--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:06:30 GMT 2020
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=500000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=1250
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=1250
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/8res/ML2199/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -410.71 -414.95
2 -410.71 -415.95
--------------------------------------
TOTAL -410.71 -415.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891595 0.086694 0.389599 1.476849 0.871692 736.90 743.95 1.000
r(A<->C){all} 0.165012 0.017422 0.000191 0.423813 0.135443 57.53 86.04 0.999
r(A<->G){all} 0.173203 0.019967 0.000106 0.467606 0.134661 126.06 167.40 1.000
r(A<->T){all} 0.177602 0.022238 0.000176 0.486647 0.138969 51.66 155.17 1.012
r(C<->G){all} 0.150010 0.016769 0.000050 0.405511 0.119989 82.30 118.21 1.004
r(C<->T){all} 0.172007 0.018404 0.000044 0.435323 0.143001 128.94 184.46 0.999
r(G<->T){all} 0.162166 0.017377 0.000141 0.412029 0.133751 53.29 81.75 1.027
pi(A){all} 0.200783 0.000517 0.158132 0.247094 0.200021 713.39 715.23 1.002
pi(C){all} 0.297059 0.000742 0.243247 0.346549 0.296551 603.39 672.05 0.999
pi(G){all} 0.308385 0.000726 0.258925 0.360285 0.308398 625.16 681.91 1.000
pi(T){all} 0.193774 0.000555 0.152500 0.244594 0.192467 647.61 694.76 1.001
alpha{1,2} 0.389153 0.196845 0.000187 1.309811 0.236156 501.25 511.62 1.001
alpha{3} 0.457442 0.259130 0.000266 1.493053 0.282043 301.34 431.00 0.999
pinvar{all} 0.994569 0.000047 0.982502 0.999985 0.996859 349.67 514.07 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -392.231659
Model 2: PositiveSelection -392.231659
Model 0: one-ratio -392.231751
Model 3: discrete -392.231659
Model 7: beta -392.23173
Model 8: beta&w>1 -392.231659
Model 0 vs 1 1.83999999990192E-4
Model 2 vs 1 0.0
Model 8 vs 7 1.4200000009623182E-4
>C1
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C2
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C3
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C4
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C5
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C6
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=100
C1 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C2 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C3 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C4 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C5 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C6 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
**************************************************
C1 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C2 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C3 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C4 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C5 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C6 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
**************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.alnset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
set
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 100 type PROTEIN Struct Unchecked
Input File input.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 100 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3000]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3000]--->[3000]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.454 Mb, Max= 30.625 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C2 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C3 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C4 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C5 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
C6 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
**************************************************
C1 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C2 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C3 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C4 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C5 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
C6 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
**************************************************
FORMAT of file input.prot.fasta.clustalw2_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.clustalw2_rs_0_0.fasta.aln I:96 S:100 BS:97
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
C2 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
C3 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
C4 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
C5 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
C6 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
**************************************************
C1 CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
C2 CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
C3 CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
C4 CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
C5 CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
C6 CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
**************************************************
C1 CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
C2 CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
C3 CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
C4 CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
C5 CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
C6 CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
**************************************************
C1 GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
C2 GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
C3 GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
C4 GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
C5 GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
C6 GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
**************************************************
C1 GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
C2 GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
C3 GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
C4 GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
C5 GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
C6 GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
**************************************************
C1 TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
C2 TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
C3 TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
C4 TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
C5 TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
C6 TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
**************************************************
>C1
ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
>C2
ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
>C3
ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
>C4
ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
>C5
ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
>C6
ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT
CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG
CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG
GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC
GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA
TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
>C1
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C2
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C3
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C4
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C5
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
>C6
MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 300 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856739
Setting output file names to "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 874644221
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 500000
Running Markov chain
MCMC stamp = 5027309855
Seed = 1738784078
Swapseed = 1579856739
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -671.414382 -- -24.965149
Chain 2 -- -671.414382 -- -24.965149
Chain 3 -- -671.414344 -- -24.965149
Chain 4 -- -671.414280 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -671.414344 -- -24.965149
Chain 2 -- -671.414382 -- -24.965149
Chain 3 -- -671.414382 -- -24.965149
