] (-325.582) * [-322.521] (-320.912) (-321.204) (-326.327) -- 0:00:14
      667500 -- (-322.371) (-321.686) [-321.507] (-325.766) * (-322.704) (-322.204) [-323.394] (-322.578) -- 0:00:14
      668000 -- (-322.390) [-326.443] (-321.633) (-323.854) * [-322.442] (-324.893) (-321.374) (-323.591) -- 0:00:14
      668500 -- (-322.254) (-326.671) (-323.955) [-325.325] * (-323.449) [-321.770] (-320.983) (-324.200) -- 0:00:14
      669000 -- (-327.591) (-323.654) [-323.616] (-326.556) * [-321.950] (-320.406) (-326.900) (-322.303) -- 0:00:14
      669500 -- (-321.350) (-324.480) [-322.320] (-324.494) * (-322.202) (-321.387) [-321.327] (-322.175) -- 0:00:14
      670000 -- (-322.789) [-322.250] (-321.585) (-320.749) * (-321.098) (-322.751) (-325.261) [-325.513] -- 0:00:14

      Average standard deviation of split frequencies: 0.010309

      670500 -- (-321.642) (-321.750) (-324.220) [-322.933] * (-321.205) [-320.973] (-325.391) (-321.216) -- 0:00:15
      671000 -- [-322.110] (-323.344) (-325.630) (-322.727) * (-324.516) (-322.634) (-323.512) [-322.076] -- 0:00:15
      671500 -- [-322.403] (-325.484) (-321.147) (-324.177) * [-324.495] (-321.674) (-322.021) (-328.439) -- 0:00:15
      672000 -- (-322.551) [-321.038] (-321.955) (-322.585) * [-324.405] (-322.459) (-326.540) (-322.872) -- 0:00:15
      672500 -- (-324.809) [-322.070] (-325.647) (-323.869) * (-321.806) [-324.356] (-321.995) (-327.690) -- 0:00:15
      673000 -- (-323.686) (-323.588) [-321.188] (-326.635) * (-326.939) (-324.077) [-322.315] (-323.313) -- 0:00:15
      673500 -- (-321.186) [-332.704] (-325.918) (-326.519) * (-322.726) [-321.458] (-322.067) (-322.302) -- 0:00:15
      674000 -- [-321.841] (-323.693) (-322.066) (-324.184) * (-325.166) (-324.812) (-320.967) [-326.937] -- 0:00:14
      674500 -- (-324.279) (-321.537) (-324.521) [-323.932] * (-327.248) (-324.799) [-322.091] (-321.820) -- 0:00:14
      675000 -- (-323.355) (-322.301) [-321.456] (-323.943) * (-324.407) [-324.029] (-324.571) (-321.322) -- 0:00:14

      Average standard deviation of split frequencies: 0.010693

      675500 -- (-323.141) [-324.412] (-322.866) (-323.739) * (-320.508) (-321.346) (-321.442) [-322.154] -- 0:00:14
      676000 -- [-322.622] (-321.479) (-321.779) (-324.575) * (-323.162) (-323.008) (-321.610) [-321.642] -- 0:00:14
      676500 -- (-320.994) [-321.602] (-324.694) (-322.646) * (-324.386) (-322.446) (-321.995) [-321.486] -- 0:00:14
      677000 -- (-320.809) [-320.553] (-322.030) (-322.435) * (-321.552) (-321.497) (-324.027) [-323.350] -- 0:00:14
      677500 -- (-320.629) (-323.905) (-323.935) [-321.957] * (-323.116) (-321.833) [-324.878] (-321.942) -- 0:00:14
      678000 -- (-321.679) (-324.744) (-322.698) [-322.262] * (-321.416) (-321.937) (-325.609) [-321.502] -- 0:00:14
      678500 -- (-321.468) (-328.416) (-321.976) [-323.027] * [-322.268] (-321.838) (-322.279) (-321.254) -- 0:00:14
      679000 -- (-324.531) (-323.488) [-321.258] (-325.543) * [-321.535] (-322.173) (-320.944) (-320.803) -- 0:00:14
      679500 -- [-322.495] (-321.052) (-333.020) (-325.073) * [-322.283] (-323.638) (-321.210) (-321.173) -- 0:00:14
      680000 -- [-321.233] (-320.694) (-322.775) (-323.065) * (-322.945) [-321.705] (-321.198) (-322.226) -- 0:00:14

      Average standard deviation of split frequencies: 0.010619

      680500 -- (-325.680) (-320.905) (-321.432) [-322.512] * (-324.447) (-322.308) (-322.083) [-328.170] -- 0:00:14
      681000 -- (-324.506) (-321.857) [-322.549] (-323.294) * (-323.190) (-323.164) (-324.534) [-321.709] -- 0:00:14
      681500 -- (-327.540) [-322.139] (-322.750) (-325.500) * (-323.976) (-325.928) [-323.664] (-321.704) -- 0:00:14
      682000 -- (-321.425) (-322.613) [-321.777] (-321.950) * (-321.656) (-322.655) [-324.961] (-321.222) -- 0:00:14
      682500 -- (-321.387) (-324.468) (-325.550) [-327.225] * (-320.711) [-325.090] (-322.951) (-326.548) -- 0:00:14
      683000 -- [-322.230] (-321.513) (-327.113) (-327.195) * [-321.867] (-323.177) (-322.780) (-326.333) -- 0:00:14
      683500 -- (-321.570) (-321.687) [-321.052] (-322.382) * (-322.014) (-322.589) [-322.351] (-327.052) -- 0:00:14
      684000 -- (-326.631) (-321.587) [-322.840] (-322.325) * (-324.407) [-325.418] (-321.750) (-325.175) -- 0:00:14
      684500 -- (-324.151) [-322.451] (-322.060) (-322.481) * [-321.780] (-322.912) (-322.666) (-327.127) -- 0:00:14
      685000 -- (-325.284) (-321.851) [-321.333] (-324.034) * (-323.380) [-325.141] (-324.956) (-326.158) -- 0:00:14

      Average standard deviation of split frequencies: 0.009621

      685500 -- (-325.165) [-325.961] (-321.922) (-322.788) * (-324.434) (-323.997) [-320.959] (-320.489) -- 0:00:14
      686000 -- [-323.176] (-327.586) (-320.807) (-322.201) * [-321.096] (-329.085) (-322.584) (-320.503) -- 0:00:14
      686500 -- (-323.400) [-323.948] (-322.337) (-323.660) * [-323.199] (-325.467) (-323.381) (-323.656) -- 0:00:14
      687000 -- [-323.760] (-322.225) (-324.562) (-322.107) * (-321.868) [-321.787] (-322.369) (-325.223) -- 0:00:14
      687500 -- (-322.236) (-322.505) (-323.116) [-322.321] * [-324.136] (-325.564) (-321.171) (-322.038) -- 0:00:14
      688000 -- (-323.106) (-321.238) (-325.452) [-321.724] * (-323.883) [-322.082] (-322.799) (-321.607) -- 0:00:14
      688500 -- (-322.437) [-321.983] (-321.119) (-323.083) * (-325.449) (-321.970) (-324.913) [-322.001] -- 0:00:14
      689000 -- (-322.876) [-323.400] (-321.957) (-325.222) * (-324.637) (-322.841) [-324.380] (-322.215) -- 0:00:13
      689500 -- (-321.494) [-322.307] (-321.607) (-323.649) * (-322.876) (-321.305) (-324.834) [-321.400] -- 0:00:13
      690000 -- [-321.161] (-322.776) (-322.926) (-320.736) * (-329.447) (-321.494) (-320.594) [-320.872] -- 0:00:13

      Average standard deviation of split frequencies: 0.007280

      690500 -- (-321.076) (-323.078) (-322.662) [-324.366] * (-326.547) (-321.415) [-321.703] (-323.941) -- 0:00:13
      691000 -- [-321.400] (-321.944) (-322.986) (-322.031) * (-324.270) (-323.328) (-323.565) [-322.545] -- 0:00:13
      691500 -- [-321.719] (-322.743) (-320.769) (-322.344) * (-322.969) (-322.880) [-323.165] (-322.786) -- 0:00:13
      692000 -- (-322.156) (-325.714) [-323.574] (-322.449) * (-324.450) (-327.621) [-321.061] (-323.455) -- 0:00:13
      692500 -- (-323.682) (-323.276) (-321.692) [-322.922] * (-326.860) [-325.478] (-321.328) (-321.732) -- 0:00:13
      693000 -- [-324.028] (-321.465) (-322.505) (-320.827) * (-321.964) (-324.421) (-325.489) [-322.802] -- 0:00:14
      693500 -- (-325.757) (-324.052) [-326.450] (-324.591) * [-322.017] (-326.466) (-324.257) (-322.021) -- 0:00:14
      694000 -- (-323.599) (-325.227) [-324.414] (-323.899) * (-320.864) [-323.701] (-326.889) (-322.515) -- 0:00:14
      694500 -- (-324.196) [-327.750] (-321.731) (-325.352) * [-321.390] (-321.513) (-322.503) (-321.237) -- 0:00:14
      695000 -- (-322.199) [-321.220] (-323.728) (-323.647) * (-323.786) [-323.807] (-321.910) (-321.586) -- 0:00:14

      Average standard deviation of split frequencies: 0.006773

      695500 -- (-325.186) (-322.487) [-325.598] (-322.597) * [-321.729] (-325.561) (-323.207) (-323.381) -- 0:00:14
      696000 -- [-322.648] (-322.428) (-321.430) (-321.939) * (-324.793) [-323.788] (-325.484) (-322.131) -- 0:00:13
      696500 -- (-322.475) (-321.949) (-329.749) [-320.908] * [-322.845] (-323.434) (-321.004) (-321.556) -- 0:00:13
      697000 -- (-321.471) (-324.451) [-320.722] (-323.016) * [-322.907] (-325.042) (-320.697) (-325.259) -- 0:00:13
      697500 -- (-320.954) [-325.237] (-324.668) (-324.691) * (-323.031) (-323.427) [-320.827] (-323.170) -- 0:00:13
      698000 -- (-321.788) [-323.281] (-323.827) (-322.266) * (-328.693) (-322.118) (-321.034) [-322.172] -- 0:00:13
      698500 -- [-321.513] (-321.270) (-321.958) (-322.446) * (-322.763) (-320.782) [-321.483] (-322.589) -- 0:00:13
      699000 -- (-322.603) (-324.211) (-324.432) [-324.012] * [-322.454] (-324.845) (-321.287) (-324.193) -- 0:00:13
      699500 -- [-323.796] (-321.060) (-322.213) (-322.250) * [-323.610] (-327.120) (-323.315) (-321.852) -- 0:00:13
      700000 -- [-322.573] (-321.981) (-327.173) (-323.173) * [-322.022] (-329.759) (-321.937) (-324.408) -- 0:00:13

      Average standard deviation of split frequencies: 0.006728

      700500 -- [-321.937] (-322.383) (-322.640) (-322.933) * [-324.190] (-326.108) (-321.102) (-325.961) -- 0:00:13
      701000 -- (-322.029) (-323.452) [-321.203] (-323.772) * (-320.729) (-323.600) [-323.541] (-323.625) -- 0:00:13
      701500 -- (-322.248) (-324.150) [-322.594] (-326.690) * (-321.735) (-323.329) (-322.160) [-321.625] -- 0:00:13
      702000 -- (-322.413) (-326.956) (-322.595) [-325.371] * [-320.643] (-322.399) (-321.391) (-331.944) -- 0:00:13
      702500 -- (-323.228) (-322.821) (-322.178) [-321.171] * (-323.688) (-322.135) (-321.701) [-323.341] -- 0:00:13
      703000 -- [-326.818] (-324.690) (-322.460) (-321.358) * (-321.673) (-323.368) (-321.303) [-323.310] -- 0:00:13
      703500 -- (-323.337) [-329.230] (-323.571) (-323.852) * (-320.560) (-325.021) (-320.909) [-325.792] -- 0:00:13
      704000 -- (-322.604) (-323.629) (-325.410) [-322.643] * [-322.724] (-321.652) (-325.053) (-321.741) -- 0:00:13
      704500 -- (-323.639) (-327.166) [-322.173] (-323.315) * (-324.842) (-325.091) [-323.748] (-322.077) -- 0:00:13
      705000 -- (-323.661) (-326.973) [-322.992] (-321.869) * [-321.853] (-322.624) (-322.719) (-322.903) -- 0:00:13

      Average standard deviation of split frequencies: 0.008458

      705500 -- (-323.021) [-322.176] (-322.975) (-322.739) * (-321.916) [-323.335] (-321.609) (-327.101) -- 0:00:13
      706000 -- (-320.607) [-326.978] (-323.329) (-321.871) * [-322.503] (-321.834) (-322.097) (-321.311) -- 0:00:13
      706500 -- (-324.954) (-326.142) (-321.751) [-322.373] * (-322.614) (-324.600) (-321.924) [-326.243] -- 0:00:13
      707000 -- (-323.705) (-323.759) (-323.032) [-320.730] * (-324.382) (-324.314) (-321.820) [-326.303] -- 0:00:13
      707500 -- (-323.714) (-325.300) (-322.598) [-323.412] * [-322.474] (-326.092) (-322.691) (-323.082) -- 0:00:13
      708000 -- (-323.770) (-322.021) (-322.074) [-322.493] * (-324.767) [-325.388] (-323.405) (-322.835) -- 0:00:13
      708500 -- (-321.263) (-321.666) (-327.111) [-321.881] * (-324.377) (-323.842) (-321.605) [-323.926] -- 0:00:13
      709000 -- (-322.322) [-324.203] (-323.102) (-321.607) * (-325.280) [-323.550] (-322.000) (-323.696) -- 0:00:13
      709500 -- (-324.865) (-322.684) (-326.096) [-322.050] * (-323.634) (-321.266) [-321.285] (-324.611) -- 0:00:13
      710000 -- (-322.501) [-323.386] (-322.747) (-323.043) * [-324.098] (-323.065) (-323.740) (-326.553) -- 0:00:13

      Average standard deviation of split frequencies: 0.007075

      710500 -- (-322.526) [-321.135] (-320.647) (-321.133) * (-326.652) (-321.527) (-325.184) [-320.828] -- 0:00:13
      711000 -- (-323.466) (-322.182) [-322.442] (-321.381) * (-323.884) (-321.076) [-320.743] (-320.914) -- 0:00:13
      711500 -- (-323.826) (-322.035) [-321.074] (-321.335) * (-323.615) (-325.112) (-321.624) [-322.953] -- 0:00:12
      712000 -- (-322.050) [-322.486] (-322.850) (-325.348) * (-323.907) (-322.434) (-324.429) [-324.310] -- 0:00:12
      712500 -- (-326.569) [-323.289] (-322.486) (-328.985) * (-322.898) [-323.047] (-322.356) (-323.972) -- 0:00:12
      713000 -- (-323.191) (-325.033) (-320.678) [-324.388] * (-321.313) (-322.841) [-321.776] (-323.830) -- 0:00:12
      713500 -- (-321.265) (-323.795) [-321.456] (-322.296) * (-322.197) (-321.484) (-323.156) [-322.192] -- 0:00:12
      714000 -- (-321.752) (-323.827) [-331.020] (-322.955) * [-321.742] (-323.247) (-321.768) (-325.575) -- 0:00:12
      714500 -- (-322.255) [-322.455] (-328.205) (-321.135) * (-322.142) (-321.581) [-322.888] (-323.721) -- 0:00:12
      715000 -- (-323.772) (-324.547) (-321.959) [-321.232] * [-322.408] (-323.111) (-326.214) (-322.998) -- 0:00:12