Chain 4 -- -671.414382 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (500000 generations requested):
0 -- [-671.414] (-671.414) (-671.414) (-671.414) * [-671.414] (-671.414) (-671.414) (-671.414)
500 -- (-427.790) [-430.656] (-417.607) (-416.396) * (-421.108) (-413.786) [-414.783] (-421.353) -- 0:00:00
1000 -- [-415.169] (-415.421) (-418.815) (-428.201) * [-414.116] (-423.168) (-418.323) (-423.212) -- 0:08:19
1500 -- (-424.362) (-417.569) [-414.108] (-417.937) * (-417.482) (-426.975) [-419.603] (-423.400) -- 0:05:32
2000 -- (-417.804) (-421.591) [-417.362] (-424.980) * (-417.100) (-419.534) [-415.651] (-418.897) -- 0:04:09
2500 -- (-417.620) (-423.401) (-419.821) [-426.823] * (-423.459) (-423.026) (-428.119) [-419.559] -- 0:03:19
3000 -- (-428.001) (-423.746) (-416.512) [-417.411] * (-420.344) [-420.392] (-421.968) (-427.480) -- 0:02:45
3500 -- (-418.380) (-424.154) [-420.833] (-422.130) * (-420.379) [-419.897] (-418.152) (-420.069) -- 0:02:21
4000 -- (-425.560) (-419.170) [-424.893] (-420.506) * (-417.514) (-424.597) (-421.631) [-421.696] -- 0:02:04
4500 -- [-417.953] (-420.589) (-422.432) (-416.317) * [-419.061] (-418.309) (-420.401) (-412.952) -- 0:01:50
5000 -- (-419.499) [-419.882] (-422.232) (-416.666) * [-415.823] (-432.838) (-426.494) (-415.845) -- 0:01:39
Average standard deviation of split frequencies: 0.082703
5500 -- (-421.234) (-426.072) (-420.862) [-423.401] * (-418.960) (-432.533) [-417.930] (-416.813) -- 0:01:29
6000 -- (-425.345) [-414.380] (-421.126) (-423.603) * (-421.291) (-425.656) (-422.666) [-418.782] -- 0:01:22
6500 -- (-420.593) (-415.245) (-425.065) [-429.978] * (-414.022) (-423.975) (-432.693) [-418.230] -- 0:01:15
7000 -- (-420.877) (-417.972) (-421.039) [-424.715] * (-418.454) (-411.647) [-419.950] (-421.237) -- 0:01:10
7500 -- (-417.222) (-421.391) [-416.437] (-426.953) * [-415.889] (-411.758) (-414.082) (-415.315) -- 0:01:05
8000 -- (-416.505) (-423.457) (-424.765) [-423.251] * [-419.736] (-411.344) (-412.062) (-418.093) -- 0:01:01
8500 -- (-425.057) (-422.918) [-421.625] (-426.456) * (-424.779) (-411.131) [-413.568] (-417.252) -- 0:00:57
9000 -- (-413.031) (-420.046) [-414.588] (-422.259) * (-416.439) [-414.548] (-410.125) (-415.099) -- 0:00:54
9500 -- (-417.465) (-420.829) (-418.450) [-420.919] * [-417.164] (-409.756) (-416.293) (-418.921) -- 0:00:51
10000 -- (-415.836) [-416.769] (-417.163) (-434.294) * (-423.100) (-411.845) (-413.565) [-417.978] -- 0:00:49
Average standard deviation of split frequencies: 0.074432
10500 -- (-419.524) [-418.615] (-425.810) (-427.743) * [-419.467] (-411.943) (-412.650) (-428.242) -- 0:00:46
11000 -- [-416.808] (-425.990) (-419.839) (-421.843) * [-419.744] (-412.506) (-410.437) (-422.335) -- 0:00:44
11500 -- (-419.600) [-421.794] (-420.115) (-420.941) * (-423.582) [-410.709] (-411.574) (-438.964) -- 0:00:42
12000 -- (-424.031) (-422.429) [-419.045] (-414.903) * (-421.867) [-409.940] (-412.135) (-432.715) -- 0:00:40
12500 -- (-423.222) [-423.280] (-415.580) (-420.162) * (-417.698) (-409.565) [-410.256] (-417.380) -- 0:00:39
13000 -- (-423.339) (-421.236) (-421.680) [-417.534] * (-427.252) (-409.915) [-409.621] (-410.707) -- 0:00:37
13500 -- (-424.619) [-425.045] (-421.629) (-418.921) * (-426.255) (-410.603) [-411.037] (-410.020) -- 0:00:36
14000 -- (-417.852) (-424.564) (-425.304) [-417.583] * (-432.234) (-411.140) [-410.921] (-412.239) -- 0:00:34
14500 -- (-416.032) [-420.549] (-419.458) (-421.479) * (-426.726) (-414.460) (-412.619) [-414.553] -- 0:00:33
15000 -- (-423.703) [-422.882] (-418.642) (-421.866) * (-430.371) (-409.670) (-409.869) [-413.638] -- 0:00:32
Average standard deviation of split frequencies: 0.054506
15500 -- (-420.546) [-418.844] (-426.313) (-415.753) * (-425.062) [-409.922] (-412.056) (-413.407) -- 0:00:31
16000 -- (-425.437) [-414.832] (-435.427) (-418.322) * (-424.212) (-410.267) [-410.827] (-413.272) -- 0:00:30
16500 -- (-420.505) [-420.541] (-427.611) (-430.987) * (-411.418) [-414.161] (-410.145) (-409.891) -- 0:00:29
17000 -- (-418.163) (-420.124) (-410.518) [-422.981] * [-409.737] (-412.351) (-418.674) (-410.025) -- 0:00:28
17500 -- (-418.152) (-431.187) (-412.955) [-420.844] * (-411.923) (-415.345) (-411.051) [-410.636] -- 0:00:55
18000 -- (-418.596) (-419.530) (-410.080) [-415.674] * [-410.301] (-410.968) (-412.790) (-411.320) -- 0:00:53
18500 -- (-420.322) (-418.452) (-409.547) [-416.202] * [-412.272] (-409.967) (-411.051) (-412.755) -- 0:00:52
19000 -- (-422.537) [-419.594] (-410.397) (-418.517) * (-409.379) (-414.595) (-410.976) [-411.785] -- 0:00:50
19500 -- [-415.680] (-420.506) (-411.987) (-422.074) * (-409.590) (-415.374) [-410.627] (-409.173) -- 0:00:49
20000 -- [-422.290] (-418.137) (-411.214) (-433.591) * [-410.961] (-410.429) (-412.336) (-412.044) -- 0:00:48
Average standard deviation of split frequencies: 0.043339
20500 -- [-418.185] (-423.495) (-409.280) (-424.619) * (-411.306) [-410.234] (-410.846) (-413.436) -- 0:00:46
21000 -- (-423.068) (-422.671) [-412.897] (-417.735) * [-409.685] (-414.841) (-413.813) (-412.892) -- 0:00:45
21500 -- (-426.439) (-421.469) [-412.124] (-414.576) * (-412.018) (-409.487) [-411.227] (-410.911) -- 0:00:44
22000 -- (-436.067) [-419.557] (-409.844) (-421.999) * (-413.442) (-413.399) [-414.204] (-410.688) -- 0:00:43
22500 -- (-422.566) [-419.098] (-411.831) (-417.748) * (-411.052) (-412.602) (-414.770) [-412.106] -- 0:00:42
23000 -- (-431.664) [-424.301] (-413.644) (-421.157) * (-413.554) (-410.459) (-410.423) [-410.797] -- 0:00:41
23500 -- (-434.677) (-419.307) [-410.665] (-429.131) * (-410.185) [-413.634] (-411.763) (-411.588) -- 0:00:40
24000 -- (-415.669) [-422.249] (-412.304) (-416.208) * (-414.004) (-414.866) (-413.834) [-411.247] -- 0:00:39
24500 -- [-411.520] (-421.710) (-412.262) (-418.499) * [-410.051] (-410.110) (-414.630) (-413.476) -- 0:00:38
25000 -- (-411.235) (-432.168) [-411.733] (-420.762) * (-412.078) [-411.133] (-415.932) (-413.285) -- 0:00:38
Average standard deviation of split frequencies: 0.041207
25500 -- (-416.082) (-420.257) (-411.760) [-424.413] * (-410.900) (-412.063) [-409.765] (-415.148) -- 0:00:37
26000 -- (-410.135) (-419.753) [-410.665] (-417.164) * (-410.384) [-412.272] (-413.683) (-413.339) -- 0:00:36
26500 -- [-411.903] (-435.430) (-410.068) (-425.154) * [-411.054] (-410.382) (-412.481) (-413.129) -- 0:00:35
27000 -- (-412.466) (-425.563) (-409.874) [-416.042] * [-409.510] (-409.788) (-411.240) (-409.898) -- 0:00:35
27500 -- (-415.889) (-422.948) (-410.931) [-422.578] * (-411.009) [-410.326] (-411.506) (-410.224) -- 0:00:34
28000 -- (-412.214) (-431.411) (-411.117) [-417.353] * [-411.551] (-411.785) (-410.268) (-411.068) -- 0:00:33
28500 -- (-412.719) (-422.782) [-410.195] (-429.002) * [-409.715] (-412.138) (-411.901) (-411.191) -- 0:00:33
29000 -- (-413.774) [-417.699] (-409.844) (-421.838) * (-409.288) (-410.731) [-413.819] (-411.372) -- 0:00:32
29500 -- (-413.206) (-418.572) [-409.712] (-416.739) * (-413.350) (-411.198) (-412.383) [-410.995] -- 0:00:31
30000 -- [-411.888] (-424.944) (-411.265) (-416.635) * (-413.781) (-412.080) [-411.442] (-412.314) -- 0:00:31
Average standard deviation of split frequencies: 0.040992
30500 -- (-412.727) (-418.947) [-411.660] (-410.406) * (-412.643) [-410.852] (-411.572) (-412.248) -- 0:00:30
31000 -- (-412.275) [-422.326] (-409.663) (-409.684) * [-412.599] (-412.636) (-409.444) (-412.717) -- 0:00:30
31500 -- (-412.043) (-431.050) (-411.285) [-413.575] * (-412.031) (-415.377) [-412.028] (-412.948) -- 0:00:29
32000 -- (-410.850) (-422.373) [-414.363] (-413.656) * (-413.826) (-410.767) [-413.880] (-414.754) -- 0:00:29
32500 -- (-412.730) [-414.095] (-416.694) (-413.351) * (-411.321) (-410.532) (-414.447) [-414.081] -- 0:00:28
33000 -- (-412.852) [-419.744] (-414.384) (-413.702) * (-411.187) (-409.527) [-411.634] (-409.689) -- 0:00:28
33500 -- (-410.066) (-421.844) [-411.796] (-410.021) * (-410.743) (-409.622) (-409.363) [-411.343] -- 0:00:27
34000 -- (-412.132) (-426.541) [-411.341] (-414.458) * [-411.779] (-412.192) (-409.168) (-411.187) -- 0:00:41
34500 -- [-411.949] (-417.041) (-412.070) (-410.978) * (-411.498) (-410.757) (-410.153) [-413.833] -- 0:00:40
35000 -- [-412.346] (-424.848) (-414.404) (-410.763) * (-411.013) (-411.346) [-413.819] (-415.132) -- 0:00:39
Average standard deviation of split frequencies: 0.032736
35500 -- (-412.212) [-420.180] (-412.437) (-412.627) * (-409.641) [-411.369] (-413.407) (-411.142) -- 0:00:39
36000 -- [-412.241] (-423.630) (-410.917) (-413.934) * (-410.990) (-409.016) [-410.962] (-411.189) -- 0:00:38
36500 -- (-413.668) (-420.147) (-410.884) [-412.660] * [-412.790] (-410.119) (-413.337) (-411.490) -- 0:00:38
37000 -- [-414.672] (-410.719) (-410.020) (-410.444) * (-413.019) (-412.282) (-412.766) [-412.071] -- 0:00:37
37500 -- (-410.838) (-412.209) [-411.815] (-414.456) * (-413.163) (-414.112) (-409.747) [-412.087] -- 0:00:37
38000 -- (-415.098) (-413.611) [-410.111] (-409.836) * [-410.703] (-415.533) (-414.066) (-409.734) -- 0:00:36
38500 -- (-411.532) [-413.109] (-409.840) (-409.938) * (-411.947) [-410.796] (-412.132) (-411.510) -- 0:00:35
39000 -- (-412.863) (-412.581) [-413.577] (-409.835) * (-411.997) (-416.494) (-411.101) [-411.542] -- 0:00:35
39500 -- (-411.110) (-412.894) (-412.258) [-410.272] * (-412.597) [-411.943] (-417.820) (-409.723) -- 0:00:34
40000 -- (-410.546) [-411.474] (-412.657) (-410.188) * [-413.904] (-412.225) (-412.052) (-413.501) -- 0:00:34
Average standard deviation of split frequencies: 0.032335
40500 -- (-410.436) [-412.720] (-410.893) (-420.432) * (-410.101) (-413.697) (-410.377) [-411.339] -- 0:00:34
41000 -- (-412.708) [-410.949] (-410.412) (-425.984) * [-414.586] (-413.694) (-410.087) (-411.311) -- 0:00:33
41500 -- (-411.106) [-412.860] (-410.132) (-419.308) * (-410.799) [-411.350] (-416.151) (-412.713) -- 0:00:33
42000 -- [-409.971] (-410.945) (-411.862) (-416.519) * [-409.399] (-409.804) (-417.889) (-410.741) -- 0:00:32
42500 -- (-411.584) (-413.447) [-414.395] (-411.472) * (-411.581) (-412.448) (-423.490) [-413.131] -- 0:00:32
43000 -- (-415.257) (-410.139) (-414.541) [-410.402] * [-411.493] (-411.390) (-411.287) (-411.064) -- 0:00:31
43500 -- (-411.498) (-410.656) (-413.204) [-410.865] * [-409.598] (-412.558) (-409.919) (-410.321) -- 0:00:31
44000 -- [-412.382] (-415.725) (-413.851) (-412.082) * (-412.973) [-412.150] (-412.676) (-411.561) -- 0:00:31
44500 -- (-418.771) [-410.646] (-412.388) (-411.314) * (-409.454) (-411.405) [-410.288] (-409.448) -- 0:00:30
45000 -- (-416.032) [-410.326] (-414.165) (-411.892) * (-411.066) (-412.622) [-411.733] (-410.034) -- 0:00:30
Average standard deviation of split frequencies: 0.030298
45500 -- (-412.831) (-412.176) (-413.451) [-409.758] * (-411.328) (-411.877) (-411.066) [-410.833] -- 0:00:29
46000 -- [-411.705] (-411.983) (-410.762) (-409.407) * (-414.285) [-414.266] (-414.243) (-410.675) -- 0:00:29
46500 -- (-411.195) (-411.735) [-411.226] (-410.067) * (-415.487) [-410.874] (-413.874) (-413.599) -- 0:00:29
47000 -- (-411.481) (-411.483) [-411.343] (-409.683) * (-410.316) [-411.506] (-412.319) (-411.624) -- 0:00:28
47500 -- (-410.549) (-412.685) [-413.083] (-409.824) * [-412.810] (-410.028) (-412.266) (-410.225) -- 0:00:28
48000 -- [-410.723] (-412.614) (-415.982) (-411.568) * (-411.374) (-411.095) (-410.538) [-410.887] -- 0:00:28
48500 -- (-412.610) [-409.607] (-412.327) (-410.311) * (-410.756) [-410.770] (-411.515) (-409.962) -- 0:00:27
49000 -- (-411.691) [-410.108] (-410.571) (-410.006) * (-411.586) [-412.249] (-410.123) (-412.743) -- 0:00:27
49500 -- (-409.672) [-411.257] (-410.130) (-409.724) * (-417.889) (-410.706) (-409.571) [-413.827] -- 0:00:27
50000 -- (-411.001) (-413.416) [-411.601] (-410.959) * (-412.249) (-411.056) (-413.805) [-412.057] -- 0:00:27
Average standard deviation of split frequencies: 0.030744
50500 -- (-412.205) (-412.257) (-414.198) [-412.337] * [-413.424] (-416.135) (-411.826) (-411.848) -- 0:00:26
51000 -- (-410.655) (-411.292) [-413.623] (-414.742) * (-410.739) [-413.623] (-413.204) (-411.209) -- 0:00:26
51500 -- [-409.980] (-409.502) (-410.407) (-410.324) * (-411.346) (-413.997) [-411.199] (-411.060) -- 0:00:34
52000 -- (-412.041) [-413.141] (-412.371) (-417.024) * (-412.801) (-410.195) [-412.542] (-410.274) -- 0:00:34
52500 -- (-414.154) [-414.375] (-410.956) (-413.203) * [-411.871] (-410.879) (-410.634) (-414.523) -- 0:00:34
53000 -- (-411.465) (-410.823) [-410.035] (-410.898) * (-412.926) [-409.502] (-410.220) (-410.061) -- 0:00:33
53500 -- (-410.811) (-411.618) [-410.580] (-411.271) * (-412.120) (-410.736) [-415.553] (-411.140) -- 0:00:33
54000 -- (-412.381) (-416.589) [-410.194] (-411.473) * (-414.988) [-410.289] (-410.443) (-411.033) -- 0:00:33
54500 -- (-413.627) (-413.500) (-409.511) [-411.289] * (-411.215) [-410.838] (-413.095) (-411.923) -- 0:00:32
55000 -- [-413.287] (-411.791) (-410.136) (-411.356) * (-411.467) (-411.464) [-409.394] (-415.264) -- 0:00:32
Average standard deviation of split frequencies: 0.029663
55500 -- (-409.625) [-410.204] (-409.251) (-411.322) * (-413.280) (-410.368) [-412.255] (-411.744) -- 0:00:32
56000 -- (-414.677) [-410.598] (-409.899) (-409.836) * (-411.717) [-414.385] (-410.361) (-410.444) -- 0:00:31
56500 -- (-412.567) (-412.840) (-412.595) [-412.150] * [-412.032] (-413.100) (-411.127) (-410.441) -- 0:00:31
57000 -- (-411.098) (-411.578) (-410.183) [-411.245] * [-411.049] (-412.306) (-411.649) (-409.617) -- 0:00:31
57500 -- (-411.320) (-415.101) (-410.585) [-410.514] * (-411.899) [-409.941] (-415.412) (-414.733) -- 0:00:30
58000 -- (-410.086) (-414.006) [-411.381] (-416.939) * (-410.555) (-411.041) (-411.219) [-410.300] -- 0:00:30
58500 -- (-410.539) (-409.695) (-411.808) [-411.725] * (-411.985) (-413.926) (-409.570) [-414.061] -- 0:00:30
59000 -- [-411.643] (-410.020) (-410.789) (-411.573) * [-410.184] (-415.775) (-409.451) (-411.664) -- 0:00:29
59500 -- (-410.863) [-411.380] (-410.123) (-414.437) * (-411.691) (-412.619) (-412.358) [-409.883] -- 0:00:29
60000 -- [-412.757] (-417.011) (-410.826) (-411.067) * (-411.586) (-410.862) (-413.956) [-410.857] -- 0:00:29
Average standard deviation of split frequencies: 0.029669
60500 -- (-410.567) (-413.614) (-413.196) [-409.790] * (-410.289) [-410.895] (-413.119) (-411.933) -- 0:00:29
61000 -- (-409.915) (-414.340) (-419.330) [-413.609] * (-410.165) (-409.938) [-411.032] (-410.462) -- 0:00:28
61500 -- [-410.964] (-411.195) (-409.756) (-414.988) * (-409.808) (-409.799) (-411.550) [-411.957] -- 0:00:28
62000 -- (-414.314) (-410.407) (-413.413) [-416.673] * (-412.026) (-412.785) (-413.542) [-410.024] -- 0:00:28
62500 -- (-415.034) (-410.421) [-411.302] (-414.274) * (-412.625) (-411.731) (-414.636) [-410.394] -- 0:00:28
63000 -- (-415.262) [-412.965] (-413.594) (-412.099) * (-416.847) (-410.988) (-415.571) [-409.504] -- 0:00:27
63500 -- (-413.771) [-409.684] (-414.698) (-413.847) * [-410.831] (-409.726) (-411.646) (-410.868) -- 0:00:27
64000 -- (-411.834) (-411.052) (-412.446) [-411.763] * [-412.182] (-411.693) (-411.953) (-409.960) -- 0:00:27
64500 -- (-411.773) [-410.475] (-411.545) (-412.659) * (-411.992) (-411.553) (-411.804) [-411.672] -- 0:00:27
65000 -- (-411.218) (-410.987) (-411.295) [-410.222] * [-411.719] (-414.959) (-410.079) (-410.003) -- 0:00:26
Average standard deviation of split frequencies: 0.029219
65500 -- (-410.455) (-409.720) [-412.526] (-410.152) * (-411.000) (-417.474) (-409.803) [-409.398] -- 0:00:26
66000 -- (-410.877) (-414.456) (-414.566) [-411.689] * [-411.651] (-416.697) (-411.479) (-410.896) -- 0:00:26
66500 -- (-416.079) (-416.477) (-411.289) [-411.052] * (-412.692) (-412.427) [-413.329] (-410.673) -- 0:00:26
67000 -- [-409.307] (-416.699) (-411.780) (-411.329) * (-412.464) (-412.895) [-411.277] (-412.208) -- 0:00:25
67500 -- [-409.956] (-416.710) (-411.752) (-412.901) * (-410.490) [-413.258] (-413.866) (-418.906) -- 0:00:25
68000 -- (-410.812) [-412.359] (-412.652) (-410.254) * (-414.918) (-410.217) [-413.678] (-412.528) -- 0:00:31
68500 -- (-412.870) (-410.883) [-411.326] (-409.440) * [-410.286] (-411.708) (-412.677) (-412.818) -- 0:00:31
69000 -- (-413.098) (-412.467) (-411.341) [-410.740] * [-416.192] (-416.551) (-415.030) (-410.491) -- 0:00:31
69500 -- [-410.718] (-410.943) (-409.449) (-410.710) * [-410.079] (-414.733) (-413.309) (-411.907) -- 0:00:30
70000 -- (-421.054) (-412.040) (-411.428) [-411.943] * (-410.065) [-410.896] (-412.172) (-411.943) -- 0:00:30
Average standard deviation of split frequencies: 0.024226
70500 -- (-412.769) [-410.728] (-410.322) (-412.025) * (-411.027) [-411.424] (-410.364) (-412.850) -- 0:00:30
71000 -- (-410.154) (-413.915) [-411.279] (-410.828) * (-416.591) (-412.898) [-409.726] (-410.124) -- 0:00:30
71500 -- (-411.166) (-412.224) (-410.498) [-410.240] * (-410.217) (-411.854) (-409.748) [-411.022] -- 0:00:29
72000 -- (-412.462) (-411.059) (-413.191) [-409.817] * (-411.415) (-411.135) (-413.203) [-411.325] -- 0:00:29