      Average standard deviation of split frequencies: 0.006145

      715500 -- (-323.223) [-323.420] (-321.552) (-320.905) * (-322.791) (-322.377) [-324.227] (-329.431) -- 0:00:13
      716000 -- (-321.517) (-323.004) (-327.029) [-323.604] * [-322.138] (-322.772) (-324.570) (-321.008) -- 0:00:13
      716500 -- (-322.576) (-324.942) [-321.086] (-324.643) * (-324.268) (-321.429) (-323.609) [-325.170] -- 0:00:13
      717000 -- (-322.002) [-322.103] (-323.326) (-323.371) * [-322.238] (-323.885) (-321.981) (-324.008) -- 0:00:13
      717500 -- (-322.387) (-322.714) [-324.013] (-324.378) * (-321.476) (-321.090) [-322.651] (-321.841) -- 0:00:12
      718000 -- (-322.357) [-321.519] (-324.814) (-323.622) * [-321.864] (-322.661) (-323.244) (-323.185) -- 0:00:12
      718500 -- [-320.992] (-321.815) (-322.651) (-322.064) * [-323.396] (-321.575) (-326.258) (-320.927) -- 0:00:12
      719000 -- [-320.884] (-320.715) (-322.656) (-322.351) * [-322.636] (-322.369) (-325.687) (-321.935) -- 0:00:12
      719500 -- (-323.954) (-322.769) [-324.804] (-321.029) * (-326.407) [-322.060] (-321.042) (-324.481) -- 0:00:12
      720000 -- [-324.448] (-321.755) (-322.507) (-323.580) * (-323.392) (-323.519) (-323.411) [-323.151] -- 0:00:12

      Average standard deviation of split frequencies: 0.007413

      720500 -- (-323.419) [-324.346] (-324.517) (-325.092) * [-322.976] (-323.239) (-321.944) (-326.097) -- 0:00:12
      721000 -- (-324.013) (-321.305) [-322.950] (-322.469) * (-321.596) (-324.224) [-322.181] (-323.620) -- 0:00:12
      721500 -- (-324.535) [-321.420] (-323.130) (-324.133) * (-326.152) (-323.548) (-324.006) [-322.085] -- 0:00:12
      722000 -- (-322.547) (-322.379) [-322.577] (-323.402) * (-325.757) (-329.210) [-322.365] (-322.993) -- 0:00:12
      722500 -- (-326.044) (-324.082) [-327.117] (-322.694) * (-322.069) [-322.391] (-324.548) (-324.144) -- 0:00:12
      723000 -- [-323.042] (-324.281) (-324.561) (-321.204) * [-321.188] (-323.259) (-322.005) (-323.360) -- 0:00:12
      723500 -- (-325.751) [-323.812] (-323.289) (-331.821) * [-321.989] (-323.862) (-324.058) (-322.436) -- 0:00:12
      724000 -- (-322.990) (-322.491) [-322.245] (-323.144) * (-321.537) (-325.004) [-322.663] (-322.173) -- 0:00:12
      724500 -- (-327.937) (-327.635) (-321.426) [-321.464] * (-324.021) [-322.502] (-325.161) (-325.348) -- 0:00:12
      725000 -- [-323.749] (-322.365) (-323.811) (-322.099) * (-320.980) (-327.542) (-322.057) [-322.094] -- 0:00:12

      Average standard deviation of split frequencies: 0.007792

      725500 -- (-321.947) (-321.190) (-322.178) [-322.422] * (-321.061) [-322.612] (-323.650) (-324.384) -- 0:00:12
      726000 -- (-321.938) [-326.245] (-321.738) (-323.228) * (-322.141) (-327.632) (-324.574) [-323.746] -- 0:00:12
      726500 -- [-325.565] (-325.150) (-325.806) (-324.808) * [-326.048] (-321.502) (-324.316) (-322.296) -- 0:00:12
      727000 -- (-324.502) (-324.280) (-323.861) [-323.245] * (-322.938) (-323.978) (-325.123) [-321.563] -- 0:00:12
      727500 -- (-324.173) (-322.955) (-322.693) [-320.610] * (-323.628) [-322.789] (-324.714) (-321.186) -- 0:00:12
      728000 -- (-322.067) [-322.853] (-322.290) (-321.548) * (-320.408) [-322.370] (-322.110) (-323.974) -- 0:00:12
      728500 -- (-320.418) (-322.328) (-324.359) [-320.881] * (-321.082) [-321.950] (-322.059) (-320.660) -- 0:00:12
      729000 -- (-322.950) (-322.434) [-323.377] (-321.956) * (-321.864) (-321.521) [-321.411] (-326.479) -- 0:00:12
      729500 -- [-324.335] (-323.186) (-328.882) (-321.148) * (-321.177) (-322.286) (-322.581) [-321.044] -- 0:00:12
      730000 -- (-325.654) [-322.434] (-324.985) (-321.051) * (-324.860) (-322.306) (-324.280) [-326.622] -- 0:00:12

      Average standard deviation of split frequencies: 0.006022

      730500 -- [-325.492] (-323.527) (-325.741) (-321.158) * (-325.901) (-321.026) (-322.047) [-331.199] -- 0:00:12
      731000 -- (-324.950) (-321.763) [-323.827] (-325.714) * (-322.601) [-321.429] (-326.577) (-324.431) -- 0:00:12
      731500 -- [-322.660] (-322.852) (-322.976) (-324.713) * [-323.391] (-322.054) (-327.124) (-326.600) -- 0:00:12
      732000 -- (-322.274) (-322.304) (-324.418) [-329.920] * (-321.079) [-325.772] (-322.257) (-323.481) -- 0:00:12
      732500 -- (-323.082) (-323.817) (-326.205) [-324.254] * (-321.631) (-322.661) [-321.282] (-328.230) -- 0:00:12
      733000 -- [-322.055] (-323.023) (-321.439) (-321.918) * (-321.633) (-323.103) (-323.778) [-322.117] -- 0:00:12
      733500 -- (-323.100) [-322.003] (-323.657) (-320.894) * (-322.899) (-324.936) (-324.289) [-322.538] -- 0:00:11
      734000 -- (-332.074) (-322.628) [-322.142] (-320.772) * (-324.090) (-327.742) (-323.339) [-324.214] -- 0:00:11
      734500 -- [-323.803] (-321.989) (-324.818) (-320.789) * (-324.792) [-326.232] (-323.067) (-324.985) -- 0:00:11
      735000 -- (-325.068) [-320.700] (-322.947) (-322.346) * (-321.256) (-325.128) [-321.581] (-322.407) -- 0:00:11

      Average standard deviation of split frequencies: 0.004697

      735500 -- [-320.760] (-321.947) (-327.738) (-323.472) * (-322.310) (-322.937) [-321.851] (-320.370) -- 0:00:11
      736000 -- (-321.090) (-320.750) (-325.841) [-326.498] * [-321.014] (-321.842) (-322.166) (-321.254) -- 0:00:11
      736500 -- (-321.594) [-320.995] (-322.627) (-323.376) * [-320.710] (-325.245) (-320.777) (-322.411) -- 0:00:11
      737000 -- (-320.871) [-321.713] (-322.551) (-323.426) * (-320.874) (-322.449) [-321.029] (-322.997) -- 0:00:11
      737500 -- (-322.259) (-326.520) [-324.333] (-322.210) * (-323.662) (-322.862) [-321.156] (-324.613) -- 0:00:11
      738000 -- (-323.531) (-324.242) [-324.342] (-321.839) * (-325.215) [-322.962] (-321.967) (-325.987) -- 0:00:11
      738500 -- (-322.321) [-320.990] (-321.727) (-324.256) * [-322.238] (-323.199) (-323.818) (-322.972) -- 0:00:12
      739000 -- (-321.372) (-320.887) (-323.992) [-322.724] * (-321.521) (-325.766) (-323.955) [-321.568] -- 0:00:12
      739500 -- (-322.286) (-325.563) [-323.461] (-322.617) * [-322.046] (-323.178) (-320.394) (-325.654) -- 0:00:11
      740000 -- (-323.962) [-326.814] (-322.124) (-322.732) * [-323.448] (-320.951) (-323.793) (-323.071) -- 0:00:11

      Average standard deviation of split frequencies: 0.004243

      740500 -- (-321.662) (-324.968) [-322.536] (-322.625) * [-322.936] (-320.853) (-324.099) (-324.102) -- 0:00:11
      741000 -- [-321.652] (-322.548) (-322.680) (-320.890) * (-323.434) [-321.878] (-321.635) (-326.302) -- 0:00:11
      741500 -- (-325.012) [-322.184] (-323.031) (-321.726) * (-326.022) [-326.178] (-324.609) (-327.012) -- 0:00:11
      742000 -- (-322.633) (-320.446) (-323.225) [-323.519] * (-322.969) (-328.394) (-323.091) [-330.852] -- 0:00:11
      742500 -- [-321.202] (-324.248) (-322.372) (-323.792) * (-323.180) (-329.672) [-323.238] (-325.252) -- 0:00:11
      743000 -- (-322.114) (-323.381) (-323.256) [-321.563] * (-322.478) [-325.288] (-325.953) (-324.749) -- 0:00:11
      743500 -- (-324.621) (-324.855) [-322.980] (-320.774) * [-327.914] (-322.378) (-322.615) (-324.198) -- 0:00:11
      744000 -- (-322.365) [-326.391] (-325.280) (-321.659) * (-323.257) (-325.533) [-321.486] (-325.145) -- 0:00:11
      744500 -- (-321.730) [-326.578] (-325.171) (-322.916) * [-324.890] (-324.770) (-321.938) (-326.250) -- 0:00:11
      745000 -- (-323.590) (-327.995) (-323.587) [-321.818] * (-327.676) (-321.365) [-322.380] (-325.826) -- 0:00:11

      Average standard deviation of split frequencies: 0.004213

      745500 -- (-322.487) (-324.226) (-326.227) [-325.915] * [-321.145] (-323.677) (-321.436) (-323.139) -- 0:00:11
      746000 -- (-323.937) (-323.188) (-322.509) [-322.706] * (-323.563) (-321.490) (-325.779) [-321.897] -- 0:00:11
      746500 -- [-322.134] (-321.698) (-325.366) (-324.251) * [-321.419] (-325.543) (-322.607) (-322.927) -- 0:00:11
      747000 -- (-323.898) (-321.575) (-324.645) [-321.101] * (-323.678) [-321.889] (-322.677) (-322.470) -- 0:00:11
      747500 -- [-320.969] (-324.876) (-323.601) (-321.954) * (-324.463) [-322.898] (-323.575) (-324.016) -- 0:00:11
      748000 -- (-322.614) (-322.834) (-323.403) [-321.934] * (-326.289) [-325.509] (-323.157) (-321.915) -- 0:00:11
      748500 -- (-323.137) (-322.601) [-321.618] (-322.208) * [-322.425] (-324.073) (-322.194) (-322.756) -- 0:00:11
      749000 -- (-321.121) (-324.019) [-321.617] (-322.617) * (-321.798) (-323.668) (-322.123) [-325.204] -- 0:00:11
      749500 -- (-322.262) [-320.599] (-322.390) (-322.308) * [-321.562] (-325.436) (-322.830) (-321.430) -- 0:00:11
      750000 -- (-323.498) (-321.831) [-324.613] (-321.483) * (-323.626) (-322.747) [-322.199] (-320.895) -- 0:00:11

      Average standard deviation of split frequencies: 0.004187

      750500 -- (-323.411) (-324.462) [-324.778] (-323.410) * (-321.680) (-323.000) [-322.388] (-323.183) -- 0:00:11
      751000 -- (-321.739) [-324.101] (-323.613) (-322.222) * (-322.876) [-323.174] (-320.856) (-321.117) -- 0:00:11
      751500 -- [-324.940] (-327.187) (-322.937) (-322.122) * (-322.159) [-322.119] (-321.049) (-321.460) -- 0:00:11
      752000 -- (-322.886) [-321.088] (-327.385) (-324.527) * (-321.847) [-321.641] (-321.407) (-322.419) -- 0:00:11
      752500 -- (-324.360) [-324.439] (-325.547) (-323.915) * [-322.126] (-323.724) (-322.992) (-321.897) -- 0:00:11
      753000 -- (-324.799) (-327.347) (-325.053) [-323.263] * (-323.089) [-322.326] (-327.460) (-320.708) -- 0:00:11
      753500 -- (-322.156) [-322.719] (-322.456) (-322.927) * [-323.687] (-323.361) (-326.576) (-321.553) -- 0:00:11
      754000 -- (-322.069) (-322.719) [-322.852] (-324.584) * [-323.541] (-324.813) (-321.873) (-321.516) -- 0:00:11
      754500 -- (-323.738) (-323.234) [-321.593] (-321.705) * (-321.165) (-322.133) (-325.968) [-321.682] -- 0:00:11
      755000 -- (-321.947) (-322.196) [-322.479] (-323.047) * (-321.734) (-320.852) [-323.115] (-324.697) -- 0:00:11

      Average standard deviation of split frequencies: 0.004157

      755500 -- [-324.660] (-321.904) (-320.651) (-328.157) * (-321.397) (-321.208) (-326.890) [-322.027] -- 0:00:11
      756000 -- (-326.281) (-325.681) [-321.540] (-325.545) * (-322.051) (-321.749) (-321.486) [-326.732] -- 0:00:10
      756500 -- (-327.276) (-322.012) [-321.104] (-323.043) * [-322.934] (-320.798) (-322.561) (-323.593) -- 0:00:10
      757000 -- (-328.304) [-321.015] (-322.132) (-321.818) * [-324.188] (-321.899) (-322.090) (-324.252) -- 0:00:10
      757500 -- (-323.816) (-321.818) (-322.622) [-321.597] * (-326.268) (-321.801) (-323.929) [-321.563] -- 0:00:10
      758000 -- [-324.123] (-324.485) (-324.295) (-323.006) * (-322.153) (-321.382) (-322.028) [-324.360] -- 0:00:10
      758500 -- (-323.472) (-323.369) (-326.792) [-324.492] * [-321.326] (-322.295) (-322.671) (-324.135) -- 0:00:10
      759000 -- (-322.343) [-324.056] (-325.346) (-324.431) * (-320.634) (-324.669) (-325.821) [-321.011] -- 0:00:10
      759500 -- (-321.497) (-320.925) [-321.672] (-321.455) * (-321.368) (-328.877) [-322.166] (-322.046) -- 0:00:10
      760000 -- (-322.272) [-330.723] (-327.512) (-322.095) * (-325.453) (-320.970) [-321.608] (-322.514) -- 0:00:10