72500 -- (-409.824) (-413.387) [-410.439] (-411.295) * (-410.457) (-413.181) (-415.956) [-411.967] -- 0:00:29
73000 -- (-412.113) (-410.993) (-412.448) [-412.996] * (-410.606) [-409.818] (-410.654) (-410.769) -- 0:00:29
73500 -- (-410.962) [-413.939] (-412.873) (-410.972) * (-414.854) (-410.649) (-411.062) [-412.769] -- 0:00:29
74000 -- [-413.428] (-412.258) (-412.015) (-416.825) * (-412.349) (-410.169) (-415.662) [-410.492] -- 0:00:28
74500 -- (-411.097) (-412.423) [-412.334] (-410.068) * (-411.682) (-414.125) [-411.159] (-411.879) -- 0:00:28
75000 -- (-412.042) (-410.750) (-416.708) [-410.779] * (-411.342) [-411.674] (-410.955) (-411.692) -- 0:00:28
Average standard deviation of split frequencies: 0.022199
75500 -- (-413.920) (-411.487) (-411.856) [-411.330] * (-412.502) (-410.235) [-410.988] (-414.017) -- 0:00:28
76000 -- (-411.079) [-411.873] (-413.758) (-410.677) * (-412.531) (-411.711) (-410.030) [-409.740] -- 0:00:27
76500 -- [-411.183] (-412.102) (-410.634) (-413.732) * [-412.727] (-410.482) (-411.821) (-414.388) -- 0:00:27
77000 -- (-413.244) [-411.626] (-411.430) (-410.144) * (-415.784) (-410.832) [-409.669] (-415.432) -- 0:00:27
77500 -- (-412.972) [-410.181] (-410.808) (-410.797) * (-414.203) (-412.744) [-411.273] (-410.557) -- 0:00:27
78000 -- (-410.274) (-413.569) [-409.911] (-411.960) * (-412.878) [-410.733] (-411.387) (-413.672) -- 0:00:27
78500 -- (-413.800) (-414.741) (-410.305) [-411.788] * (-412.302) [-413.272] (-415.936) (-409.707) -- 0:00:26
79000 -- (-410.964) (-412.820) (-417.283) [-412.427] * (-413.629) (-409.998) (-411.515) [-409.990] -- 0:00:26
79500 -- [-412.345] (-410.857) (-411.617) (-413.613) * (-414.764) (-409.477) (-411.684) [-409.961] -- 0:00:26
80000 -- (-412.232) [-410.995] (-411.013) (-409.777) * [-410.990] (-409.954) (-412.357) (-411.813) -- 0:00:26
Average standard deviation of split frequencies: 0.018408
80500 -- (-412.539) [-410.756] (-410.545) (-410.391) * (-417.826) (-409.622) (-411.843) [-410.078] -- 0:00:26
81000 -- (-410.938) (-410.891) (-409.408) [-411.961] * (-417.815) [-409.979] (-412.613) (-411.179) -- 0:00:25
81500 -- (-410.809) (-415.296) [-410.126] (-410.309) * [-412.470] (-412.707) (-415.465) (-411.234) -- 0:00:25
82000 -- (-411.260) (-414.367) (-414.617) [-412.591] * [-412.919] (-410.098) (-417.684) (-412.170) -- 0:00:25
82500 -- (-411.856) (-412.964) [-414.950] (-412.721) * (-411.798) [-411.383] (-413.745) (-410.278) -- 0:00:25
83000 -- (-412.224) (-412.420) (-410.967) [-412.793] * (-413.195) [-411.505] (-409.597) (-409.652) -- 0:00:25
83500 -- (-410.887) (-409.877) (-410.202) [-411.016] * [-410.891] (-410.283) (-410.358) (-411.541) -- 0:00:24
84000 -- (-410.098) (-409.414) [-409.545] (-413.441) * [-409.636] (-413.055) (-412.270) (-414.600) -- 0:00:24
84500 -- (-412.379) (-410.929) (-412.815) [-410.869] * (-410.246) [-413.468] (-411.722) (-410.828) -- 0:00:24
85000 -- [-412.199] (-409.579) (-411.393) (-410.668) * (-411.528) (-413.247) (-413.805) [-412.965] -- 0:00:29
Average standard deviation of split frequencies: 0.016195
85500 -- (-414.224) (-413.676) (-409.737) [-409.647] * [-417.443] (-411.084) (-411.750) (-410.811) -- 0:00:29
86000 -- (-410.589) (-412.014) [-410.939] (-410.499) * [-409.996] (-410.459) (-416.131) (-413.919) -- 0:00:28
86500 -- (-410.626) [-413.935] (-413.336) (-410.818) * (-410.294) (-410.614) (-410.850) [-411.968] -- 0:00:28
87000 -- (-410.174) (-411.010) [-412.244] (-413.309) * [-411.019] (-413.871) (-410.820) (-411.954) -- 0:00:28
87500 -- (-411.975) [-418.231] (-411.837) (-414.062) * (-411.520) (-412.089) (-414.764) [-409.885] -- 0:00:28
88000 -- (-411.827) (-414.584) [-409.585] (-410.569) * [-411.359] (-410.190) (-417.269) (-412.310) -- 0:00:28
88500 -- (-414.591) (-414.105) [-410.084] (-414.197) * (-411.579) [-409.593] (-411.726) (-410.708) -- 0:00:27
89000 -- (-415.871) (-411.575) (-409.320) [-413.062] * (-412.258) (-411.939) [-410.418] (-410.808) -- 0:00:27
89500 -- (-410.393) [-409.882] (-409.086) (-410.119) * [-410.584] (-410.836) (-411.716) (-412.051) -- 0:00:27
90000 -- (-410.852) (-410.161) [-409.569] (-412.341) * (-409.970) (-410.599) (-409.842) [-410.172] -- 0:00:27
Average standard deviation of split frequencies: 0.020797
90500 -- (-409.482) (-410.055) (-410.874) [-414.606] * (-418.295) (-412.657) [-416.932] (-410.548) -- 0:00:27
91000 -- [-410.200] (-412.471) (-410.484) (-414.630) * (-414.615) [-410.691] (-413.303) (-409.741) -- 0:00:26
91500 -- (-413.050) (-414.082) (-410.513) [-416.369] * (-410.907) (-412.951) (-410.600) [-414.557] -- 0:00:26
92000 -- (-411.989) (-412.696) (-411.587) [-412.666] * [-409.967] (-411.337) (-411.131) (-409.235) -- 0:00:26
92500 -- (-413.153) (-412.473) [-413.337] (-410.584) * (-412.114) (-410.029) [-410.394] (-411.195) -- 0:00:26
93000 -- (-410.976) [-412.486] (-410.410) (-411.406) * (-410.835) [-409.287] (-409.738) (-414.949) -- 0:00:26
93500 -- (-413.226) (-411.444) (-411.399) [-409.389] * (-411.222) (-413.235) (-409.726) [-409.584] -- 0:00:26
94000 -- (-410.834) (-411.257) (-416.328) [-412.877] * [-413.506] (-409.948) (-410.046) (-411.098) -- 0:00:25
94500 -- [-411.160] (-410.980) (-412.224) (-416.550) * (-411.933) (-411.405) (-409.564) [-411.855] -- 0:00:25
95000 -- (-416.948) (-410.110) (-412.969) [-411.263] * (-409.637) (-410.138) (-411.836) [-410.299] -- 0:00:25
Average standard deviation of split frequencies: 0.017187
95500 -- (-415.121) [-410.328] (-412.985) (-415.399) * (-411.465) (-413.196) (-413.403) [-410.386] -- 0:00:25
96000 -- (-411.685) [-411.261] (-411.946) (-411.114) * [-414.504] (-410.677) (-411.330) (-409.849) -- 0:00:25
96500 -- (-411.419) (-418.622) (-411.078) [-411.074] * (-416.184) [-410.023] (-415.626) (-411.051) -- 0:00:25
97000 -- (-412.495) (-414.671) [-411.052] (-415.111) * (-410.600) [-411.430] (-415.450) (-415.392) -- 0:00:24
97500 -- (-410.457) (-409.473) [-412.757] (-410.633) * [-410.295] (-411.870) (-415.490) (-414.863) -- 0:00:24
98000 -- (-411.602) (-411.323) [-409.376] (-417.614) * (-412.574) (-412.944) (-412.767) [-410.951] -- 0:00:24
98500 -- (-413.406) [-410.087] (-410.535) (-417.771) * (-412.362) (-412.686) [-411.060] (-414.061) -- 0:00:24
99000 -- (-412.008) (-411.540) (-409.443) [-411.581] * (-412.524) [-410.195] (-413.071) (-415.339) -- 0:00:24
99500 -- (-411.806) (-414.789) [-412.116] (-411.936) * [-409.787] (-414.746) (-410.599) (-411.289) -- 0:00:24
100000 -- (-414.664) (-413.856) (-411.636) [-410.619] * (-409.924) [-410.652] (-411.983) (-412.695) -- 0:00:24
Average standard deviation of split frequencies: 0.015832
100500 -- (-411.120) [-411.532] (-412.576) (-413.176) * [-413.126] (-409.607) (-413.864) (-409.462) -- 0:00:23
101000 -- (-410.103) (-413.765) [-411.853] (-413.080) * (-409.583) [-410.356] (-411.391) (-409.554) -- 0:00:23
101500 -- [-410.451] (-412.558) (-410.408) (-411.617) * (-415.331) [-409.338] (-409.430) (-410.111) -- 0:00:23
102000 -- (-410.159) (-410.863) (-411.491) [-410.475] * (-410.123) (-413.750) (-412.162) [-411.079] -- 0:00:23
102500 -- (-411.133) (-411.317) (-411.180) [-413.873] * (-411.836) (-410.502) [-410.128] (-411.967) -- 0:00:27
103000 -- [-411.426] (-409.891) (-410.725) (-413.652) * [-411.847] (-411.223) (-410.948) (-416.820) -- 0:00:26
103500 -- (-409.691) [-410.720] (-409.939) (-417.471) * (-410.458) (-412.130) [-409.968] (-411.626) -- 0:00:26
104000 -- (-410.870) [-410.482] (-410.244) (-411.855) * (-412.493) (-412.112) [-414.366] (-411.472) -- 0:00:26
104500 -- (-410.396) (-411.804) (-412.010) [-413.403] * [-409.136] (-414.269) (-409.810) (-412.398) -- 0:00:26
105000 -- [-413.548] (-409.655) (-410.538) (-413.354) * (-409.740) (-415.313) [-411.754] (-412.587) -- 0:00:26
Average standard deviation of split frequencies: 0.014898
105500 -- (-412.429) (-413.190) [-412.622] (-411.693) * [-409.772] (-411.699) (-412.031) (-414.905) -- 0:00:26
106000 -- (-411.598) (-411.965) (-411.839) [-410.728] * [-409.724] (-411.126) (-412.206) (-411.032) -- 0:00:26
106500 -- (-411.464) [-410.665] (-411.681) (-414.329) * (-417.789) (-413.677) (-412.118) [-409.980] -- 0:00:25
107000 -- (-415.712) (-413.175) (-409.913) [-411.337] * [-412.141] (-410.549) (-414.063) (-412.759) -- 0:00:25
107500 -- [-411.080] (-412.506) (-409.995) (-409.472) * (-415.422) (-412.648) (-409.720) [-411.319] -- 0:00:25
108000 -- (-411.623) (-412.000) [-409.792] (-409.648) * (-413.326) (-414.635) [-410.973] (-410.072) -- 0:00:25
108500 -- (-410.897) (-412.675) (-412.602) [-411.128] * (-414.113) [-412.485] (-409.814) (-411.517) -- 0:00:25
109000 -- [-413.485] (-411.209) (-409.713) (-413.723) * (-414.375) [-411.943] (-409.641) (-413.765) -- 0:00:25
109500 -- (-413.432) (-412.209) (-412.320) [-412.478] * (-410.231) [-410.307] (-409.733) (-414.929) -- 0:00:24
110000 -- (-411.913) [-413.072] (-411.508) (-414.269) * (-411.432) (-412.345) [-410.548] (-415.426) -- 0:00:24
Average standard deviation of split frequencies: 0.015335
110500 -- (-412.125) (-409.900) [-412.895] (-410.291) * (-409.831) (-409.814) [-410.285] (-412.683) -- 0:00:24
111000 -- (-410.623) (-410.663) [-414.334] (-411.996) * [-410.136] (-410.865) (-411.786) (-410.634) -- 0:00:24
111500 -- (-412.150) [-412.763] (-412.400) (-409.609) * [-409.274] (-411.412) (-412.511) (-412.789) -- 0:00:24
112000 -- [-411.070] (-413.283) (-412.137) (-409.686) * (-410.369) (-413.421) [-411.411] (-413.402) -- 0:00:24
112500 -- (-410.466) (-412.975) [-410.472] (-410.293) * [-411.445] (-410.236) (-409.809) (-413.477) -- 0:00:24
113000 -- (-412.226) [-410.078] (-413.379) (-410.233) * (-411.370) (-411.729) [-409.508] (-410.190) -- 0:00:23
113500 -- (-412.047) [-410.422] (-410.543) (-412.977) * (-410.659) (-412.510) (-410.377) [-411.678] -- 0:00:23
114000 -- (-415.042) (-412.001) [-410.518] (-412.144) * (-411.276) (-412.583) [-410.051] (-412.887) -- 0:00:23
114500 -- (-413.222) (-411.978) [-411.328] (-411.074) * (-411.667) [-410.514] (-412.989) (-411.608) -- 0:00:23
115000 -- (-409.740) (-410.817) (-413.071) [-411.190] * [-411.992] (-411.283) (-411.747) (-419.990) -- 0:00:23
Average standard deviation of split frequencies: 0.015849
115500 -- [-410.154] (-413.142) (-411.679) (-410.025) * [-410.243] (-411.730) (-411.056) (-413.599) -- 0:00:23
116000 -- (-412.857) (-410.468) (-410.080) [-410.189] * [-409.681] (-413.352) (-411.321) (-410.867) -- 0:00:23
116500 -- [-409.676] (-410.081) (-410.434) (-409.268) * (-411.329) [-412.961] (-412.630) (-409.562) -- 0:00:23
117000 -- (-411.999) (-411.107) (-415.562) [-410.087] * (-413.035) [-410.131] (-411.481) (-411.654) -- 0:00:22
117500 -- (-410.948) [-410.143] (-412.063) (-410.795) * (-410.012) (-413.350) (-410.251) [-411.336] -- 0:00:22
118000 -- (-411.604) (-411.603) [-412.121] (-409.285) * [-411.925] (-410.767) (-412.775) (-411.710) -- 0:00:22
118500 -- (-412.602) [-411.108] (-413.247) (-415.265) * (-410.088) (-410.702) [-412.512] (-413.178) -- 0:00:22
119000 -- [-410.322] (-413.079) (-411.623) (-410.753) * (-411.994) [-410.912] (-410.279) (-411.458) -- 0:00:22
119500 -- (-409.781) [-412.881] (-414.382) (-411.289) * [-412.995] (-412.080) (-409.921) (-411.307) -- 0:00:25
120000 -- [-411.835] (-411.915) (-411.057) (-410.273) * [-413.081] (-411.581) (-409.914) (-411.897) -- 0:00:25
Average standard deviation of split frequencies: 0.017189
120500 -- (-409.042) [-412.627] (-415.038) (-412.350) * (-411.541) (-411.323) (-411.615) [-410.075] -- 0:00:25
121000 -- [-410.631] (-417.644) (-413.627) (-412.454) * (-409.987) (-409.589) (-409.922) [-413.417] -- 0:00:25
121500 -- [-411.036] (-416.939) (-412.310) (-410.649) * [-411.936] (-412.166) (-414.725) (-411.586) -- 0:00:24
122000 -- (-410.079) (-412.398) (-412.293) [-409.741] * (-412.085) (-409.118) [-414.878] (-411.013) -- 0:00:24
122500 -- (-410.061) (-411.722) (-411.679) [-412.655] * (-411.337) (-411.363) [-409.589] (-410.439) -- 0:00:24
123000 -- [-409.908] (-414.546) (-410.270) (-411.231) * (-412.340) (-412.524) (-411.021) [-412.969] -- 0:00:24
123500 -- (-410.190) [-411.106] (-414.749) (-409.266) * (-412.465) (-411.411) [-413.421] (-415.278) -- 0:00:24
124000 -- (-411.308) [-411.491] (-409.632) (-410.516) * (-412.738) [-412.704] (-412.066) (-413.158) -- 0:00:24
124500 -- (-413.462) (-410.660) (-410.923) [-409.274] * (-411.761) (-412.587) [-409.460] (-411.672) -- 0:00:24
125000 -- [-412.051] (-412.611) (-413.513) (-414.738) * (-411.519) (-409.954) [-409.280] (-412.014) -- 0:00:24
Average standard deviation of split frequencies: 0.017771
125500 -- (-412.854) (-410.814) [-410.949] (-414.100) * (-412.599) [-410.138] (-409.666) (-410.052) -- 0:00:23
126000 -- (-411.380) [-410.534] (-409.786) (-412.284) * (-410.210) (-410.951) [-410.472] (-411.328) -- 0:00:23
126500 -- (-414.316) (-411.703) [-415.429] (-411.282) * (-411.627) (-415.405) [-412.237] (-409.494) -- 0:00:23
127000 -- (-414.264) (-414.269) (-410.081) [-411.676] * (-411.449) (-411.954) (-410.320) [-410.037] -- 0:00:23
127500 -- (-412.099) [-412.841] (-411.135) (-409.740) * [-409.842] (-413.630) (-410.397) (-412.210) -- 0:00:23
128000 -- (-415.091) (-412.583) [-410.108] (-413.751) * (-411.527) [-415.558] (-413.018) (-410.851) -- 0:00:23
128500 -- (-410.815) (-412.103) [-414.620] (-412.716) * (-413.855) [-411.881] (-411.369) (-410.579) -- 0:00:23
129000 -- (-411.829) (-412.872) [-410.649] (-410.391) * (-418.070) [-411.567] (-412.269) (-410.346) -- 0:00:23
129500 -- (-410.894) (-413.003) [-410.338] (-412.432) * (-418.724) (-410.615) (-411.481) [-410.537] -- 0:00:22
130000 -- (-411.706) (-413.155) [-412.567] (-409.524) * [-410.617] (-415.409) (-410.760) (-411.207) -- 0:00:22
Average standard deviation of split frequencies: 0.018798
130500 -- [-412.116] (-410.376) (-410.618) (-413.374) * [-409.543] (-410.921) (-409.748) (-412.016) -- 0:00:22
131000 -- (-409.197) [-414.761] (-409.444) (-410.710) * (-410.893) [-411.974] (-410.645) (-414.532) -- 0:00:22
131500 -- (-409.955) [-409.495] (-413.045) (-411.054) * (-409.797) (-411.782) [-410.969] (-411.339) -- 0:00:22
132000 -- (-411.053) (-409.239) [-412.499] (-413.399) * (-411.863) [-412.042] (-417.933) (-410.150) -- 0:00:22
132500 -- (-413.749) (-412.302) (-412.849) [-411.126] * (-411.370) (-412.851) (-414.054) [-412.999] -- 0:00:22
133000 -- (-410.873) (-410.270) (-412.164) [-410.978] * [-411.528] (-410.231) (-411.483) (-421.250) -- 0:00:22
133500 -- [-411.407] (-409.615) (-409.371) (-411.480) * (-411.986) (-410.251) (-411.790) [-412.447] -- 0:00:21
134000 -- (-412.667) [-411.357] (-412.387) (-412.461) * [-411.561] (-411.632) (-412.816) (-416.124) -- 0:00:21
134500 -- (-410.461) (-416.909) [-412.018] (-409.694) * [-410.801] (-412.000) (-413.642) (-417.255) -- 0:00:21
135000 -- (-410.763) [-411.733] (-411.952) (-409.874) * (-411.097) (-410.819) [-411.673] (-412.359) -- 0:00:21
Average standard deviation of split frequencies: 0.021182
135500 -- [-411.408] (-411.781) (-412.785) (-410.972) * [-410.205] (-410.102) (-410.955) (-413.193) -- 0:00:21
136000 -- (-410.658) (-412.332) [-415.339] (-412.091) * [-410.083] (-410.565) (-413.565) (-409.595) -- 0:00:21
136500 -- (-410.345) [-411.879] (-413.008) (-410.571) * (-409.668) [-412.889] (-414.391) (-409.781) -- 0:00:21
137000 -- (-410.803) [-410.470] (-413.496) (-411.830) * (-411.354) (-411.401) [-411.445] (-410.481) -- 0:00:23
137500 -- (-414.615) (-411.403) (-414.663) [-409.086] * (-413.512) (-415.076) (-409.813) [-413.064] -- 0:00:23
138000 -- [-411.136] (-409.347) (-411.696) (-413.750) * (-414.123) (-413.098) (-412.845) [-411.940] -- 0:00:23
138500 -- [-411.423] (-409.752) (-410.716) (-411.306) * (-410.666) [-413.400] (-410.449) (-411.429) -- 0:00:23
139000 -- (-412.883) [-411.033] (-409.815) (-415.230) * (-411.742) [-413.196] (-409.964) (-410.786) -- 0:00:23
139500 -- [-412.383] (-413.505) (-410.994) (-413.789) * (-415.741) [-413.306] (-412.221) (-410.374) -- 0:00:23
140000 -- [-412.251] (-411.753) (-413.934) (-417.731) * (-410.406) [-409.594] (-413.205) (-411.868) -- 0:00:23
Average standard deviation of split frequencies: 0.021881
140500 -- (-413.200) [-414.614] (-412.876) (-414.219) * (-417.249) [-412.698] (-412.139) (-412.838) -- 0:00:23
141000 -- (-410.036) (-413.585) [-418.360] (-411.547) * [-410.598] (-413.315) (-409.806) (-410.029) -- 0:00:22
141500 -- (-411.339) (-411.258) (-411.879) [-409.892] * (-410.222) (-412.334) [-410.180] (-412.949) -- 0:00:22
142000 -- (-410.728) (-409.556) (-410.927) [-411.854] * (-411.797) (-411.952) [-410.353] (-413.321) -- 0:00:22
142500 -- [-412.883] (-411.783) (-409.841) (-411.183) * (-412.588) [-411.848] (-411.711) (-411.275) -- 0:00:22
143000 -- (-411.438) (-409.906) (-411.514) [-409.963] * (-413.578) (-409.204) [-410.116] (-409.414) -- 0:00:22
143500 -- (-412.651) (-411.356) [-410.506] (-409.638) * (-410.031) [-409.535] (-411.513) (-410.804) -- 0:00:22
144000 -- (-412.041) [-409.607] (-413.745) (-411.176) * (-411.037) (-417.338) (-412.993) [-410.064] -- 0:00:22