      Average standard deviation of split frequencies: 0.004132

      760500 -- [-322.842] (-322.339) (-326.848) (-324.545) * (-324.894) (-324.465) (-321.946) [-322.748] -- 0:00:10
      761000 -- (-324.980) (-321.429) (-322.201) [-322.501] * [-321.097] (-327.175) (-323.840) (-325.924) -- 0:00:10
      761500 -- [-322.158] (-321.308) (-325.732) (-324.556) * [-320.738] (-324.555) (-321.668) (-324.535) -- 0:00:10
      762000 -- (-321.375) [-321.209] (-322.739) (-324.097) * (-324.309) (-324.158) [-322.346] (-324.455) -- 0:00:10
      762500 -- (-322.995) [-321.790] (-321.156) (-321.908) * (-321.997) (-322.751) (-325.044) [-321.116] -- 0:00:10
      763000 -- [-321.731] (-327.146) (-329.574) (-324.947) * (-323.550) (-322.287) (-322.248) [-325.181] -- 0:00:10
      763500 -- (-322.207) [-320.942] (-325.547) (-327.015) * (-321.305) (-325.854) [-321.923] (-321.520) -- 0:00:10
      764000 -- [-323.009] (-323.085) (-324.227) (-323.858) * (-322.899) (-321.029) (-322.225) [-321.803] -- 0:00:10
      764500 -- [-321.656] (-321.872) (-321.097) (-324.315) * [-321.512] (-320.821) (-322.764) (-322.227) -- 0:00:10
      765000 -- [-324.084] (-326.624) (-328.079) (-323.276) * [-324.218] (-321.320) (-323.599) (-321.705) -- 0:00:10

      Average standard deviation of split frequencies: 0.004923

      765500 -- (-327.138) (-326.068) (-326.058) [-322.523] * (-321.747) (-324.785) [-321.763] (-327.274) -- 0:00:10
      766000 -- (-322.491) [-322.124] (-323.089) (-321.725) * [-322.564] (-321.393) (-326.456) (-323.665) -- 0:00:10
      766500 -- [-325.006] (-321.647) (-322.848) (-321.491) * (-321.266) [-322.443] (-326.741) (-321.697) -- 0:00:10
      767000 -- [-321.608] (-320.640) (-322.266) (-322.274) * (-320.944) [-321.146] (-320.868) (-322.272) -- 0:00:10
      767500 -- [-323.966] (-321.526) (-321.849) (-321.643) * (-321.679) [-321.253] (-326.112) (-321.622) -- 0:00:10
      768000 -- (-322.363) [-321.635] (-323.867) (-321.894) * [-322.866] (-323.418) (-323.126) (-324.501) -- 0:00:10
      768500 -- [-321.561] (-323.411) (-322.046) (-324.511) * [-321.259] (-321.897) (-323.386) (-322.421) -- 0:00:10
      769000 -- (-326.049) (-326.076) [-325.021] (-324.201) * (-322.480) [-323.708] (-323.681) (-325.412) -- 0:00:10
      769500 -- [-323.415] (-321.348) (-322.095) (-321.773) * (-325.694) (-322.474) [-323.323] (-324.794) -- 0:00:10
      770000 -- (-328.514) [-321.420] (-322.298) (-321.164) * (-323.405) (-325.204) (-322.814) [-325.135] -- 0:00:10

      Average standard deviation of split frequencies: 0.003670

      770500 -- [-323.780] (-320.824) (-323.595) (-322.735) * (-325.735) (-324.223) [-321.225] (-321.361) -- 0:00:10
      771000 -- (-326.018) (-320.787) (-322.972) [-322.119] * (-323.434) [-323.415] (-324.996) (-322.310) -- 0:00:10
      771500 -- (-322.720) (-321.675) [-323.195] (-321.062) * [-324.664] (-322.565) (-321.527) (-325.436) -- 0:00:10
      772000 -- (-325.866) (-322.398) (-321.698) [-323.147] * (-324.658) (-322.492) [-320.933] (-322.780) -- 0:00:10
      772500 -- [-321.956] (-329.243) (-321.656) (-323.854) * (-324.141) (-322.260) (-323.683) [-321.703] -- 0:00:10
      773000 -- (-324.958) (-324.538) [-322.926] (-325.970) * [-323.707] (-324.355) (-321.488) (-322.617) -- 0:00:10
      773500 -- (-321.461) (-322.450) (-321.867) [-321.923] * (-322.009) [-322.676] (-320.912) (-322.167) -- 0:00:10
      774000 -- (-321.866) [-326.489] (-322.617) (-324.029) * (-326.817) [-321.889] (-321.344) (-324.981) -- 0:00:10
      774500 -- (-323.747) [-323.959] (-322.440) (-322.215) * [-322.518] (-322.029) (-325.490) (-323.728) -- 0:00:10
      775000 -- (-324.866) [-321.412] (-322.471) (-323.078) * (-325.019) (-324.373) [-321.760] (-322.757) -- 0:00:10

      Average standard deviation of split frequencies: 0.003645

      775500 -- (-321.259) (-323.057) (-321.912) [-321.108] * (-322.881) (-324.573) [-321.367] (-326.525) -- 0:00:10
      776000 -- [-323.746] (-321.533) (-325.524) (-322.522) * (-321.727) (-325.766) (-325.343) [-323.254] -- 0:00:10
      776500 -- [-323.018] (-321.355) (-321.767) (-322.897) * (-324.382) (-321.121) (-324.653) [-321.872] -- 0:00:10
      777000 -- (-322.024) [-321.337] (-322.149) (-324.075) * (-323.553) [-323.614] (-323.624) (-322.510) -- 0:00:10
      777500 -- (-320.755) (-327.852) [-324.713] (-326.335) * (-320.977) (-322.321) (-325.316) [-323.083] -- 0:00:10
      778000 -- (-322.797) (-324.298) [-323.395] (-323.537) * (-321.487) (-323.427) (-322.492) [-321.955] -- 0:00:09
      778500 -- (-321.889) [-327.152] (-321.385) (-324.285) * (-323.063) [-323.317] (-324.495) (-323.782) -- 0:00:09
      779000 -- [-322.276] (-324.479) (-324.348) (-323.806) * [-321.311] (-325.879) (-326.488) (-322.695) -- 0:00:09
      779500 -- (-320.752) [-325.654] (-326.194) (-323.426) * (-323.559) (-324.866) (-322.868) [-328.414] -- 0:00:09
      780000 -- (-324.262) [-324.368] (-323.616) (-325.851) * (-328.701) (-325.622) (-320.478) [-323.068] -- 0:00:09

      Average standard deviation of split frequencies: 0.004026

      780500 -- (-322.746) [-324.228] (-324.514) (-323.949) * [-326.254] (-322.167) (-326.778) (-322.130) -- 0:00:09
      781000 -- [-324.623] (-321.411) (-324.657) (-321.048) * (-321.037) (-326.496) (-329.653) [-322.818] -- 0:00:09
      781500 -- (-324.749) (-324.138) [-321.080] (-322.655) * (-322.168) (-321.380) (-326.183) [-322.534] -- 0:00:09
      782000 -- (-327.358) [-321.293] (-320.923) (-322.977) * [-321.710] (-323.437) (-326.596) (-321.984) -- 0:00:09
      782500 -- (-324.763) (-324.753) (-321.712) [-322.403] * [-322.703] (-323.634) (-326.842) (-325.099) -- 0:00:09
      783000 -- (-323.504) [-321.521] (-328.234) (-324.485) * (-321.975) (-328.190) [-322.664] (-321.307) -- 0:00:09
      783500 -- (-324.297) (-321.726) [-322.631] (-323.101) * [-324.275] (-322.718) (-320.946) (-323.216) -- 0:00:09
      784000 -- (-326.487) [-320.722] (-323.842) (-321.761) * [-323.001] (-322.372) (-321.282) (-323.013) -- 0:00:09
      784500 -- (-322.680) [-321.638] (-322.576) (-322.274) * (-324.168) [-323.638] (-323.455) (-322.180) -- 0:00:09
      785000 -- (-321.320) (-323.961) (-327.689) [-321.920] * [-327.700] (-321.713) (-322.921) (-325.197) -- 0:00:09

      Average standard deviation of split frequencies: 0.003998

      785500 -- [-324.023] (-320.733) (-321.758) (-323.223) * [-321.737] (-323.755) (-321.979) (-321.824) -- 0:00:09
      786000 -- (-322.685) [-321.363] (-320.777) (-322.687) * (-323.168) (-322.795) (-325.042) [-324.901] -- 0:00:09
      786500 -- (-326.788) [-321.663] (-321.565) (-321.279) * (-326.537) (-322.293) [-323.350] (-323.328) -- 0:00:09
      787000 -- (-322.208) [-323.593] (-322.329) (-323.069) * (-323.972) (-326.132) (-323.309) [-325.561] -- 0:00:09
      787500 -- [-323.255] (-323.205) (-323.641) (-323.136) * [-322.565] (-321.355) (-321.081) (-321.117) -- 0:00:09
      788000 -- (-322.244) (-321.306) (-322.065) [-322.422] * (-323.188) (-320.706) (-321.605) [-320.796] -- 0:00:09
      788500 -- (-325.418) (-323.418) [-322.141] (-321.397) * (-322.008) (-324.623) (-323.248) [-323.940] -- 0:00:09
      789000 -- (-323.551) (-325.857) (-326.492) [-320.790] * (-323.567) (-321.703) (-322.385) [-327.076] -- 0:00:09
      789500 -- [-323.268] (-322.398) (-323.631) (-323.618) * (-324.381) [-320.765] (-322.689) (-322.033) -- 0:00:09
      790000 -- [-326.393] (-324.106) (-321.898) (-321.959) * [-326.351] (-322.212) (-321.533) (-323.320) -- 0:00:09

      Average standard deviation of split frequencies: 0.005167

      790500 -- (-322.683) (-322.525) [-322.667] (-326.307) * (-322.116) (-322.657) [-321.651] (-325.290) -- 0:00:09
      791000 -- [-322.391] (-321.942) (-321.166) (-326.380) * (-321.229) [-324.599] (-322.486) (-320.909) -- 0:00:09
      791500 -- (-324.963) (-322.794) [-321.706] (-322.773) * (-320.816) [-324.640] (-323.557) (-324.582) -- 0:00:09
      792000 -- (-323.306) (-327.532) (-321.809) [-322.156] * (-322.892) (-323.479) (-321.809) [-320.966] -- 0:00:09
      792500 -- (-325.243) (-325.858) [-321.501] (-320.912) * (-323.627) [-323.781] (-324.017) (-322.675) -- 0:00:09
      793000 -- [-322.735] (-325.029) (-325.185) (-325.128) * (-323.963) (-322.955) (-323.519) [-322.859] -- 0:00:09
      793500 -- (-321.649) (-320.704) [-323.768] (-322.192) * (-321.790) [-323.879] (-321.135) (-321.362) -- 0:00:09
      794000 -- (-323.882) [-321.052] (-323.090) (-323.222) * (-328.194) (-322.613) [-324.021] (-320.785) -- 0:00:09
      794500 -- (-325.185) [-321.903] (-321.359) (-321.597) * (-326.329) (-321.696) (-321.841) [-322.775] -- 0:00:09
      795000 -- (-325.234) (-323.366) (-321.039) [-322.512] * (-322.201) [-321.821] (-327.576) (-322.204) -- 0:00:09

      Average standard deviation of split frequencies: 0.005527

      795500 -- [-323.223] (-323.499) (-320.828) (-321.436) * (-320.967) (-323.339) (-330.658) [-324.102] -- 0:00:09
      796000 -- (-321.787) (-325.115) [-322.393] (-322.846) * (-321.273) (-322.104) [-324.299] (-325.444) -- 0:00:09
      796500 -- (-321.615) (-321.259) (-325.411) [-323.466] * (-320.484) (-322.739) (-322.959) [-324.110] -- 0:00:09
      797000 -- (-322.767) (-321.659) [-322.787] (-323.481) * (-321.951) (-322.877) (-327.881) [-322.426] -- 0:00:09
      797500 -- (-324.066) [-321.964] (-325.641) (-324.755) * [-323.659] (-320.471) (-324.340) (-327.585) -- 0:00:09
      798000 -- [-323.162] (-320.900) (-325.273) (-323.019) * (-323.146) (-321.078) [-324.282] (-323.431) -- 0:00:09
      798500 -- [-329.289] (-322.450) (-327.105) (-325.426) * [-327.166] (-324.112) (-324.066) (-323.527) -- 0:00:09
      799000 -- (-322.954) (-323.201) (-323.971) [-321.290] * (-331.096) (-320.452) (-325.066) [-325.544] -- 0:00:09
      799500 -- [-323.945] (-322.551) (-321.806) (-324.413) * (-323.995) (-322.639) (-324.069) [-322.581] -- 0:00:09
      800000 -- [-325.594] (-322.536) (-321.532) (-322.436) * [-321.371] (-323.976) (-321.860) (-321.632) -- 0:00:09

      Average standard deviation of split frequencies: 0.005495

      800500 -- (-324.820) [-321.655] (-321.376) (-321.612) * (-331.511) (-323.201) [-322.899] (-321.023) -- 0:00:08
      801000 -- [-323.345] (-322.348) (-323.209) (-322.230) * (-324.264) [-322.876] (-321.965) (-322.902) -- 0:00:08
      801500 -- (-322.808) [-322.802] (-323.953) (-322.912) * (-327.486) [-322.909] (-322.844) (-325.147) -- 0:00:08
      802000 -- (-322.750) [-323.476] (-323.489) (-324.642) * (-323.803) (-322.098) (-322.426) [-321.482] -- 0:00:08
      802500 -- [-323.532] (-322.117) (-322.364) (-322.798) * (-323.970) [-321.955] (-322.901) (-321.812) -- 0:00:08
      803000 -- [-322.272] (-323.142) (-323.425) (-324.637) * [-324.276] (-324.296) (-320.940) (-324.568) -- 0:00:08
      803500 -- [-321.712] (-325.062) (-322.008) (-326.636) * (-322.674) (-321.038) [-323.868] (-324.047) -- 0:00:08
      804000 -- [-322.438] (-323.108) (-320.477) (-321.730) * (-322.903) (-326.150) [-324.484] (-321.247) -- 0:00:08
      804500 -- (-323.156) (-321.075) [-322.664] (-322.730) * (-321.706) (-324.443) [-321.316] (-321.273) -- 0:00:08
      805000 -- (-324.694) [-325.102] (-325.355) (-323.258) * (-326.158) (-322.605) (-321.087) [-322.709] -- 0:00:08