144500 -- (-409.810) (-417.719) [-411.386] (-413.015) * (-412.325) (-415.295) [-411.904] (-410.944) -- 0:00:22
145000 -- [-412.264] (-413.812) (-415.789) (-410.367) * (-413.070) [-413.211] (-413.154) (-412.150) -- 0:00:22
Average standard deviation of split frequencies: 0.020702
145500 -- [-413.237] (-411.492) (-413.012) (-410.828) * (-411.444) (-412.420) (-410.512) [-411.762] -- 0:00:21
146000 -- [-411.573] (-410.376) (-409.598) (-413.574) * [-414.069] (-411.773) (-415.249) (-409.643) -- 0:00:21
146500 -- (-413.675) (-412.382) (-410.354) [-410.955] * (-416.049) (-411.423) [-410.067] (-409.175) -- 0:00:21
147000 -- (-411.180) [-410.225] (-411.370) (-414.429) * (-411.213) (-411.753) [-409.957] (-412.705) -- 0:00:21
147500 -- (-410.069) [-413.150] (-410.634) (-410.489) * [-409.797] (-411.044) (-409.574) (-414.860) -- 0:00:21
148000 -- (-411.737) [-411.155] (-410.948) (-413.482) * (-410.453) (-411.348) [-410.067] (-412.330) -- 0:00:21
148500 -- [-410.710] (-409.728) (-410.141) (-413.272) * (-413.959) (-410.194) (-413.230) [-410.475] -- 0:00:21
149000 -- (-409.550) (-410.336) (-410.446) [-412.350] * (-414.698) (-411.423) (-411.969) [-412.155] -- 0:00:21
149500 -- (-409.801) (-412.800) [-411.910] (-413.520) * [-410.621] (-412.791) (-410.112) (-411.033) -- 0:00:21
150000 -- (-412.906) (-410.063) [-409.611] (-415.547) * (-415.326) [-410.365] (-410.653) (-411.027) -- 0:00:21
Average standard deviation of split frequencies: 0.020061
150500 -- [-409.855] (-410.680) (-411.615) (-412.152) * [-413.063] (-412.285) (-411.233) (-410.565) -- 0:00:20
151000 -- (-412.808) (-417.033) (-411.709) [-412.896] * (-412.154) (-409.935) [-410.369] (-411.682) -- 0:00:20
151500 -- (-409.806) [-409.975] (-410.362) (-409.832) * (-412.443) (-409.374) (-411.132) [-410.798] -- 0:00:20
152000 -- (-409.265) (-413.993) (-411.811) [-420.140] * (-411.782) (-409.276) (-413.206) [-410.716] -- 0:00:20
152500 -- (-409.744) (-414.672) [-410.285] (-415.195) * (-410.711) (-410.028) (-412.377) [-409.845] -- 0:00:20
153000 -- [-409.720] (-410.196) (-413.166) (-413.430) * [-410.482] (-412.613) (-412.175) (-410.009) -- 0:00:20
153500 -- (-410.196) (-412.549) [-412.442] (-410.729) * (-411.494) [-415.359] (-411.606) (-411.430) -- 0:00:20
154000 -- (-414.836) [-410.326] (-410.741) (-411.890) * (-412.028) (-412.120) [-409.803] (-411.472) -- 0:00:22
154500 -- (-415.024) (-414.570) [-411.082] (-412.302) * (-411.972) (-412.979) [-412.266] (-412.242) -- 0:00:22
155000 -- (-410.739) [-410.020] (-410.912) (-411.198) * [-410.907] (-415.043) (-412.326) (-411.817) -- 0:00:22
Average standard deviation of split frequencies: 0.020264
155500 -- (-411.412) (-412.801) [-410.796] (-411.289) * (-413.376) (-413.884) [-411.832] (-413.755) -- 0:00:22
156000 -- (-412.136) (-414.979) [-410.270] (-412.587) * (-411.087) (-410.984) [-409.696] (-415.784) -- 0:00:22
156500 -- (-410.023) (-414.205) [-411.062] (-413.938) * (-410.635) (-409.383) (-410.930) [-410.980] -- 0:00:21
157000 -- [-410.998] (-411.030) (-410.642) (-410.319) * (-416.642) (-411.227) (-409.764) [-412.670] -- 0:00:21
157500 -- (-411.095) [-410.806] (-411.097) (-411.778) * (-410.705) (-412.110) [-410.954] (-412.647) -- 0:00:21
158000 -- [-410.230] (-413.786) (-411.586) (-409.344) * (-409.866) (-410.854) [-411.032] (-410.565) -- 0:00:21
158500 -- [-410.365] (-411.699) (-411.457) (-411.302) * (-411.167) [-410.971] (-414.321) (-412.910) -- 0:00:21
159000 -- (-410.957) (-413.545) (-413.817) [-413.047] * (-409.947) (-410.359) (-410.870) [-414.656] -- 0:00:21
159500 -- (-411.242) [-411.694] (-413.061) (-413.917) * (-411.805) (-411.146) (-411.961) [-410.541] -- 0:00:21
160000 -- [-413.716] (-415.907) (-416.023) (-414.765) * (-414.283) (-411.960) (-410.723) [-410.634] -- 0:00:21
Average standard deviation of split frequencies: 0.018985
160500 -- (-410.451) (-411.515) (-410.399) [-410.373] * (-411.938) [-410.298] (-413.058) (-411.621) -- 0:00:21
161000 -- (-410.470) (-412.350) [-410.083] (-409.819) * (-414.446) (-412.628) [-410.408] (-411.746) -- 0:00:21
161500 -- (-417.648) [-410.843] (-414.907) (-411.010) * [-410.773] (-415.521) (-411.439) (-410.090) -- 0:00:20
162000 -- (-411.930) (-412.685) (-412.168) [-410.331] * [-409.701] (-418.914) (-414.938) (-412.235) -- 0:00:20
162500 -- [-411.358] (-414.571) (-409.752) (-413.348) * (-410.981) (-410.544) (-410.933) [-414.292] -- 0:00:20
163000 -- (-414.710) [-409.976] (-413.263) (-411.393) * (-412.826) [-414.350] (-409.617) (-412.688) -- 0:00:20
163500 -- (-413.663) (-410.535) (-412.002) [-412.772] * (-413.483) [-411.321] (-410.042) (-412.308) -- 0:00:20
164000 -- (-411.102) [-410.134] (-410.939) (-412.890) * (-411.183) (-413.562) [-414.389] (-411.040) -- 0:00:20
164500 -- (-409.221) [-412.612] (-409.783) (-411.110) * [-410.045] (-414.978) (-415.119) (-409.779) -- 0:00:20
165000 -- (-415.471) (-412.170) (-411.532) [-410.910] * (-410.242) (-414.567) [-410.492] (-410.563) -- 0:00:20
Average standard deviation of split frequencies: 0.020213
165500 -- (-414.443) (-411.670) (-411.038) [-411.180] * [-412.107] (-414.193) (-414.894) (-410.772) -- 0:00:20
166000 -- (-415.862) [-410.831] (-409.937) (-410.918) * (-410.760) [-409.208] (-414.459) (-412.114) -- 0:00:20
166500 -- (-415.550) [-411.226] (-410.002) (-409.873) * [-414.680] (-409.146) (-414.298) (-413.591) -- 0:00:20
167000 -- (-412.072) [-410.017] (-410.319) (-412.516) * (-417.310) (-410.859) [-411.775] (-411.997) -- 0:00:19
167500 -- (-411.330) [-412.453] (-412.741) (-409.978) * (-412.673) [-410.322] (-412.834) (-409.931) -- 0:00:19
168000 -- (-409.260) (-410.908) (-411.873) [-411.885] * [-411.270] (-411.904) (-412.555) (-411.664) -- 0:00:19
168500 -- (-412.218) (-411.754) [-410.582] (-409.177) * (-413.342) [-410.976] (-410.968) (-413.947) -- 0:00:19
169000 -- (-415.890) (-410.698) (-410.094) [-409.886] * (-410.533) (-410.242) (-412.567) [-414.970] -- 0:00:19
169500 -- [-412.284] (-415.475) (-411.600) (-409.438) * (-414.048) [-412.043] (-412.359) (-411.717) -- 0:00:19
170000 -- (-411.551) (-410.758) [-409.673] (-410.425) * (-413.116) [-412.055] (-411.542) (-426.884) -- 0:00:19
Average standard deviation of split frequencies: 0.021122
170500 -- (-411.771) (-409.776) [-414.385] (-411.192) * (-417.958) (-413.296) [-410.172] (-409.972) -- 0:00:19
171000 -- (-411.579) [-410.043] (-411.540) (-413.828) * (-412.110) (-411.113) (-410.759) [-410.273] -- 0:00:21
171500 -- (-412.616) [-411.268] (-411.240) (-411.766) * (-412.402) (-411.456) (-409.544) [-413.098] -- 0:00:21
172000 -- (-410.093) (-412.710) (-410.350) [-409.753] * (-411.118) [-416.931] (-409.582) (-409.989) -- 0:00:20
172500 -- (-409.526) (-416.148) (-410.778) [-413.123] * (-411.328) [-410.858] (-411.308) (-409.765) -- 0:00:20
173000 -- (-409.605) [-414.670] (-410.274) (-413.673) * [-412.631] (-413.710) (-410.793) (-410.950) -- 0:00:20
173500 -- (-411.693) [-411.075] (-412.168) (-411.182) * (-410.774) [-414.298] (-410.126) (-412.212) -- 0:00:20
174000 -- (-411.549) (-412.237) [-410.335] (-413.130) * [-411.514] (-414.473) (-415.083) (-410.273) -- 0:00:20
174500 -- (-412.579) (-410.622) [-411.712] (-414.937) * (-413.531) [-409.607] (-416.238) (-412.721) -- 0:00:20
175000 -- (-413.720) [-412.797] (-413.309) (-411.894) * (-411.729) (-410.317) (-411.272) [-413.896] -- 0:00:20
Average standard deviation of split frequencies: 0.019642
175500 -- [-412.818] (-409.615) (-413.537) (-409.840) * (-413.608) (-414.092) (-411.796) [-412.939] -- 0:00:20
176000 -- (-413.551) (-411.960) [-412.488] (-410.653) * (-412.494) (-410.466) (-411.481) [-411.731] -- 0:00:20
176500 -- (-409.390) [-409.110] (-411.025) (-410.447) * (-414.039) (-413.459) [-410.987] (-409.603) -- 0:00:20
177000 -- (-410.155) [-415.106] (-409.205) (-413.054) * [-411.914] (-412.360) (-411.444) (-409.637) -- 0:00:20
177500 -- (-412.210) (-412.525) [-409.881] (-412.953) * (-411.566) (-410.705) [-412.179] (-410.793) -- 0:00:19
178000 -- (-415.581) [-419.495] (-410.210) (-411.618) * [-411.629] (-411.536) (-411.716) (-411.004) -- 0:00:19
178500 -- (-411.557) (-409.992) [-411.330] (-410.128) * (-409.607) (-411.296) (-410.253) [-409.946] -- 0:00:19
179000 -- (-411.232) [-412.185] (-410.318) (-412.608) * [-412.524] (-412.520) (-414.918) (-409.450) -- 0:00:19
179500 -- (-410.880) [-412.279] (-411.433) (-412.480) * (-412.408) [-410.170] (-410.286) (-410.537) -- 0:00:19
180000 -- (-411.484) (-413.415) (-410.690) [-411.906] * [-410.279] (-412.216) (-412.047) (-412.036) -- 0:00:19
Average standard deviation of split frequencies: 0.018102
180500 -- (-416.337) (-416.196) [-409.974] (-409.972) * (-411.454) [-412.436] (-410.202) (-413.884) -- 0:00:19
181000 -- (-412.434) (-415.805) (-412.923) [-411.664] * (-411.474) (-412.358) [-412.800] (-409.564) -- 0:00:19
181500 -- (-411.024) [-413.329] (-411.681) (-411.001) * (-410.927) (-412.322) [-411.395] (-409.872) -- 0:00:19
182000 -- (-410.901) (-412.519) (-413.025) [-412.828] * (-410.455) (-410.276) [-412.290] (-412.464) -- 0:00:19
182500 -- (-409.083) (-410.035) [-409.982] (-411.487) * (-413.199) (-410.263) (-411.590) [-410.206] -- 0:00:19
183000 -- (-409.261) [-411.351] (-415.932) (-413.361) * (-412.323) (-412.232) [-410.117] (-412.645) -- 0:00:19
183500 -- [-411.785] (-411.111) (-416.363) (-410.475) * (-412.980) (-412.383) [-410.166] (-410.119) -- 0:00:18
184000 -- (-409.379) (-411.380) [-411.185] (-411.391) * (-410.364) (-413.265) [-410.935] (-412.541) -- 0:00:18
184500 -- (-411.103) (-411.786) (-409.480) [-412.055] * [-411.033] (-416.943) (-411.105) (-411.766) -- 0:00:18
185000 -- (-411.675) (-414.750) [-411.074] (-412.357) * (-410.174) (-411.742) (-409.813) [-409.260] -- 0:00:18
Average standard deviation of split frequencies: 0.017017
185500 -- [-411.834] (-411.450) (-409.637) (-411.520) * (-413.731) (-411.508) (-410.973) [-409.864] -- 0:00:18
186000 -- (-412.933) (-409.799) (-411.247) [-410.808] * (-411.953) (-412.112) (-413.747) [-410.201] -- 0:00:18
186500 -- (-410.380) [-413.058] (-410.916) (-411.716) * [-411.511] (-409.758) (-410.776) (-413.091) -- 0:00:18
187000 -- (-411.824) (-417.983) (-410.834) [-413.010] * (-412.410) [-409.226] (-411.353) (-413.845) -- 0:00:18
187500 -- (-409.960) (-411.630) [-412.131] (-411.789) * [-411.856] (-409.747) (-410.442) (-409.813) -- 0:00:18
188000 -- (-412.233) (-415.963) (-410.106) [-413.242] * (-411.294) [-412.473] (-414.520) (-410.271) -- 0:00:18
188500 -- (-412.294) (-409.501) (-411.054) [-410.495] * (-413.448) [-413.267] (-411.746) (-409.341) -- 0:00:19
189000 -- (-411.453) (-412.585) (-413.175) [-411.228] * [-409.897] (-412.697) (-412.281) (-410.830) -- 0:00:19
189500 -- [-411.330] (-409.989) (-413.072) (-411.679) * (-410.736) [-412.113] (-414.576) (-411.740) -- 0:00:19
190000 -- (-414.119) (-409.596) [-411.913] (-410.116) * (-414.389) [-409.813] (-413.683) (-413.469) -- 0:00:19
Average standard deviation of split frequencies: 0.018790
190500 -- (-412.244) [-411.587] (-412.884) (-410.816) * (-411.058) [-410.490] (-413.829) (-411.616) -- 0:00:19
191000 -- [-411.015] (-411.573) (-410.638) (-411.089) * (-409.967) [-410.331] (-411.121) (-409.651) -- 0:00:19
191500 -- (-410.854) (-411.191) [-410.449] (-411.705) * (-410.191) (-409.772) (-413.734) [-410.431] -- 0:00:19
192000 -- (-409.904) (-413.789) [-410.726] (-412.636) * (-412.036) (-411.598) (-414.812) [-409.691] -- 0:00:19
192500 -- [-411.458] (-411.485) (-410.674) (-412.374) * (-411.885) [-413.867] (-411.230) (-412.156) -- 0:00:19
193000 -- (-411.020) (-409.898) (-411.657) [-412.378] * (-410.383) [-410.133] (-412.940) (-411.308) -- 0:00:19
193500 -- (-414.112) (-413.854) (-411.392) [-415.781] * (-410.766) (-411.913) (-412.791) [-411.139] -- 0:00:19
194000 -- (-413.599) [-410.934] (-412.509) (-412.859) * (-414.051) (-411.974) [-411.456] (-410.963) -- 0:00:18
194500 -- (-409.343) (-410.156) [-410.648] (-412.420) * (-410.613) (-410.229) (-411.407) [-409.770] -- 0:00:18
195000 -- (-411.857) (-410.754) (-410.395) [-412.211] * (-411.032) (-411.247) [-409.703] (-410.717) -- 0:00:18
Average standard deviation of split frequencies: 0.019241
195500 -- (-410.516) (-410.003) (-410.395) [-409.553] * (-412.509) [-410.887] (-411.024) (-410.527) -- 0:00:18
196000 -- (-410.705) (-415.204) [-409.912] (-410.550) * (-412.617) (-413.976) [-410.473] (-413.479) -- 0:00:18
196500 -- (-409.882) (-412.096) (-411.707) [-411.379] * [-411.616] (-410.272) (-412.483) (-413.065) -- 0:00:18
197000 -- (-409.644) (-413.866) (-412.177) [-410.020] * [-413.451] (-412.718) (-413.569) (-410.565) -- 0:00:18
197500 -- [-410.458] (-414.306) (-410.552) (-410.722) * (-410.391) (-415.332) [-411.227] (-409.760) -- 0:00:18
198000 -- (-412.632) [-410.575] (-413.588) (-412.248) * [-413.370] (-411.044) (-412.753) (-413.393) -- 0:00:18
198500 -- [-410.766] (-413.034) (-415.420) (-413.275) * (-412.910) (-413.014) [-411.591] (-415.153) -- 0:00:18
199000 -- (-410.469) (-410.836) (-409.425) [-411.943] * (-410.814) [-410.139] (-411.374) (-413.903) -- 0:00:18
199500 -- (-409.249) (-410.028) [-410.776] (-409.608) * [-411.822] (-412.155) (-414.916) (-412.725) -- 0:00:18
200000 -- (-409.828) (-409.937) [-410.789] (-416.565) * (-413.077) (-410.108) (-418.719) [-409.558] -- 0:00:18
Average standard deviation of split frequencies: 0.019288
200500 -- (-409.564) [-410.244] (-413.504) (-413.000) * [-409.855] (-410.636) (-411.250) (-411.694) -- 0:00:17
201000 -- [-410.132] (-411.862) (-411.616) (-412.084) * (-411.482) (-410.785) [-410.824] (-411.983) -- 0:00:17
201500 -- (-413.283) (-413.824) (-410.159) [-410.867] * (-414.628) (-411.567) [-413.843] (-413.062) -- 0:00:17
202000 -- [-410.675] (-410.604) (-411.586) (-414.587) * [-411.905] (-412.753) (-415.610) (-412.751) -- 0:00:17
202500 -- (-409.967) (-411.646) [-411.677] (-410.298) * (-413.396) (-411.335) (-409.693) [-412.361] -- 0:00:17
203000 -- (-411.703) (-412.392) [-412.074] (-410.436) * [-411.999] (-412.955) (-413.903) (-412.531) -- 0:00:17
203500 -- [-411.351] (-410.798) (-409.815) (-410.407) * (-415.529) (-411.535) (-412.145) [-412.629] -- 0:00:17
204000 -- (-415.948) (-410.265) (-410.093) [-411.328] * (-410.636) (-410.395) (-413.875) [-410.054] -- 0:00:17
204500 -- (-411.049) (-411.750) (-411.278) [-411.089] * (-409.541) [-414.096] (-410.287) (-409.906) -- 0:00:17
205000 -- (-413.677) (-409.381) (-413.113) [-410.795] * (-413.221) (-410.679) [-410.603] (-412.214) -- 0:00:17
Average standard deviation of split frequencies: 0.019150
205500 -- (-412.181) (-409.470) (-411.088) [-410.320] * (-411.128) (-411.682) (-412.512) [-411.632] -- 0:00:18
206000 -- (-414.678) [-409.209] (-409.623) (-411.840) * (-411.822) [-412.238] (-411.474) (-418.380) -- 0:00:18
206500 -- (-409.967) [-415.682] (-410.024) (-410.732) * (-412.116) (-411.774) [-411.170] (-414.487) -- 0:00:18
207000 -- (-411.535) [-412.607] (-409.714) (-412.623) * (-411.172) (-412.521) [-410.952] (-411.027) -- 0:00:18
207500 -- (-412.017) [-410.257] (-410.696) (-413.226) * (-417.806) (-409.794) [-414.445] (-412.934) -- 0:00:18
208000 -- [-413.526] (-411.972) (-414.644) (-413.080) * [-411.636] (-413.385) (-412.096) (-412.606) -- 0:00:18
208500 -- (-410.504) [-410.612] (-410.599) (-410.349) * (-409.447) (-410.169) (-410.841) [-409.376] -- 0:00:18
209000 -- (-411.856) (-411.474) (-411.480) [-413.322] * (-410.024) (-413.070) (-411.556) [-411.058] -- 0:00:18
209500 -- (-409.794) (-409.593) [-410.752] (-420.461) * [-409.344] (-410.843) (-411.213) (-412.607) -- 0:00:18
210000 -- (-411.199) [-410.372] (-410.186) (-413.960) * (-415.956) (-412.540) (-412.551) [-411.480] -- 0:00:17
Average standard deviation of split frequencies: 0.021482
210500 -- [-409.844] (-416.010) (-409.273) (-410.693) * [-413.467] (-413.081) (-411.765) (-410.878) -- 0:00:17
211000 -- (-410.880) (-413.580) (-409.754) [-415.799] * (-416.550) (-412.691) (-414.690) [-410.011] -- 0:00:17
211500 -- (-410.580) (-415.216) (-410.330) [-411.822] * (-412.616) [-409.780] (-410.770) (-410.319) -- 0:00:17
212000 -- (-413.045) [-415.606] (-414.430) (-412.585) * (-410.567) [-412.617] (-409.734) (-413.620) -- 0:00:17
212500 -- (-410.223) [-411.561] (-414.249) (-410.456) * [-412.859] (-412.122) (-410.236) (-411.123) -- 0:00:17
213000 -- (-412.930) [-411.583] (-412.118) (-412.479) * (-410.607) (-411.974) [-410.965] (-409.509) -- 0:00:17
213500 -- (-417.197) (-411.475) (-412.275) [-415.421] * [-412.175] (-409.674) (-414.696) (-410.277) -- 0:00:17
214000 -- (-411.074) [-411.539] (-410.521) (-410.175) * (-411.353) [-412.427] (-413.147) (-410.362) -- 0:00:17
214500 -- (-411.026) [-412.354] (-409.711) (-412.075) * (-413.709) (-411.376) (-410.843) [-410.800] -- 0:00:17
215000 -- (-410.253) (-409.921) (-412.006) [-412.374] * (-410.190) [-411.012] (-410.276) (-411.590) -- 0:00:17
Average standard deviation of split frequencies: 0.020676
215500 -- (-412.188) (-411.825) [-416.497] (-409.216) * (-410.200) [-413.547] (-410.788) (-412.656) -- 0:00:17