      Average standard deviation of split frequencies: 0.005069

      805500 -- (-321.489) [-321.896] (-323.486) (-323.014) * [-323.315] (-321.494) (-324.246) (-323.284) -- 0:00:08
      806000 -- (-326.766) (-322.156) [-321.176] (-322.572) * (-323.409) (-322.431) [-321.680] (-322.164) -- 0:00:08
      806500 -- (-325.301) [-320.465] (-322.229) (-325.712) * (-329.176) (-323.186) [-321.811] (-323.932) -- 0:00:08
      807000 -- (-329.433) (-322.484) (-322.461) [-324.060] * (-322.891) [-323.199] (-321.873) (-326.433) -- 0:00:08
      807500 -- (-326.136) (-323.571) [-321.100] (-323.955) * (-322.643) (-326.165) (-321.632) [-324.330] -- 0:00:08
      808000 -- (-322.428) (-323.944) [-320.997] (-322.805) * (-322.644) (-321.524) [-322.875] (-322.514) -- 0:00:08
      808500 -- [-321.712] (-322.185) (-322.369) (-323.196) * (-324.282) (-323.463) [-322.736] (-322.169) -- 0:00:08
      809000 -- (-321.473) [-322.945] (-324.783) (-321.579) * [-321.391] (-322.405) (-321.809) (-321.624) -- 0:00:08
      809500 -- (-322.144) [-322.414] (-327.425) (-321.480) * (-321.820) [-320.830] (-321.266) (-323.196) -- 0:00:08
      810000 -- (-322.313) (-323.790) [-324.236] (-322.093) * (-322.741) (-322.477) (-327.694) [-323.036] -- 0:00:08

      Average standard deviation of split frequencies: 0.004652

      810500 -- (-322.640) (-323.916) [-323.574] (-321.540) * (-322.907) (-322.438) [-321.801] (-322.931) -- 0:00:08
      811000 -- [-322.712] (-322.060) (-324.555) (-322.705) * [-322.446] (-324.556) (-324.598) (-325.033) -- 0:00:08
      811500 -- [-323.242] (-323.692) (-322.244) (-323.258) * [-322.559] (-326.241) (-324.837) (-323.870) -- 0:00:08
      812000 -- [-322.430] (-323.718) (-326.683) (-325.679) * (-323.144) [-325.008] (-324.949) (-332.523) -- 0:00:08
      812500 -- (-321.810) (-322.007) (-323.605) [-322.976] * (-324.334) (-325.645) (-324.507) [-322.374] -- 0:00:08
      813000 -- [-322.573] (-324.058) (-322.087) (-327.168) * (-322.853) (-325.619) (-322.740) [-322.110] -- 0:00:08
      813500 -- (-322.249) (-328.351) (-321.843) [-323.480] * (-321.954) (-327.422) (-321.923) [-324.321] -- 0:00:08
      814000 -- (-324.322) [-321.806] (-324.532) (-324.097) * (-323.243) (-325.165) [-321.412] (-323.953) -- 0:00:08
      814500 -- (-321.901) (-324.767) [-321.926] (-321.720) * [-322.164] (-325.023) (-322.768) (-323.294) -- 0:00:08
      815000 -- [-323.652] (-325.024) (-321.507) (-321.535) * (-321.136) (-325.123) [-323.714] (-322.828) -- 0:00:08

      Average standard deviation of split frequencies: 0.003466

      815500 -- (-323.292) [-323.566] (-323.822) (-322.392) * (-323.905) (-323.722) (-321.647) [-321.168] -- 0:00:08
      816000 -- (-321.327) [-326.878] (-321.230) (-326.079) * (-325.320) (-324.494) [-321.018] (-324.376) -- 0:00:08
      816500 -- (-323.605) [-323.173] (-321.812) (-325.997) * (-323.721) (-324.364) [-320.785] (-322.107) -- 0:00:08
      817000 -- (-325.563) (-322.122) [-323.013] (-324.669) * (-325.858) (-320.993) [-324.115] (-324.318) -- 0:00:08
      817500 -- [-328.177] (-324.945) (-323.281) (-324.543) * (-321.955) (-323.594) (-326.978) [-321.108] -- 0:00:08
      818000 -- [-323.177] (-322.183) (-322.447) (-322.193) * (-323.022) (-325.363) (-321.278) [-326.041] -- 0:00:08
      818500 -- (-322.480) (-323.019) (-322.530) [-320.826] * (-323.037) (-322.696) [-321.813] (-321.263) -- 0:00:08
      819000 -- (-325.829) (-323.157) (-324.193) [-321.747] * [-323.464] (-323.714) (-320.948) (-326.020) -- 0:00:08
      819500 -- [-323.102] (-324.737) (-323.344) (-322.618) * (-322.573) (-324.810) (-323.474) [-322.278] -- 0:00:08
      820000 -- (-325.261) (-328.046) (-324.970) [-322.708] * (-325.529) (-321.869) (-324.167) [-322.949] -- 0:00:08

      Average standard deviation of split frequencies: 0.003064

      820500 -- (-321.477) (-322.491) [-322.033] (-321.411) * (-326.336) (-324.514) (-323.274) [-322.866] -- 0:00:08
      821000 -- (-321.678) [-324.071] (-322.320) (-321.360) * (-321.623) (-323.178) [-327.491] (-321.864) -- 0:00:08
      821500 -- [-325.571] (-322.373) (-322.128) (-321.152) * [-320.756] (-321.661) (-321.821) (-324.581) -- 0:00:08
      822000 -- (-321.407) (-322.462) (-323.093) [-321.264] * (-325.101) (-321.617) [-322.754] (-325.664) -- 0:00:08
      822500 -- (-326.778) [-323.159] (-321.783) (-321.749) * (-322.744) (-325.849) (-324.465) [-325.806] -- 0:00:07
      823000 -- [-322.690] (-325.974) (-322.854) (-322.571) * (-323.355) (-325.381) (-323.145) [-322.689] -- 0:00:07
      823500 -- (-321.998) (-323.984) (-324.251) [-322.215] * [-322.740] (-322.976) (-324.584) (-322.802) -- 0:00:07
      824000 -- (-322.102) [-320.740] (-322.873) (-323.349) * (-320.418) (-321.223) [-321.398] (-321.754) -- 0:00:07
      824500 -- [-321.065] (-323.365) (-327.673) (-322.350) * [-322.354] (-322.859) (-322.982) (-325.177) -- 0:00:07
      825000 -- (-325.381) (-326.271) [-321.640] (-324.582) * [-320.876] (-322.295) (-323.377) (-324.035) -- 0:00:07

      Average standard deviation of split frequencies: 0.003805

      825500 -- (-321.743) (-321.003) (-326.584) [-322.330] * (-325.762) (-325.522) [-322.303] (-327.535) -- 0:00:07
      826000 -- [-322.185] (-324.361) (-325.154) (-325.827) * (-322.477) (-322.254) [-323.611] (-327.549) -- 0:00:07
      826500 -- [-322.112] (-322.281) (-323.245) (-325.205) * (-321.964) (-324.123) [-322.874] (-325.975) -- 0:00:07
      827000 -- (-322.217) (-322.941) (-322.025) [-324.060] * (-323.074) (-323.661) (-324.617) [-323.970] -- 0:00:07
      827500 -- (-327.709) (-321.160) (-321.322) [-328.356] * [-322.960] (-322.651) (-326.530) (-324.347) -- 0:00:07
      828000 -- (-322.639) (-322.122) [-322.404] (-321.554) * (-323.056) (-322.633) [-321.295] (-321.741) -- 0:00:07
      828500 -- (-323.568) [-320.914] (-321.093) (-322.653) * (-322.489) (-326.400) [-321.831] (-327.696) -- 0:00:07
      829000 -- (-322.227) (-321.778) (-321.725) [-322.126] * [-322.974] (-321.702) (-321.895) (-321.690) -- 0:00:07
      829500 -- (-322.402) (-322.188) (-321.238) [-320.919] * (-320.960) [-321.274] (-322.770) (-326.575) -- 0:00:07
      830000 -- (-320.635) (-322.334) [-322.531] (-329.148) * (-322.430) (-321.285) (-322.374) [-321.669] -- 0:00:07

      Average standard deviation of split frequencies: 0.003027

      830500 -- (-321.081) [-323.411] (-323.497) (-328.790) * (-320.788) (-323.287) [-327.043] (-321.006) -- 0:00:07
      831000 -- (-320.737) (-323.322) (-321.516) [-320.906] * [-322.715] (-323.656) (-324.778) (-322.877) -- 0:00:07
      831500 -- (-321.222) [-322.613] (-324.385) (-321.434) * (-323.288) [-321.654] (-324.891) (-323.373) -- 0:00:07
      832000 -- (-322.551) [-323.513] (-324.340) (-320.922) * (-321.118) (-321.268) [-325.438] (-326.719) -- 0:00:07
      832500 -- (-324.098) [-324.207] (-323.021) (-321.511) * (-322.136) (-320.957) [-322.344] (-321.947) -- 0:00:07
      833000 -- (-320.459) [-323.696] (-323.212) (-321.503) * (-322.462) (-320.795) [-323.971] (-322.231) -- 0:00:07
      833500 -- (-326.488) (-323.861) (-321.609) [-322.271] * [-325.671] (-325.042) (-326.874) (-326.051) -- 0:00:07
      834000 -- (-322.217) [-323.367] (-323.643) (-322.716) * (-322.425) (-326.634) [-322.207] (-323.222) -- 0:00:07
      834500 -- (-328.791) [-322.549] (-322.181) (-322.405) * [-322.792] (-326.019) (-323.745) (-325.229) -- 0:00:07
      835000 -- [-322.792] (-322.436) (-325.794) (-323.715) * (-323.656) (-324.025) (-322.533) [-322.932] -- 0:00:07

      Average standard deviation of split frequencies: 0.001880

      835500 -- [-323.651] (-327.320) (-323.493) (-323.489) * [-321.169] (-325.609) (-323.000) (-326.510) -- 0:00:07
      836000 -- (-321.372) (-324.078) [-322.567] (-323.725) * (-325.608) (-322.253) [-322.038] (-323.999) -- 0:00:07
      836500 -- (-320.834) (-322.441) [-322.989] (-323.096) * [-324.652] (-323.533) (-323.498) (-321.998) -- 0:00:07
      837000 -- (-323.010) [-326.488] (-321.919) (-324.993) * (-325.122) [-326.350] (-322.803) (-325.045) -- 0:00:07
      837500 -- (-321.030) [-323.282] (-320.945) (-322.292) * (-320.963) (-328.310) (-320.993) [-324.429] -- 0:00:07
      838000 -- [-321.166] (-323.702) (-320.890) (-321.431) * (-321.951) (-323.601) (-321.007) [-321.132] -- 0:00:07
      838500 -- (-324.748) [-324.481] (-323.659) (-323.920) * (-321.656) (-324.271) (-321.148) [-322.453] -- 0:00:07
      839000 -- [-322.646] (-323.942) (-321.378) (-323.930) * (-321.589) (-325.260) (-326.830) [-325.541] -- 0:00:07
      839500 -- [-320.809] (-323.231) (-320.920) (-322.320) * (-325.201) [-321.902] (-329.773) (-323.424) -- 0:00:07
      840000 -- (-324.516) (-323.558) [-320.666] (-324.424) * (-322.852) [-321.723] (-326.034) (-323.123) -- 0:00:07

      Average standard deviation of split frequencies: 0.002243

      840500 -- (-325.941) (-323.605) [-321.263] (-327.513) * (-322.300) [-324.426] (-322.727) (-328.093) -- 0:00:07
      841000 -- (-322.282) (-325.711) (-325.817) [-321.204] * (-321.462) (-323.639) (-322.102) [-320.643] -- 0:00:07
      841500 -- (-321.252) (-326.690) [-323.722] (-326.442) * (-324.856) (-321.100) [-322.205] (-321.141) -- 0:00:07
      842000 -- [-323.674] (-327.034) (-321.386) (-322.054) * [-322.412] (-322.412) (-320.917) (-323.474) -- 0:00:07
      842500 -- (-324.644) (-322.651) (-325.082) [-321.577] * [-326.104] (-322.361) (-322.204) (-322.369) -- 0:00:07
      843000 -- [-326.452] (-322.132) (-324.583) (-321.957) * [-324.725] (-325.414) (-320.708) (-321.228) -- 0:00:07
      843500 -- (-326.953) (-322.600) [-323.057] (-322.239) * [-321.641] (-322.665) (-320.683) (-322.940) -- 0:00:07
      844000 -- (-322.276) (-323.042) [-322.996] (-326.573) * [-328.459] (-323.615) (-321.740) (-323.808) -- 0:00:07
      844500 -- (-323.357) (-330.301) [-321.876] (-321.521) * (-322.329) [-321.440] (-322.102) (-323.462) -- 0:00:06
      845000 -- (-322.449) (-321.711) (-326.322) [-322.731] * [-323.308] (-321.566) (-325.329) (-329.732) -- 0:00:06

      Average standard deviation of split frequencies: 0.002600

      845500 -- (-322.871) (-322.069) [-321.949] (-320.956) * (-322.390) (-322.571) [-322.095] (-323.795) -- 0:00:06
      846000 -- (-322.425) (-324.629) (-322.982) [-322.378] * (-321.525) [-321.121] (-325.803) (-323.987) -- 0:00:06
      846500 -- (-322.930) [-320.823] (-321.063) (-321.490) * (-321.348) [-326.074] (-320.661) (-322.149) -- 0:00:06
      847000 -- (-322.622) [-320.851] (-324.531) (-325.177) * (-322.418) (-324.019) [-320.817] (-323.401) -- 0:00:06
      847500 -- (-322.860) [-322.141] (-321.442) (-323.502) * [-320.419] (-322.029) (-321.405) (-326.816) -- 0:00:06
      848000 -- (-326.781) (-322.890) [-324.906] (-320.667) * (-320.768) (-323.882) [-321.571] (-322.437) -- 0:00:06
      848500 -- [-321.544] (-322.930) (-321.934) (-323.920) * (-321.948) [-322.152] (-323.676) (-323.528) -- 0:00:06
      849000 -- (-326.175) [-321.223] (-325.648) (-323.706) * (-322.999) [-321.719] (-322.593) (-325.175) -- 0:00:06
      849500 -- [-323.503] (-322.862) (-326.094) (-327.090) * (-326.964) (-320.889) [-321.708] (-322.222) -- 0:00:06
      850000 -- (-327.474) (-320.778) (-326.908) [-328.068] * [-321.820] (-324.215) (-325.366) (-324.473) -- 0:00:06

      Average standard deviation of split frequencies: 0.002586

      850500 -- (-324.931) (-321.751) (-322.596) [-320.751] * (-324.451) (-323.163) [-320.525] (-323.581) -- 0:00:06
      851000 -- (-324.319) [-322.393] (-321.849) (-321.584) * [-323.636] (-321.898) (-321.285) (-320.803) -- 0:00:06
      851500 -- (-325.379) [-322.534] (-324.164) (-321.823) * (-325.415) [-321.926] (-322.191) (-322.307) -- 0:00:06
      852000 -- (-325.792) (-322.452) [-322.637] (-322.740) * (-325.519) [-320.907] (-322.815) (-323.617) -- 0:00:06
      852500 -- (-322.729) (-324.178) [-320.867] (-322.471) * (-323.650) (-321.641) [-322.454] (-326.198) -- 0:00:06
      853000 -- (-324.177) [-323.349] (-324.552) (-322.653) * (-321.898) (-321.635) (-322.978) [-322.498] -- 0:00:06
      853500 -- (-321.245) [-322.114] (-321.639) (-320.812) * [-321.917] (-321.472) (-322.010) (-327.452) -- 0:00:06
      854000 -- [-320.706] (-322.678) (-321.424) (-322.735) * (-330.633) (-323.524) (-321.540) [-324.376] -- 0:00:06
      854500 -- [-321.395] (-321.708) (-321.279) (-323.732) * (-323.514) (-323.729) (-322.476) [-321.135] -- 0:00:06
      855000 -- (-324.852) [-322.714] (-324.513) (-324.581) * (-325.185) (-324.078) [-323.640] (-321.879) -- 0:00:06

      Average standard deviation of split frequencies: 0.002570

      855500 -- (-322.656) [-324.611] (-321.038) (-323.964) * (-325.319) (-323.053) (-321.059) [-324.486] -- 0:00:06
      856000 -- [-321.726] (-322.865) (-325.070) (-323.787) * (-325.128) (-322.806) (-327.894) [-326.470] -- 0:00:06
      856500 -- [-324.101] (-321.157) (-323.848) (-322.908) * (-322.087) (-324.477) (-325.378) [-322.686] -- 0:00:06
      857000 -- [-321.668] (-321.248) (-322.315) (-323.185) * [-322.966] (-324.200) (-320.761) (-326.180) -- 0:00:06
      857500 -- [-321.134] (-322.562) (-321.515) (-324.886) * [-321.831] (-322.920) (-322.654) (-324.183) -- 0:00:06
      858000 -- (-323.418) (-323.876) (-321.996) [-324.666] * [-321.182] (-320.752) (-320.874) (-326.405) -- 0:00:06
      858500 -- [-322.326] (-323.704) (-323.185) (-322.245) * (-322.192) [-322.890] (-321.974) (-324.293) -- 0:00:06
      859000 -- (-324.202) [-320.713] (-323.490) (-322.565) * (-323.679) [-321.131] (-323.746) (-325.784) -- 0:00:06
      859500 -- [-321.222] (-321.244) (-321.379) (-327.043) * (-324.138) [-320.586] (-323.462) (-321.489) -- 0:00:06
      860000 -- [-321.085] (-322.757) (-322.865) (-321.221) * (-322.490) [-322.353] (-324.408) (-323.272) -- 0:00:06

      Average standard deviation of split frequencies: 0.002921

      860500 -- (-322.832) (-321.720) [-320.873] (-323.096) * (-321.767) (-325.345) (-325.742) [-325.762] -- 0:00:06
      861000 -- (-325.112) [-323.397] (-320.872) (-322.309) * (-324.795) (-329.403) (-327.743) [-322.292] -- 0:00:06
      861500 -- (-321.776) (-324.681) (-321.899) [-325.123] * [-322.922] (-326.897) (-324.078) (-326.257) -- 0:00:06
      862000 -- (-325.702) (-323.129) [-321.121] (-325.471) * (-323.576) (-324.214) (-323.949) [-324.354] -- 0:00:06
      862500 -- (-325.371) [-321.225] (-323.336) (-323.584) * (-321.494) (-324.554) [-320.950] (-321.657) -- 0:00:06
      863000 -- (-323.358) (-322.828) [-324.872] (-324.054) * (-322.439) [-325.145] (-321.482) (-324.110) -- 0:00:06
      863500 -- [-321.595] (-323.910) (-322.304) (-322.246) * (-326.738) (-325.723) (-324.035) [-325.471] -- 0:00:06
      864000 -- (-320.822) (-321.355) [-322.256] (-324.216) * (-323.524) [-321.725] (-321.716) (-322.184) -- 0:00:06
      864500 -- [-321.775] (-323.871) (-324.999) (-322.538) * (-321.899) (-324.013) (-322.276) [-323.215] -- 0:00:06
      865000 -- (-321.617) (-324.762) (-323.626) [-321.683] * (-322.103) (-322.592) (-324.115) [-323.003] -- 0:00:06

      Average standard deviation of split frequencies: 0.002540

      865500 -- (-322.492) (-326.467) [-321.148] (-324.078) * (-322.715) (-322.652) (-321.151) [-322.394] -- 0:00:06
      866000 -- (-324.713) [-324.423] (-322.817) (-323.961) * (-324.392) (-321.393) (-323.692) [-322.599] -- 0:00:06
      866500 -- (-324.609) (-320.957) (-321.950) [-322.351] * (-322.072) (-321.516) (-320.700) [-323.852] -- 0:00:06
      867000 -- (-322.994) (-323.741) [-324.203] (-325.203) * (-323.131) [-324.345] (-321.626) (-324.958) -- 0:00:05
      867500 -- (-323.701) (-324.859) [-323.274] (-322.439) * (-322.205) [-324.835] (-324.109) (-325.300) -- 0:00:05
      868000 -- [-323.646] (-323.607) (-324.508) (-322.635) * (-322.018) (-324.773) (-323.746) [-321.545] -- 0:00:05
      868500 -- (-326.345) (-320.630) [-322.180] (-325.560) * (-323.943) [-324.508] (-325.749) (-324.479) -- 0:00:05
      869000 -- [-322.873] (-326.592) (-324.862) (-326.534) * [-322.980] (-323.945) (-325.126) (-321.416) -- 0:00:05
      869500 -- (-323.260) [-321.351] (-327.639) (-326.551) * (-325.069) (-321.517) (-321.295) [-322.807] -- 0:00:05
      870000 -- (-322.257) (-325.012) (-323.043) [-322.397] * (-323.102) (-321.284) [-321.482] (-322.089) -- 0:00:05

      Average standard deviation of split frequencies: 0.001444

      870500 -- [-322.592] (-326.565) (-321.409) (-321.396) * (-322.553) (-326.368) (-322.945) [-321.861] -- 0:00:05
      871000 -- (-322.102) [-323.634] (-324.133) (-330.342) * (-324.203) (-322.363) (-324.099) [-323.800] -- 0:00:05
      871500 -- [-322.119] (-325.409) (-328.990) (-322.028) * (-325.774) (-322.057) (-323.658) [-322.904] -- 0:00:05
      872000 -- [-322.052] (-321.515) (-323.336) (-321.259) * (-323.488) (-323.542) (-327.879) [-320.488] -- 0:00:05
      872500 -- (-323.255) (-321.504) [-323.313] (-324.264) * [-321.986] (-325.014) (-323.446) (-321.224) -- 0:00:05
      873000 -- (-326.959) (-321.647) [-321.384] (-322.586) * (-325.965) (-324.320) (-322.154) [-320.946] -- 0:00:05
      873500 -- [-320.955] (-327.341) (-320.815) (-324.923) * (-324.168) [-327.040] (-326.461) (-321.888) -- 0:00:05
      874000 -- (-324.177) [-324.415] (-321.291) (-327.284) * [-324.425] (-323.840) (-324.367) (-323.102) -- 0:00:05
      874500 -- (-321.686) (-323.735) (-321.480) [-320.840] * (-323.929) [-322.869] (-323.089) (-325.988) -- 0:00:05
      875000 -- (-322.776) (-323.925) [-325.579] (-321.911) * (-322.803) (-322.485) (-321.927) [-322.054] -- 0:00:05

      Average standard deviation of split frequencies: 0.002153

      875500 -- (-322.940) (-321.605) (-322.089) [-321.237] * (-322.336) (-321.710) (-322.405) [-321.654] -- 0:00:05
      876000 -- [-325.600] (-320.845) (-324.164) (-321.153) * (-323.053) (-320.717) (-322.596) [-323.842] -- 0:00:05
      876500 -- [-324.344] (-320.902) (-325.117) (-324.694) * (-321.918) [-325.411] (-321.986) (-323.738) -- 0:00:05
      877000 -- (-320.740) (-321.730) (-324.081) [-324.023] * [-321.269] (-323.911) (-321.328) (-324.014) -- 0:00:05
      877500 -- (-321.807) (-323.820) (-326.151) [-325.943] * (-321.284) (-322.114) [-321.685] (-322.184) -- 0:00:05
      878000 -- (-322.255) (-324.314) (-322.589) [-324.331] * (-325.500) (-323.939) [-322.022] (-320.859) -- 0:00:05
      878500 -- [-321.267] (-324.519) (-321.848) (-321.127) * (-326.289) (-320.554) (-324.002) [-321.454] -- 0:00:05
      879000 -- [-320.915] (-321.232) (-324.448) (-322.140) * (-326.458) [-322.582] (-323.782) (-323.645) -- 0:00:05
      879500 -- (-322.824) [-321.723] (-323.229) (-322.510) * (-322.711) (-323.804) (-325.210) [-322.494] -- 0:00:05
      880000 -- (-324.054) (-322.206) (-325.003) [-321.563] * (-322.922) [-322.477] (-320.634) (-326.072) -- 0:00:05

      Average standard deviation of split frequencies: 0.002855

      880500 -- (-323.120) (-321.311) (-323.665) [-322.371] * (-322.438) (-321.167) [-321.474] (-321.975) -- 0:00:05
      881000 -- (-322.644) (-323.909) [-321.296] (-322.605) * (-323.024) [-321.369] (-321.170) (-323.405) -- 0:00:05
      881500 -- [-320.746] (-324.513) (-320.807) (-325.010) * (-322.093) [-324.902] (-320.457) (-323.728) -- 0:00:05
      882000 -- (-321.734) [-324.799] (-322.172) (-321.523) * (-323.093) (-321.391) [-320.521] (-321.359) -- 0:00:05
      882500 -- (-320.719) (-322.665) [-321.083] (-324.290) * (-323.577) [-321.503] (-324.626) (-322.055) -- 0:00:05
      883000 -- [-323.459] (-322.325) (-323.934) (-327.726) * (-322.985) (-322.059) (-322.111) [-321.693] -- 0:00:05
      883500 -- (-322.207) (-323.593) [-323.072] (-321.926) * (-331.096) (-321.567) [-324.202] (-322.738) -- 0:00:05
      884000 -- (-325.973) [-321.603] (-324.697) (-323.612) * (-327.497) (-326.009) (-324.679) [-322.573] -- 0:00:05
      884500 -- (-321.808) [-321.528] (-321.610) (-322.473) * (-322.815) (-322.605) (-323.095) [-321.986] -- 0:00:05
      885000 -- (-323.412) [-321.390] (-330.393) (-324.360) * (-323.739) (-322.623) (-322.423) [-321.232] -- 0:00:05

      Average standard deviation of split frequencies: 0.002483

      885500 -- [-323.357] (-323.782) (-324.236) (-323.221) * (-322.392) [-323.583] (-320.871) (-321.820) -- 0:00:05
      886000 -- (-323.015) [-327.037] (-325.631) (-321.446) * (-322.459) (-325.136) [-321.536] (-324.483) -- 0:00:05
      886500 -- [-324.153] (-328.213) (-325.348) (-324.338) * [-320.422] (-323.977) (-322.950) (-322.368) -- 0:00:05
      887000 -- (-323.807) (-320.483) [-323.983] (-323.177) * (-325.271) (-322.799) [-321.190] (-322.236) -- 0:00:05
      887500 -- (-325.100) (-324.695) (-322.205) [-321.672] * (-323.120) (-321.747) (-323.469) [-326.848] -- 0:00:05
      888000 -- (-326.325) (-325.373) [-321.292] (-322.653) * (-325.182) (-321.600) (-327.300) [-322.625] -- 0:00:05
      888500 -- [-323.580] (-322.591) (-323.867) (-322.038) * (-322.067) (-322.802) (-323.488) [-321.814] -- 0:00:05
      889000 -- (-321.290) (-323.779) [-323.778] (-322.710) * (-321.539) [-324.591] (-321.778) (-325.349) -- 0:00:04
      889500 -- [-321.912] (-322.700) (-321.346) (-323.715) * [-321.257] (-322.158) (-325.002) (-326.676) -- 0:00:04
      890000 -- (-321.141) (-323.480) (-321.721) [-322.147] * (-323.595) [-325.780] (-321.275) (-321.783) -- 0:00:04

      Average standard deviation of split frequencies: 0.002823

      890500 -- [-324.190] (-321.740) (-321.501) (-322.445) * (-320.773) (-321.904) [-321.683] (-321.901) -- 0:00:04
      891000 -- [-324.388] (-321.993) (-321.573) (-323.191) * (-323.123) (-323.706) (-324.214) [-328.161] -- 0:00:04
      891500 -- (-324.914) [-324.642] (-321.370) (-325.056) * (-321.826) [-321.488] (-321.871) (-321.656) -- 0:00:04
      892000 -- (-324.627) [-322.233] (-322.480) (-322.384) * [-321.143] (-324.365) (-321.892) (-322.297) -- 0:00:04
      892500 -- (-323.151) [-322.726] (-322.065) (-321.186) * [-322.522] (-323.324) (-327.309) (-321.140) -- 0:00:04
      893000 -- (-323.703) [-323.782] (-323.689) (-324.536) * (-324.965) (-322.163) (-327.058) [-325.946] -- 0:00:04
      893500 -- (-322.766) [-321.251] (-323.222) (-325.487) * (-323.168) [-322.553] (-321.608) (-323.064) -- 0:00:04
      894000 -- [-324.001] (-321.830) (-322.407) (-323.055) * (-322.913) (-324.521) [-321.768] (-321.107) -- 0:00:04
      894500 -- (-321.524) (-323.645) (-321.667) [-326.948] * (-329.416) (-322.285) [-321.750] (-322.713) -- 0:00:04
      895000 -- (-323.621) (-323.012) [-321.702] (-323.789) * (-326.632) [-323.383] (-324.704) (-322.034) -- 0:00:04

      Average standard deviation of split frequencies: 0.002104

      895500 -- [-324.090] (-322.376) (-322.562) (-325.646) * (-321.523) (-321.406) (-322.134) [-322.165] -- 0:00:04
      896000 -- (-322.213) (-321.302) [-325.544] (-324.646) * (-321.419) (-322.209) (-321.450) [-321.363] -- 0:00:04
      896500 -- (-321.932) (-321.651) (-324.571) [-320.588] * [-321.550] (-322.105) (-323.011) (-323.344) -- 0:00:04
      897000 -- (-322.130) [-322.240] (-324.885) (-322.709) * [-322.422] (-322.953) (-323.350) (-322.322) -- 0:00:04
      897500 -- (-320.974) [-322.906] (-324.051) (-321.066) * (-323.537) (-326.310) (-321.324) [-327.218] -- 0:00:04
      898000 -- (-325.365) (-329.375) [-321.851] (-321.277) * (-323.970) [-320.854] (-322.653) (-321.668) -- 0:00:04
      898500 -- [-321.382] (-324.747) (-324.611) (-320.667) * (-322.472) (-320.926) [-323.283] (-324.680) -- 0:00:04
      899000 -- (-324.361) (-325.351) (-329.296) [-321.515] * [-327.542] (-324.460) (-322.194) (-324.803) -- 0:00:04
      899500 -- (-323.147) [-323.644] (-328.474) (-323.468) * (-325.390) (-327.631) [-322.858] (-323.011) -- 0:00:04
      900000 -- [-321.975] (-328.668) (-322.167) (-330.512) * (-322.744) [-328.270] (-321.749) (-320.985) -- 0:00:04

      Average standard deviation of split frequencies: 0.002094

      900500 -- (-325.222) (-323.333) [-321.060] (-323.199) * (-321.141) (-324.952) [-322.799] (-322.431) -- 0:00:04
      901000 -- (-324.905) (-323.763) [-323.976] (-324.082) * (-320.733) (-323.588) [-323.634] (-321.892) -- 0:00:04
      901500 -- [-324.657] (-324.270) (-322.434) (-326.591) * (-321.762) (-323.242) (-322.145) [-321.599] -- 0:00:04
      902000 -- (-325.524) [-323.510] (-327.080) (-326.376) * (-321.585) [-323.661] (-326.174) (-323.108) -- 0:00:04
      902500 -- (-321.432) (-320.703) (-332.673) [-321.281] * (-323.005) [-323.316] (-328.519) (-321.906) -- 0:00:04
      903000 -- (-324.797) [-324.888] (-327.288) (-325.157) * (-322.245) [-323.074] (-326.955) (-323.130) -- 0:00:04
      903500 -- (-321.442) (-324.528) [-323.545] (-322.586) * (-322.472) (-321.163) [-323.012] (-324.361) -- 0:00:04
      904000 -- (-323.411) [-323.322] (-322.708) (-328.121) * (-322.706) (-322.307) (-324.441) [-324.096] -- 0:00:04
      904500 -- (-325.916) (-321.249) (-322.109) [-324.946] * (-324.606) [-322.133] (-323.326) (-322.565) -- 0:00:04
      905000 -- (-326.852) (-322.469) [-321.962] (-322.183) * (-329.727) (-321.390) [-325.432] (-321.470) -- 0:00:04

      Average standard deviation of split frequencies: 0.003469

      905500 -- (-327.863) (-323.306) (-320.433) [-324.373] * (-322.276) (-323.609) (-324.625) [-320.781] -- 0:00:04
      906000 -- (-321.062) (-324.004) (-321.169) [-324.725] * (-322.113) [-325.607] (-325.406) (-322.019) -- 0:00:04
      906500 -- (-322.468) (-323.246) [-321.078] (-321.217) * [-322.632] (-323.069) (-323.934) (-324.030) -- 0:00:04
      907000 -- [-322.064] (-323.234) (-322.161) (-321.404) * (-328.528) [-322.960] (-322.787) (-328.111) -- 0:00:04
      907500 -- (-321.738) (-322.797) (-323.247) [-320.697] * (-324.412) (-322.241) [-323.470] (-326.362) -- 0:00:04
      908000 -- [-325.817] (-323.179) (-321.209) (-321.125) * (-323.701) [-323.323] (-323.928) (-323.335) -- 0:00:04
      908500 -- (-324.365) (-320.786) (-321.082) [-322.933] * (-322.475) (-320.861) [-325.384] (-324.423) -- 0:00:04
      909000 -- (-322.763) (-321.622) (-321.539) [-321.892] * (-326.405) (-322.479) [-322.500] (-321.678) -- 0:00:04
      909500 -- [-322.583] (-323.184) (-325.758) (-320.910) * (-322.036) (-323.429) (-323.293) [-321.327] -- 0:00:04
      910000 -- [-321.036] (-324.399) (-321.981) (-325.312) * (-321.396) (-321.113) (-323.987) [-322.978] -- 0:00:04

      Average standard deviation of split frequencies: 0.005176

      910500 -- (-321.809) (-322.180) (-325.506) [-321.544] * [-323.642] (-322.701) (-322.922) (-321.192) -- 0:00:04
      911000 -- (-328.547) [-320.632] (-322.798) (-322.031) * (-322.938) (-321.986) [-325.889] (-321.096) -- 0:00:04
      911500 -- (-321.733) (-322.952) [-322.570] (-322.032) * (-322.174) (-322.509) [-321.783] (-323.586) -- 0:00:03
      912000 -- [-324.574] (-323.419) (-321.847) (-321.823) * (-320.415) [-323.197] (-323.144) (-325.055) -- 0:00:03
      912500 -- (-323.307) (-323.548) (-322.436) [-323.191] * (-323.081) (-322.982) (-323.848) [-322.328] -- 0:00:03
      913000 -- (-321.568) (-325.490) [-322.288] (-325.015) * (-323.511) (-323.176) [-323.342] (-324.846) -- 0:00:03
      913500 -- (-321.830) (-321.641) (-327.678) [-322.447] * [-321.133] (-322.698) (-321.450) (-324.460) -- 0:00:03
      914000 -- (-326.693) (-323.421) (-326.397) [-325.673] * [-321.330] (-323.859) (-324.650) (-321.312) -- 0:00:03
      914500 -- (-325.366) [-322.378] (-322.826) (-323.153) * (-322.103) (-324.617) (-321.638) [-320.744] -- 0:00:03
      915000 -- [-325.089] (-323.778) (-323.860) (-324.057) * (-324.511) (-320.750) [-320.990] (-321.765) -- 0:00:03

      Average standard deviation of split frequencies: 0.004460

      915500 -- (-321.409) (-323.627) (-321.376) [-323.396] * (-321.013) (-321.101) (-327.674) [-321.803] -- 0:00:03
      916000 -- (-323.330) (-323.009) (-321.707) [-322.448] * (-321.697) [-325.658] (-323.959) (-323.666) -- 0:00:03
      916500 -- (-323.449) (-323.303) (-322.125) [-321.713] * (-321.720) (-322.992) [-323.688] (-323.391) -- 0:00:03
      917000 -- (-326.845) (-322.488) [-322.621] (-323.800) * (-323.459) [-325.020] (-323.473) (-321.497) -- 0:00:03
      917500 -- (-324.309) [-321.983] (-322.525) (-324.310) * (-323.027) (-324.555) (-321.549) [-324.299] -- 0:00:03
      918000 -- (-325.249) (-322.576) (-324.101) [-322.522] * (-322.151) (-324.098) [-322.840] (-322.016) -- 0:00:03
      918500 -- (-323.882) (-327.289) (-322.387) [-324.117] * (-322.601) (-321.829) (-323.137) [-321.399] -- 0:00:03
      919000 -- (-324.897) [-324.186] (-324.498) (-322.437) * [-322.686] (-322.530) (-322.401) (-329.158) -- 0:00:03
      919500 -- (-325.931) (-326.973) (-321.582) [-321.205] * (-321.817) (-323.230) (-325.297) [-322.058] -- 0:00:03
      920000 -- (-324.015) [-323.415] (-320.885) (-324.336) * (-326.149) [-323.957] (-322.889) (-322.343) -- 0:00:03

      Average standard deviation of split frequencies: 0.004096

      920500 -- (-322.544) [-321.168] (-322.695) (-324.836) * [-323.668] (-325.668) (-324.877) (-325.181) -- 0:00:03
      921000 -- (-324.650) (-322.772) (-323.665) [-324.095] * (-326.104) (-320.738) [-322.955] (-321.140) -- 0:00:03
      921500 -- (-326.067) (-323.402) [-323.170] (-322.202) * (-323.195) [-322.151] (-322.406) (-324.589) -- 0:00:03
      922000 -- (-324.482) (-321.367) (-321.863) [-323.426] * (-321.115) [-321.926] (-324.341) (-321.094) -- 0:00:03
      922500 -- (-325.152) [-321.250] (-321.677) (-324.408) * (-321.513) (-325.606) (-324.554) [-326.362] -- 0:00:03
      923000 -- [-322.738] (-321.305) (-323.327) (-328.873) * (-320.800) [-322.907] (-322.696) (-321.183) -- 0:00:03
      923500 -- (-323.686) (-322.460) [-322.935] (-321.273) * [-323.874] (-322.370) (-323.005) (-321.649) -- 0:00:03
      924000 -- (-321.469) (-321.922) (-324.512) [-321.524] * (-321.012) (-321.215) (-321.303) [-321.566] -- 0:00:03
      924500 -- (-324.343) (-320.896) [-323.880] (-320.920) * (-321.862) [-321.067] (-321.228) (-323.030) -- 0:00:03
      925000 -- (-322.116) (-325.738) (-324.919) [-320.891] * [-322.771] (-322.443) (-321.245) (-324.014) -- 0:00:03

      Average standard deviation of split frequencies: 0.004412

      925500 -- (-322.060) (-325.786) (-325.483) [-321.189] * (-321.226) (-323.063) [-321.541] (-321.432) -- 0:00:03
      926000 -- (-322.105) (-324.437) (-321.399) [-321.617] * [-322.408] (-323.665) (-322.683) (-323.158) -- 0:00:03
      926500 -- (-322.185) [-322.577] (-322.351) (-321.300) * (-321.738) [-322.717] (-322.817) (-325.129) -- 0:00:03
      927000 -- [-322.324] (-321.549) (-327.254) (-322.455) * (-322.509) (-323.289) [-321.445] (-321.652) -- 0:00:03
      927500 -- [-321.279] (-321.838) (-327.169) (-322.042) * (-324.441) (-321.464) (-321.229) [-323.037] -- 0:00:03
      928000 -- (-322.504) (-324.108) (-326.009) [-322.736] * (-323.567) (-324.352) (-322.730) [-321.335] -- 0:00:03
      928500 -- (-323.630) (-321.482) (-322.368) [-322.637] * (-322.180) (-324.118) (-322.714) [-322.058] -- 0:00:03
      929000 -- (-326.736) (-323.887) [-323.323] (-328.734) * (-321.426) (-323.285) (-322.891) [-322.255] -- 0:00:03
      929500 -- [-324.289] (-321.555) (-330.275) (-322.828) * (-322.483) [-322.968] (-321.379) (-322.589) -- 0:00:03
      930000 -- [-325.117] (-321.155) (-323.381) (-322.488) * (-323.057) [-326.376] (-321.265) (-321.771) -- 0:00:03

      Average standard deviation of split frequencies: 0.004052

      930500 -- (-322.073) (-325.793) [-321.655] (-322.318) * (-324.086) (-321.211) [-321.014] (-321.756) -- 0:00:03
      931000 -- (-328.205) (-326.336) (-321.174) [-322.886] * [-323.502] (-322.183) (-323.907) (-321.318) -- 0:00:03
      931500 -- (-324.171) (-327.222) (-324.119) [-323.206] * (-322.152) [-322.311] (-322.900) (-322.727) -- 0:00:03
      932000 -- (-320.778) (-322.241) (-322.077) [-321.157] * (-323.388) [-325.856] (-324.016) (-326.925) -- 0:00:03
      932500 -- (-323.456) [-322.924] (-329.448) (-323.490) * (-321.381) (-322.061) [-322.437] (-322.124) -- 0:00:03
      933000 -- (-325.289) [-321.309] (-323.868) (-323.099) * (-321.638) (-325.361) (-322.700) [-321.261] -- 0:00:03
      933500 -- (-328.702) (-322.614) (-323.669) [-323.026] * (-324.169) [-322.980] (-322.952) (-327.181) -- 0:00:02
      934000 -- (-323.440) (-328.396) (-321.504) [-322.232] * (-322.856) [-323.555] (-320.886) (-326.049) -- 0:00:02
      934500 -- (-321.875) (-322.262) [-323.200] (-325.000) * (-324.291) (-321.444) [-321.916] (-327.178) -- 0:00:02
      935000 -- [-322.476] (-323.882) (-321.373) (-321.656) * (-326.234) [-321.842] (-322.837) (-323.335) -- 0:00:02

      Average standard deviation of split frequencies: 0.003358

      935500 -- (-322.546) [-320.851] (-321.949) (-324.890) * (-321.288) (-323.928) (-324.370) [-321.757] -- 0:00:02
      936000 -- (-323.931) [-322.847] (-321.364) (-322.263) * (-324.762) (-322.012) [-322.276] (-322.387) -- 0:00:02
      936500 -- (-326.155) [-323.723] (-322.794) (-321.850) * (-323.013) [-321.438] (-321.432) (-320.717) -- 0:00:02
      937000 -- (-323.270) (-321.609) (-326.352) [-320.912] * [-323.074] (-322.182) (-321.807) (-324.923) -- 0:00:02
      937500 -- (-320.461) (-321.172) [-320.845] (-323.765) * (-323.336) [-325.216] (-321.940) (-321.693) -- 0:00:02
      938000 -- (-324.550) (-323.451) (-321.992) [-322.421] * [-320.630] (-327.677) (-322.891) (-322.098) -- 0:00:02
      938500 -- (-320.816) [-321.986] (-325.344) (-320.972) * [-322.353] (-327.369) (-324.316) (-321.127) -- 0:00:02
      939000 -- [-323.946] (-322.869) (-323.353) (-322.269) * (-321.891) [-322.672] (-322.411) (-322.914) -- 0:00:02
      939500 -- (-321.262) (-321.061) [-322.860] (-322.726) * (-324.165) [-322.365] (-323.892) (-325.706) -- 0:00:02
      940000 -- (-320.723) [-323.774] (-323.628) (-324.997) * (-325.292) (-326.360) (-324.866) [-323.675] -- 0:00:02

      Average standard deviation of split frequencies: 0.005345

      940500 -- (-321.143) (-322.665) (-321.298) [-322.355] * (-323.089) [-321.367] (-321.586) (-323.471) -- 0:00:02
      941000 -- (-323.093) [-323.599] (-320.693) (-324.741) * [-320.653] (-321.884) (-324.151) (-322.681) -- 0:00:02
      941500 -- (-327.367) (-322.368) [-320.807] (-322.807) * [-320.540] (-324.922) (-322.845) (-324.302) -- 0:00:02
      942000 -- [-321.821] (-322.029) (-322.171) (-324.246) * (-320.965) [-321.397] (-321.876) (-323.170) -- 0:00:02
      942500 -- (-321.123) [-322.622] (-322.042) (-321.169) * (-323.740) [-322.701] (-321.675) (-320.555) -- 0:00:02
      943000 -- (-323.616) (-322.906) [-323.732] (-321.888) * (-323.255) (-322.492) (-320.950) [-324.486] -- 0:00:02
      943500 -- (-326.765) (-321.351) (-322.914) [-320.514] * (-322.825) [-321.813] (-321.189) (-320.716) -- 0:00:02
      944000 -- [-329.590] (-323.151) (-323.841) (-320.697) * (-325.414) (-321.515) [-321.200] (-321.500) -- 0:00:02
      944500 -- (-324.891) [-320.575] (-320.637) (-324.728) * (-323.821) [-321.040] (-325.204) (-324.787) -- 0:00:02
      945000 -- (-323.513) [-321.776] (-323.412) (-322.583) * (-323.501) (-323.212) [-321.899] (-322.627) -- 0:00:02

      Average standard deviation of split frequencies: 0.005315

      945500 -- (-328.781) (-324.599) (-321.834) [-322.070] * (-323.057) (-322.445) (-321.922) [-323.751] -- 0:00:02
      946000 -- [-325.683] (-324.331) (-322.081) (-321.157) * (-322.802) (-321.368) (-322.214) [-323.029] -- 0:00:02
      946500 -- (-322.359) (-323.150) [-324.135] (-323.893) * (-324.826) (-322.518) [-322.943] (-323.428) -- 0:00:02
      947000 -- (-322.262) [-322.542] (-323.884) (-327.102) * (-322.596) (-326.418) [-322.633] (-323.123) -- 0:00:02
      947500 -- (-320.770) [-325.345] (-323.049) (-323.981) * [-323.385] (-324.773) (-322.973) (-324.717) -- 0:00:02
      948000 -- (-321.488) (-322.981) [-322.764] (-321.353) * (-323.132) (-325.170) (-324.423) [-322.787] -- 0:00:02
      948500 -- (-321.703) (-322.655) (-324.308) [-326.484] * (-322.917) [-321.693] (-322.050) (-323.907) -- 0:00:02
      949000 -- (-324.470) (-322.486) [-323.435] (-324.235) * (-322.839) (-321.922) (-321.025) [-325.363] -- 0:00:02
      949500 -- (-320.617) (-327.491) (-323.420) [-324.939] * (-325.299) [-322.822] (-323.691) (-322.969) -- 0:00:02
      950000 -- [-321.606] (-322.137) (-321.797) (-324.257) * [-322.015] (-324.095) (-321.294) (-321.130) -- 0:00:02

      Average standard deviation of split frequencies: 0.005950

      950500 -- (-320.980) [-324.964] (-321.858) (-323.483) * [-323.137] (-322.167) (-322.968) (-323.569) -- 0:00:02
      951000 -- [-321.293] (-321.363) (-322.351) (-323.052) * (-327.969) (-322.361) [-321.297] (-320.926) -- 0:00:02
      951500 -- (-322.219) (-321.017) [-321.115] (-324.198) * (-323.876) (-323.614) [-324.793] (-323.275) -- 0:00:02
      952000 -- (-323.830) (-323.713) [-320.990] (-321.127) * (-324.106) (-321.755) (-325.332) [-325.090] -- 0:00:02
      952500 -- (-322.628) (-322.807) (-321.212) [-322.071] * (-326.113) (-320.628) (-321.340) [-321.650] -- 0:00:02
      953000 -- (-326.514) (-322.835) [-321.818] (-324.559) * (-321.952) [-321.544] (-322.762) (-321.135) -- 0:00:02
      953500 -- [-323.402] (-322.817) (-322.799) (-322.027) * [-321.098] (-322.202) (-323.269) (-321.070) -- 0:00:02
      954000 -- (-322.426) (-325.882) (-321.229) [-324.101] * (-322.563) (-320.577) (-322.978) [-323.126] -- 0:00:02
      954500 -- (-322.312) (-322.308) (-327.334) [-320.444] * (-321.864) [-323.533] (-323.697) (-323.594) -- 0:00:02
      955000 -- (-323.370) (-323.498) (-325.898) [-321.818] * [-321.681] (-323.675) (-324.257) (-323.390) -- 0:00:02

      Average standard deviation of split frequencies: 0.006246

      955500 -- (-324.165) (-321.293) (-321.258) [-324.340] * (-321.020) (-321.002) [-322.375] (-321.544) -- 0:00:02
      956000 -- (-322.264) (-324.026) (-323.224) [-323.995] * (-321.486) (-322.095) [-322.995] (-322.600) -- 0:00:01
      956500 -- (-323.284) (-321.283) [-323.146] (-324.338) * (-329.162) [-323.949] (-321.679) (-326.730) -- 0:00:01
      957000 -- (-326.788) [-321.324] (-323.957) (-326.730) * (-321.982) [-323.832] (-324.585) (-327.593) -- 0:00:01
      957500 -- (-324.888) (-324.854) (-326.230) [-322.023] * (-321.608) (-324.296) (-322.664) [-325.530] -- 0:00:01
      958000 -- (-323.486) (-324.498) (-321.905) [-321.048] * (-321.788) [-323.257] (-323.311) (-323.513) -- 0:00:01
      958500 -- [-323.156] (-322.780) (-321.581) (-322.872) * [-322.605] (-323.123) (-321.970) (-325.275) -- 0:00:01
      959000 -- (-321.598) (-323.012) (-324.039) [-323.390] * [-324.073] (-321.460) (-320.799) (-322.384) -- 0:00:01
      959500 -- (-324.811) (-321.961) (-321.875) [-323.476] * (-322.535) [-322.559] (-320.657) (-327.958) -- 0:00:01
      960000 -- (-322.554) [-323.665] (-321.943) (-324.069) * (-321.660) [-321.588] (-321.451) (-324.571) -- 0:00:01

      Average standard deviation of split frequencies: 0.006543

      960500 -- (-324.488) [-323.397] (-323.430) (-326.474) * (-326.327) (-323.251) (-321.544) [-322.751] -- 0:00:01
      961000 -- (-322.759) [-322.684] (-323.473) (-321.342) * [-322.228] (-324.289) (-320.877) (-321.924) -- 0:00:01
      961500 -- (-321.675) [-326.624] (-324.714) (-322.263) * (-325.374) [-321.836] (-329.002) (-326.352) -- 0:00:01
      962000 -- [-321.521] (-322.969) (-321.398) (-323.139) * (-322.372) [-322.222] (-322.078) (-326.250) -- 0:00:01
      962500 -- (-325.695) [-323.507] (-322.932) (-325.424) * [-322.662] (-323.526) (-323.617) (-321.134) -- 0:00:01
      963000 -- (-324.540) (-323.507) (-320.664) [-327.885] * (-324.025) (-322.999) (-325.988) [-323.976] -- 0:00:01
      963500 -- (-322.960) (-325.074) [-320.515] (-323.704) * (-320.751) (-325.486) [-322.697] (-323.162) -- 0:00:01
      964000 -- (-325.491) [-325.779] (-324.846) (-322.366) * [-322.468] (-321.432) (-331.277) (-322.562) -- 0:00:01
      964500 -- (-325.405) [-322.058] (-324.505) (-320.979) * (-323.621) [-326.749] (-324.948) (-325.745) -- 0:00:01
      965000 -- (-322.600) (-322.796) (-322.520) [-322.353] * (-324.074) (-325.857) [-322.682] (-323.011) -- 0:00:01

      Average standard deviation of split frequencies: 0.006832

      965500 -- (-323.751) [-321.786] (-327.574) (-325.735) * (-322.258) (-320.993) (-323.925) [-321.011] -- 0:00:01
      966000 -- [-324.790] (-324.327) (-326.871) (-326.105) * [-323.119] (-323.801) (-322.713) (-322.412) -- 0:00:01
      966500 -- (-322.576) (-321.669) [-323.096] (-320.829) * [-324.181] (-322.305) (-323.290) (-321.526) -- 0:00:01
      967000 -- (-322.163) [-321.719] (-322.493) (-323.258) * (-323.868) (-322.708) [-320.965] (-322.598) -- 0:00:01
      967500 -- [-320.880] (-322.903) (-325.542) (-322.686) * (-323.890) (-322.082) (-322.568) [-321.152] -- 0:00:01
      968000 -- [-323.571] (-323.931) (-323.158) (-321.720) * (-322.319) (-324.230) [-321.879] (-325.398) -- 0:00:01
      968500 -- (-321.327) (-323.648) [-323.410] (-321.070) * (-323.285) [-322.378] (-326.001) (-322.621) -- 0:00:01
      969000 -- (-322.987) [-320.777] (-324.709) (-320.800) * [-321.010] (-321.830) (-325.083) (-323.893) -- 0:00:01
      969500 -- (-321.267) [-323.725] (-323.532) (-321.705) * (-325.396) (-322.777) [-324.442] (-322.759) -- 0:00:01
      970000 -- (-321.766) (-323.191) [-324.116] (-325.679) * (-327.517) (-322.215) (-323.652) [-322.495] -- 0:00:01

      Average standard deviation of split frequencies: 0.007447

      970500 -- (-322.325) (-321.962) [-322.327] (-322.842) * [-324.939] (-321.847) (-320.909) (-320.681) -- 0:00:01
      971000 -- (-326.710) (-321.941) [-321.192] (-324.175) * [-322.884] (-321.222) (-321.730) (-321.615) -- 0:00:01
      971500 -- (-323.045) [-323.007] (-321.353) (-321.368) * (-322.612) (-322.392) [-321.944] (-321.319) -- 0:00:01
      972000 -- (-329.740) (-323.636) (-321.935) [-323.492] * [-321.534] (-321.575) (-323.488) (-324.581) -- 0:00:01
      972500 -- (-327.861) (-322.829) [-321.381] (-325.385) * (-321.347) (-322.879) (-323.337) [-321.616] -- 0:00:01
      973000 -- [-324.242] (-323.266) (-321.132) (-322.786) * [-323.532] (-322.774) (-320.861) (-321.619) -- 0:00:01
      973500 -- (-321.998) (-325.892) (-321.808) [-322.763] * (-327.163) (-321.321) [-321.619] (-323.598) -- 0:00:01
      974000 -- (-323.507) (-323.673) [-321.164] (-326.604) * (-324.780) (-322.745) [-322.747] (-321.368) -- 0:00:01
      974500 -- (-327.411) (-323.764) (-322.624) [-321.190] * (-329.813) [-322.210] (-322.016) (-322.107) -- 0:00:01
      975000 -- [-322.955] (-324.114) (-322.956) (-322.983) * (-324.041) (-322.330) [-323.499] (-322.157) -- 0:00:01

      Average standard deviation of split frequencies: 0.008050

      975500 -- (-323.036) (-323.426) (-324.637) [-320.716] * (-326.715) (-322.889) (-322.797) [-324.128] -- 0:00:01
      976000 -- (-322.308) (-322.251) (-324.222) [-322.998] * (-322.495) (-321.942) [-322.448] (-322.475) -- 0:00:01
      976500 -- (-321.969) [-321.925] (-324.433) (-327.812) * (-328.540) (-322.710) (-323.117) [-323.528] -- 0:00:01
      977000 -- (-322.555) (-327.899) [-325.220] (-321.575) * (-323.319) [-321.992] (-322.220) (-321.794) -- 0:00:01
      977500 -- (-326.173) (-324.516) [-323.229] (-321.149) * (-320.663) [-323.552] (-322.973) (-329.208) -- 0:00:01
      978000 -- [-322.350] (-324.329) (-322.394) (-321.740) * (-323.354) [-323.941] (-324.247) (-322.753) -- 0:00:00
      978500 -- [-322.322] (-325.956) (-321.627) (-323.702) * (-321.177) (-323.327) (-321.574) [-324.327] -- 0:00:00
      979000 -- (-321.147) (-322.688) (-322.150) [-321.130] * (-320.937) (-325.660) (-323.112) [-321.679] -- 0:00:00
      979500 -- [-324.316] (-321.985) (-322.727) (-321.024) * (-322.332) [-321.233] (-327.045) (-322.021) -- 0:00:00
      980000 -- [-325.486] (-322.927) (-324.476) (-322.007) * (-322.937) (-324.586) (-322.854) [-324.196] -- 0:00:00

      Average standard deviation of split frequencies: 0.007691

      980500 -- [-324.759] (-326.590) (-326.446) (-321.641) * (-322.757) (-321.955) [-322.185] (-321.637) -- 0:00:00
      981000 -- (-321.484) (-324.763) [-322.555] (-321.681) * [-322.602] (-324.066) (-322.028) (-321.905) -- 0:00:00
      981500 -- (-321.620) (-323.370) [-323.665] (-321.246) * (-323.774) [-323.422] (-330.664) (-321.992) -- 0:00:00
      982000 -- (-322.610) [-322.873] (-326.336) (-322.240) * (-322.346) [-321.631] (-324.439) (-322.472) -- 0:00:00
      982500 -- (-321.010) [-321.361] (-322.188) (-327.211) * (-322.095) (-322.096) [-324.329] (-321.152) -- 0:00:00
      983000 -- [-321.341] (-323.753) (-322.489) (-323.299) * (-322.455) [-322.924] (-321.786) (-322.864) -- 0:00:00
      983500 -- (-321.492) (-322.392) [-322.589] (-323.027) * [-323.644] (-321.624) (-320.766) (-324.512) -- 0:00:00
      984000 -- (-321.421) (-325.552) (-323.341) [-321.726] * (-323.749) (-326.176) (-322.784) [-321.944] -- 0:00:00
      984500 -- [-321.510] (-323.922) (-322.877) (-321.868) * (-324.021) [-323.782] (-322.060) (-323.290) -- 0:00:00
      985000 -- (-322.444) (-323.398) (-326.275) [-321.915] * (-321.357) (-322.025) [-321.898] (-324.327) -- 0:00:00

      Average standard deviation of split frequencies: 0.007650

      985500 -- [-326.563] (-322.310) (-321.673) (-323.912) * [-321.228] (-325.790) (-325.254) (-323.032) -- 0:00:00
      986000 -- [-322.331] (-323.258) (-323.188) (-323.036) * (-321.278) [-323.446] (-324.064) (-324.240) -- 0:00:00
      986500 -- [-323.322] (-323.221) (-323.403) (-320.842) * [-323.430] (-321.579) (-322.781) (-325.926) -- 0:00:00
      987000 -- (-324.894) (-324.173) (-321.221) [-321.875] * (-325.980) (-323.370) (-322.853) [-324.498] -- 0:00:00
      987500 -- (-324.428) (-323.281) (-322.008) [-320.895] * (-322.270) [-322.234] (-322.170) (-323.335) -- 0:00:00
      988000 -- (-324.419) [-322.001] (-324.193) (-321.519) * (-321.690) (-322.372) (-324.906) [-325.742] -- 0:00:00
      988500 -- (-327.533) [-321.812] (-326.083) (-321.345) * (-326.735) [-322.021] (-323.985) (-328.904) -- 0:00:00
      989000 -- (-323.759) [-324.120] (-324.270) (-324.301) * [-320.693] (-321.908) (-321.311) (-321.179) -- 0:00:00
      989500 -- (-325.796) [-321.754] (-321.799) (-325.319) * [-325.972] (-323.923) (-324.545) (-327.313) -- 0:00:00
      990000 -- [-330.956] (-322.885) (-324.422) (-322.086) * (-322.834) [-323.138] (-322.129) (-322.426) -- 0:00:00

      Average standard deviation of split frequencies: 0.008248

      990500 -- (-323.930) (-321.945) (-322.168) [-322.942] * (-321.097) (-323.240) [-324.745] (-321.486) -- 0:00:00
      991000 -- (-323.508) [-321.953] (-322.810) (-324.248) * (-321.003) (-323.460) [-324.259] (-323.935) -- 0:00:00
      991500 -- (-321.842) (-321.310) (-324.680) [-321.394] * (-327.328) (-323.960) (-327.842) [-321.605] -- 0:00:00
      992000 -- [-324.526] (-321.399) (-332.688) (-322.352) * (-328.634) (-322.269) (-322.859) [-323.015] -- 0:00:00
      992500 -- [-321.137] (-324.392) (-325.118) (-321.651) * [-324.856] (-322.347) (-323.239) (-325.567) -- 0:00:00
      993000 -- [-321.264] (-321.931) (-324.300) (-322.113) * (-324.941) [-322.658] (-320.517) (-321.575) -- 0:00:00
      993500 -- (-322.810) (-322.605) (-325.800) [-322.802] * (-321.567) [-321.819] (-321.128) (-326.388) -- 0:00:00
      994000 -- [-325.203] (-323.432) (-322.829) (-322.938) * (-323.251) (-324.933) (-323.135) [-320.908] -- 0:00:00
      994500 -- (-323.901) (-322.525) [-322.343] (-330.591) * (-325.160) [-321.755] (-321.195) (-323.199) -- 0:00:00
      995000 -- (-324.760) [-321.007] (-322.210) (-326.188) * (-321.548) (-321.784) [-321.719] (-321.700) -- 0:00:00

      Average standard deviation of split frequencies: 0.007888

      995500 -- (-323.211) (-326.845) (-321.877) [-323.273] * (-322.448) (-324.562) [-322.430] (-324.046) -- 0:00:00
      996000 -- (-321.668) (-321.878) [-321.562] (-322.235) * (-329.671) (-324.176) (-321.981) [-322.591] -- 0:00:00
      996500 -- [-322.363] (-322.362) (-323.949) (-322.356) * [-322.408] (-323.891) (-325.777) (-324.995) -- 0:00:00
      997000 -- [-321.576] (-320.705) (-321.408) (-323.767) * (-324.013) [-322.080] (-325.126) (-320.973) -- 0:00:00
      997500 -- (-321.496) [-322.803] (-322.290) (-326.891) * (-324.774) [-322.099] (-320.777) (-326.523) -- 0:00:00
      998000 -- (-323.817) [-321.687] (-323.186) (-321.236) * (-323.826) [-322.987] (-321.684) (-328.460) -- 0:00:00
      998500 -- (-322.707) (-323.079) [-321.916] (-322.732) * [-321.649] (-326.413) (-323.908) (-324.438) -- 0:00:00
      999000 -- [-323.059] (-322.508) (-322.664) (-327.275) * (-326.697) (-326.859) (-322.165) [-323.019] -- 0:00:00
      999500 -- (-325.471) (-321.647) [-322.275] (-324.251) * (-324.030) (-323.106) [-323.514] (-323.844) -- 0:00:00
      1000000 -- (-325.016) (-322.335) (-325.878) [-323.220] * (-321.873) (-323.755) (-322.543) [-323.837] -- 0:00:00

      Average standard deviation of split frequencies: 0.008166

      Analysis completed in 45 seconds
      Analysis used 43.39 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -320.36
      Likelihood of best state for "cold" chain of run 2 was -320.36

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            74.5 %     ( 57 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            41.7 %     ( 33 %)     Dirichlet(Pi{all})
            38.2 %     ( 20 %)     Slider(Pi{all})
            71.3 %     ( 33 %)     Multiplier(Alpha{1,2})
            70.0 %     ( 32 %)     Multiplier(Alpha{3})
            27.3 %     ( 28 %)     Slider(Pinvar{all})
            99.9 %     (100 %)     NNI(Tau{all},V{all})
            73.7 %     ( 77 %)     ParsSPR(Tau{all},V{all})
            27.6 %     ( 20 %)     Multiplier(V{all})
            97.4 %     (100 %)     Nodeslider(V{all})
            32.0 %     ( 22 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            73.9 %     ( 63 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            41.1 %     ( 31 %)     Dirichlet(Pi{all})
            38.9 %     ( 34 %)     Slider(Pi{all})
            71.5 %     ( 33 %)     Multiplier(Alpha{1,2})
            69.5 %     ( 31 %)     Multiplier(Alpha{3})
            27.4 %     ( 23 %)     Slider(Pinvar{all})
            99.9 %     (100 %)     NNI(Tau{all},V{all})
            73.7 %     ( 69 %)     ParsSPR(Tau{all},V{all})
            27.7 %     ( 29 %)     Multiplier(V{all})
            97.4 %     ( 98 %)     Nodeslider(V{all})
            32.0 %     ( 21 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.84    0.70    0.58 
         2 |  166487            0.85    0.72 
         3 |  166139  166977            0.86 
         4 |  167036  166828  166533         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.84    0.69    0.57 
         2 |  166986            0.85    0.72 
         3 |  166469  166693            0.86 
         4 |  166941  166283  166628         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -322.06
      |          1         2           2                           |
      |                                                  2         |
      |               2                                            |
      |2                     11       1        2      111    12    |
      |  12 1    2  2      1   2     1    2 2   2            2     |
      |       1 1 1  2    2 2     1      1         *   2       12 1|
      |  2   1         2           2            11  2 2     2  2112|
      |     22 *          1  2 1*2  2 2  2    1   1       111      |
      | 1  1        1 1 1   1       1      1 2      1*   1       2 |
      |1      2      1 1 1       121    * 1 1           2          |
      |    2    2 2     22           2     2 1 1          2   1    |
      |                       2        1      2                    |
      |            2                             2         2       |
      | 2          1                              2                |
      |   1                                                        |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -323.76
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -322.05          -326.42
        2       -322.11          -325.58
      --------------------------------------
      TOTAL     -322.08          -326.09
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.492384    0.049085    0.111649    0.918190    0.460304   1501.00   1501.00    1.000
      r(A<->C){all}   0.160370    0.019466    0.000001    0.442189    0.124547    268.49    287.60    1.000
      r(A<->G){all}   0.172695    0.020356    0.000034    0.457872    0.136214    309.43    364.98    1.000
      r(A<->T){all}   0.165308    0.019764    0.000007    0.452955    0.128975    213.27    311.52    1.006
      r(C<->G){all}   0.164070    0.020387    0.000040    0.456697    0.122524    391.76    397.53    1.000
      r(C<->T){all}   0.164476    0.018929    0.000044    0.449293    0.128260    253.13    362.65    1.000
      r(G<->T){all}   0.173081    0.021315    0.000027    0.466261    0.135325    350.80    362.93    1.003
      pi(A){all}      0.180659    0.000616    0.134134    0.231639    0.179772   1374.04   1437.52    1.000
      pi(C){all}      0.336348    0.000903    0.281970    0.398958    0.336122   1216.14   1314.14    1.000
      pi(G){all}      0.318938    0.000905    0.261873    0.379277    0.318382   1390.71   1445.86    1.000
      pi(T){all}      0.164055    0.000563    0.118878    0.210361    0.162674   1400.89   1412.39    1.000
      alpha{1,2}      0.405426    0.216082    0.000159    1.330127    0.234933   1328.81   1393.74    1.000
      alpha{3}        0.453299    0.223251    0.000123    1.428646    0.301880   1163.76   1317.27    1.000
      pinvar{all}     0.992195    0.000101    0.974261    0.999996    0.995419   1305.39   1403.19    1.001
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4

   Key to taxon bipartitions (saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ----------
    1 -- .***
    2 -- .*..
    3 -- ..*.
    4 -- ...*
    5 -- ..**
    6 -- .*.*
    7 -- .**.
   ----------

   Summary statistics for informative taxon bipartitions
      (saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    5  1040    0.346436    0.009422    0.339773    0.353098    2
    6   984    0.327781    0.012248    0.319121    0.336442    2
    7   978    0.325783    0.002827    0.323784    0.327781    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/data/5res/ML1010/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                               95% HPD Interval
                                             --------------------
   Parameter          Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   ------------------------------------------------------------------------------------------
   length{all}[1]    0.095165    0.008916    0.000031    0.281533    0.065433    1.001    2
   length{all}[2]    0.098016    0.009372    0.000027    0.294413    0.067870    1.000    2
   length{all}[3]    0.101039    0.010889    0.000010    0.311671    0.069917    1.000    2
   length{all}[4]    0.097657    0.009946    0.000008    0.298855    0.066470    1.000    2
   length{all}[5]    0.098982    0.009634    0.000091    0.290691    0.066852    0.999    2
   length{all}[6]    0.098195    0.010600    0.000081    0.283187    0.065520    0.999    2
   length{all}[7]    0.104455    0.010332    0.000071    0.318341    0.075684    0.999    2
   ------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.008166
       Maximum standard deviation of split frequencies = 0.012248
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.001


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------------------------------------------------------------------ C2 (2)
   +                                                                               
   |------------------------------------------------------------------------ C3 (3)
   |                                                                               
   \------------------------------------------------------------------------ C4 (4)
                                                                                   

   Phylogram (based on average branch lengths):

   /------------------------------------------------------------------- C1 (1)
   |                                                                               
   |---------------------------------------------------------------------- C2 (2)
   +                                                                               
   |------------------------------------------------------------------------ C3 (3)
   |                                                                               
   \-------------------------------------------------------------------- C4 (4)
                                                                                   
   |---------| 0.010 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (3 trees sampled):
      50 % credible set contains 2 trees
      90 % credible set contains 3 trees
      95 % credible set contains 3 trees
      99 % credible set contains 3 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.9h, March 2018

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  7  8

seq file is not paml/phylip format.  Trying nexus format.ns = 4  	ls = 240
Reading sequences, sequential format..
Reading seq # 1: C1       
Reading seq # 2: C2       
Reading seq # 3: C3       
Reading seq # 4: C4       
Sequences read..
Counting site patterns..  0:00

Compressing,     41 patterns at     80 /     80 sites (100.0%),  0:00

Collecting fpatt[] & pose[],     41 patterns at     80 /     80 sites (100.0%),  0:00
Counting codons..

       48 bytes for distance
    40016 bytes for conP
     3608 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 2, 3, 4);   MP score: 0
    0.059602    0.080421    0.042611    0.010136    0.300000    1.300000

ntime & nrate & np:     4     2     6

Bounds (np=6):
   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =     6
lnL0 =  -329.669148

Iterating by ming2
Initial: fx=   329.669148
x=  0.05960  0.08042  0.04261  0.01014  0.30000  1.30000

  1 h-m-p  0.0000 0.0001 156.4826 ++      326.517660  m 0.0001    11 | 1/6
  2 h-m-p  0.0007 0.0151  23.8339 -----------..  | 1/6
  3 h-m-p  0.0000 0.0004 135.4507 +++     318.887461  m 0.0004    39 | 2/6
  4 h-m-p  0.0026 0.0215  17.3375 ------------..  | 2/6
  5 h-m-p  0.0000 0.0002 111.0766 +++     316.198020  m 0.0002    68 | 3/6
  6 h-m-p  0.0016 0.0374  10.7803 -----------..  | 3/6
  7 h-m-p  0.0000 0.0003  78.6391 +++     314.539193  m 0.0003    96 | 4/6
  8 h-m-p  1.6000 8.0000   0.0000 ++      314.539193  m 8.0000   105 | 4/6
  9 h-m-p  0.3276 8.0000   0.0000 -Y      314.539193  0 0.0205   117 | 4/6
 10 h-m-p  0.0160 8.0000   0.0001 -------------..  | 4/6
 11 h-m-p  0.0160 8.0000   0.0000 +++++   314.539193  m 8.0000   153 | 4/6
 12 h-m-p  0.0020 0.9980   1.9490 ---------Y   314.539193  0 0.0000   173 | 4/6
 13 h-m-p  0.0160 8.0000   0.0000 +++++   314.539193  m 8.0000   185 | 4/6
 14 h-m-p  0.0072 3.6208   0.4404 +++++   314.539182  m 3.6208   199 | 5/6
 15 h-m-p  1.6000 8.0000   0.6463 ++      314.539177  m 8.0000   210 | 5/6
 16 h-m-p  1.6000 8.0000   0.9044 ++      314.539176  m 8.0000   220 | 5/6
 17 h-m-p  1.6000 8.0000   2.9532 ++      314.539175  m 8.0000   230 | 5/6
 18 h-m-p  1.6000 8.0000   8.4549 ++      314.539175  m 8.0000   239 | 5/6
 19 h-m-p  1.6000 8.0000   6.0778 ++      314.539174  m 8.0000   248 | 5/6
 20 h-m-p  0.4956 2.4782  62.6097 ---------C   314.539174  0 0.0000   266 | 5/6
 21 h-m-p  1.6000 8.0000   0.0000 ----C   314.539174  0 0.0016   279 | 5/6
 22 h-m-p  0.7071 8.0000   0.0000 ---------N   314.539174  0 0.0000   298
Out..
lnL  =  -314.539174
299 lfun, 299 eigenQcodon, 1196 P(t)

Time used:  0:00


Model 1: NearlyNeutral

TREE #  1
(1, 2, 3, 4);   MP score: 0
    0.096545    0.011264    0.090281    0.062220    0.000100    0.875439    0.574855

ntime & nrate & np:     4     2     7

Bounds (np=7):
   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 11.186087

np =     7
lnL0 =  -334.938215

Iterating by ming2
Initial: fx=   334.938215
x=  0.09655  0.01126  0.09028  0.06222  0.00011  0.87544  0.57486

  1 h-m-p  0.0000 0.0000 155.4073 ++      334.590940  m 0.0000    12 | 1/7
  2 h-m-p  0.0001 0.0038  43.3139 ++++    331.214199  m 0.0038    24 | 2/7
  3 h-m-p  0.0005 0.0027 165.4523 ++      320.013233  m 0.0027    34 | 3/7
  4 h-m-p  0.0000 0.0002 560.1004 ++      315.170374  m 0.0002    44 | 4/7
  5 h-m-p  0.0003 0.0015  41.9602 ++      315.112910  m 0.0015    54 | 4/7
  6 h-m-p  0.0002 0.0042 268.8767 ----------..  | 4/7
  7 h-m-p  0.0000 0.0001  79.0550 ++      314.539200  m 0.0001    82 | 5/7
  8 h-m-p  0.3131 8.0000   0.0000 +++     314.539200  m 8.0000    93 | 5/7
  9 h-m-p  0.0510 8.0000   0.0004 ++++    314.539200  m 8.0000   107 | 5/7
 10 h-m-p  0.0028 0.0139   0.2488 --------C   314.539200  0 0.0000   127 | 5/7
 11 h-m-p  0.0160 8.0000   0.0000 ----N   314.539200  0 0.0000   143 | 5/7
 12 h-m-p  0.0038 1.8777   0.5466 +++++   314.539193  m 1.8777   158 | 6/7
 13 h-m-p  1.6000 8.0000   0.0000 N       314.539193  0 1.6000   170 | 6/7
 14 h-m-p  0.0160 8.0000   0.0000 Y       314.539193  0 0.0160   181
Out..
lnL  =  -314.539193
182 lfun, 546 eigenQcodon, 1456 P(t)

Time used:  0:01


Model 2: PositiveSelection

TREE #  1
(1, 2, 3, 4);   MP score: 0
    0.063482    0.072842    0.030736    0.106595    0.000100    1.109540    0.423163    0.113056  168.721369

ntime & nrate & np:     4     3     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 0.363803

np =     9
lnL0 =  -326.061374

Iterating by ming2
Initial: fx=   326.061374
x=  0.06348  0.07284  0.03074  0.10660  0.00011  1.10954  0.42316  0.11306 168.72137

  1 h-m-p  0.0000 0.0000  42.3746 ++      326.043278  m 0.0000    14 | 1/9
  2 h-m-p  0.0003 0.1486   7.7350 +++++   319.277411  m