216000 -- (-411.113) (-411.809) (-413.754) [-410.699] * (-412.506) (-413.572) [-413.659] (-410.195) -- 0:00:17
216500 -- (-410.464) (-412.381) [-412.847] (-411.143) * (-410.801) [-413.824] (-411.711) (-409.733) -- 0:00:17
217000 -- (-410.287) (-411.118) [-411.591] (-412.456) * (-411.197) (-413.740) (-411.421) [-410.057] -- 0:00:16
217500 -- [-413.396] (-415.979) (-411.432) (-412.313) * [-410.273] (-409.173) (-409.579) (-410.952) -- 0:00:16
218000 -- [-410.729] (-409.855) (-411.377) (-411.835) * (-409.899) (-410.611) [-410.943] (-410.977) -- 0:00:16
218500 -- (-412.261) (-410.200) (-411.255) [-410.970] * (-410.725) (-409.645) (-410.314) [-411.161] -- 0:00:16
219000 -- (-411.177) [-411.190] (-416.619) (-409.885) * [-412.883] (-411.767) (-411.698) (-411.439) -- 0:00:16
219500 -- (-410.991) (-414.435) [-410.829] (-411.437) * [-413.899] (-410.208) (-412.568) (-412.868) -- 0:00:16
220000 -- [-409.476] (-413.662) (-410.982) (-412.047) * [-409.805] (-409.636) (-409.728) (-413.804) -- 0:00:16
Average standard deviation of split frequencies: 0.020351
220500 -- (-412.546) (-411.047) [-414.149] (-410.334) * [-410.476] (-412.435) (-411.939) (-411.307) -- 0:00:16
221000 -- (-410.333) [-411.363] (-409.703) (-410.337) * (-411.090) (-415.132) [-409.708] (-410.185) -- 0:00:16
221500 -- (-409.898) (-416.051) [-409.441] (-412.397) * (-412.098) [-411.433] (-411.839) (-409.475) -- 0:00:16
222000 -- [-414.903] (-412.083) (-415.408) (-410.854) * (-414.202) (-415.731) [-412.341] (-412.839) -- 0:00:16
222500 -- (-412.298) [-412.351] (-415.574) (-410.053) * (-413.378) (-412.129) [-412.773] (-411.365) -- 0:00:16
223000 -- (-418.007) (-413.761) [-412.618] (-413.299) * (-415.789) [-411.695] (-412.556) (-410.899) -- 0:00:17
223500 -- (-411.078) [-412.985] (-411.521) (-412.935) * (-411.119) (-409.875) [-412.252] (-411.059) -- 0:00:17
224000 -- (-411.932) [-410.122] (-412.834) (-412.296) * (-410.916) [-413.079] (-410.216) (-414.531) -- 0:00:17
224500 -- (-412.639) [-409.809] (-413.307) (-413.670) * (-411.191) [-411.778] (-414.684) (-411.725) -- 0:00:17
225000 -- (-414.703) (-411.465) [-409.721] (-411.067) * (-410.231) (-412.491) (-411.138) [-409.983] -- 0:00:17
Average standard deviation of split frequencies: 0.019322
225500 -- (-410.703) (-412.216) [-411.962] (-410.170) * (-412.012) [-411.229] (-413.032) (-411.058) -- 0:00:17
226000 -- (-410.777) [-412.576] (-410.471) (-411.267) * (-412.492) [-411.351] (-412.346) (-411.856) -- 0:00:16
226500 -- [-409.733] (-414.922) (-411.585) (-411.813) * (-409.735) [-410.028] (-411.291) (-418.573) -- 0:00:16
227000 -- (-412.360) (-417.295) [-410.598] (-417.240) * [-410.343] (-410.854) (-411.625) (-412.409) -- 0:00:16
227500 -- (-412.865) (-412.028) (-410.653) [-412.585] * (-413.137) [-412.232] (-413.482) (-410.451) -- 0:00:16
228000 -- (-413.342) (-414.150) (-410.828) [-417.524] * (-414.313) (-410.830) (-416.371) [-414.431] -- 0:00:16
228500 -- (-412.164) (-415.141) (-412.515) [-411.221] * (-411.006) (-410.520) [-412.038] (-410.646) -- 0:00:16
229000 -- (-411.728) (-414.303) (-409.703) [-410.139] * (-409.551) (-411.818) (-414.207) [-412.346] -- 0:00:16
229500 -- (-410.257) [-409.777] (-411.976) (-410.568) * (-417.333) (-410.913) [-411.804] (-410.348) -- 0:00:16
230000 -- (-409.718) [-411.944] (-410.132) (-412.335) * (-411.841) (-411.106) (-411.208) [-410.414] -- 0:00:16
Average standard deviation of split frequencies: 0.018070
230500 -- (-410.607) (-409.907) [-409.916] (-414.968) * (-412.949) (-410.449) [-409.492] (-414.489) -- 0:00:16
231000 -- (-420.254) [-412.771] (-412.688) (-416.118) * (-414.613) [-414.596] (-411.053) (-418.874) -- 0:00:16
231500 -- [-416.074] (-410.175) (-410.089) (-412.684) * (-410.017) (-413.100) (-413.855) [-412.056] -- 0:00:16
232000 -- (-411.752) (-410.758) [-412.581] (-412.706) * (-412.207) [-409.960] (-414.440) (-411.531) -- 0:00:16
232500 -- (-412.020) (-415.703) (-410.692) [-411.261] * [-409.535] (-411.018) (-412.855) (-409.915) -- 0:00:16
233000 -- (-412.331) (-414.554) (-411.894) [-415.083] * (-409.887) [-410.235] (-410.367) (-412.548) -- 0:00:16
233500 -- (-416.307) [-412.435] (-410.844) (-416.351) * (-413.534) [-409.315] (-413.270) (-412.269) -- 0:00:15
234000 -- (-412.218) (-410.473) [-413.493] (-410.101) * (-410.439) (-412.234) [-414.312] (-411.219) -- 0:00:15
234500 -- [-413.625] (-410.584) (-416.289) (-412.944) * (-411.726) (-411.124) (-412.334) [-410.682] -- 0:00:15
235000 -- (-413.798) (-411.441) (-411.948) [-413.099] * (-412.489) (-412.568) [-414.071] (-411.581) -- 0:00:15
Average standard deviation of split frequencies: 0.016716
235500 -- [-412.311] (-412.688) (-410.444) (-411.652) * (-410.190) (-411.118) (-413.124) [-412.768] -- 0:00:15
236000 -- [-410.766] (-412.440) (-414.828) (-411.429) * (-410.900) [-409.867] (-410.754) (-412.918) -- 0:00:15
236500 -- [-410.016] (-415.379) (-409.638) (-410.369) * (-412.904) (-412.049) [-410.975] (-411.419) -- 0:00:15
237000 -- (-411.811) [-411.437] (-411.211) (-409.746) * [-411.273] (-414.397) (-410.836) (-411.038) -- 0:00:15
237500 -- (-409.918) (-411.510) (-411.103) [-409.207] * (-417.134) (-410.611) (-413.655) [-410.578] -- 0:00:15
238000 -- (-411.688) (-412.487) [-410.332] (-411.806) * (-415.473) [-409.863] (-412.368) (-410.594) -- 0:00:15
238500 -- (-413.288) (-417.481) [-413.183] (-411.546) * (-410.591) (-413.499) [-409.043] (-410.370) -- 0:00:15
239000 -- (-409.258) [-410.931] (-412.981) (-412.934) * [-413.509] (-412.833) (-410.643) (-410.805) -- 0:00:15
239500 -- [-412.481] (-414.027) (-412.372) (-409.924) * [-410.427] (-413.714) (-409.940) (-410.627) -- 0:00:15
240000 -- (-411.970) (-409.298) (-412.529) [-410.972] * (-409.172) (-414.842) (-409.403) [-409.924] -- 0:00:16
Average standard deviation of split frequencies: 0.016495
240500 -- [-411.926] (-411.126) (-411.120) (-411.635) * [-411.472] (-412.560) (-411.323) (-411.299) -- 0:00:16
241000 -- (-410.435) (-411.825) [-411.020] (-414.987) * (-412.231) (-410.361) (-410.763) [-414.548] -- 0:00:16
241500 -- (-410.089) (-409.951) [-409.835] (-413.181) * (-410.358) (-410.161) (-412.262) [-411.178] -- 0:00:16
242000 -- [-412.396] (-416.595) (-412.636) (-411.703) * (-412.593) [-410.832] (-411.529) (-411.465) -- 0:00:15
242500 -- (-416.980) (-411.257) (-411.243) [-409.243] * (-412.349) [-410.131] (-409.318) (-410.803) -- 0:00:15
243000 -- (-413.280) (-409.401) [-410.129] (-411.156) * (-412.427) (-411.888) [-412.196] (-413.757) -- 0:00:15
243500 -- [-413.725] (-409.549) (-410.881) (-411.617) * (-410.576) [-409.940] (-410.805) (-413.224) -- 0:00:15
244000 -- (-417.388) (-412.749) (-409.696) [-409.181] * (-413.146) (-410.328) (-413.939) [-412.389] -- 0:00:15
244500 -- (-413.716) (-410.189) (-411.993) [-410.896] * (-411.768) [-410.894] (-410.739) (-410.568) -- 0:00:15
245000 -- (-412.241) [-411.121] (-410.000) (-414.469) * [-412.420] (-412.313) (-410.202) (-411.760) -- 0:00:15
Average standard deviation of split frequencies: 0.016576
245500 -- (-409.591) [-412.981] (-413.358) (-410.933) * (-412.314) [-412.217] (-410.743) (-414.509) -- 0:00:15
246000 -- (-410.479) (-409.850) (-411.126) [-411.147] * (-411.834) [-412.135] (-410.698) (-410.385) -- 0:00:15
246500 -- (-410.869) (-411.298) (-409.742) [-409.634] * (-411.391) (-412.674) (-411.491) [-410.890] -- 0:00:15
247000 -- (-411.082) [-410.159] (-412.296) (-411.054) * (-412.626) (-411.363) (-414.397) [-410.908] -- 0:00:15
247500 -- [-411.074] (-410.559) (-414.478) (-412.193) * (-410.454) (-415.672) (-413.726) [-410.790] -- 0:00:15
248000 -- (-410.736) (-410.142) (-412.138) [-409.864] * (-411.030) [-411.107] (-417.463) (-409.924) -- 0:00:15
248500 -- (-412.709) [-411.264] (-411.560) (-410.781) * (-411.310) (-411.327) [-410.083] (-411.234) -- 0:00:15
249000 -- (-415.870) (-411.679) (-413.826) [-413.878] * (-413.407) (-413.949) (-414.845) [-410.324] -- 0:00:15
249500 -- [-410.622] (-410.335) (-410.382) (-410.428) * (-409.579) (-415.404) [-410.792] (-411.271) -- 0:00:15
250000 -- [-411.324] (-412.079) (-409.939) (-413.106) * (-410.797) (-417.515) [-409.955] (-409.855) -- 0:00:15
Average standard deviation of split frequencies: 0.015243
250500 -- (-411.284) [-410.266] (-416.260) (-411.320) * (-411.302) [-410.318] (-409.485) (-410.543) -- 0:00:14
251000 -- (-410.609) [-411.409] (-411.440) (-416.478) * [-410.985] (-411.049) (-413.990) (-412.423) -- 0:00:14
251500 -- (-414.403) (-409.423) (-411.613) [-414.938] * (-410.860) (-415.416) (-411.376) [-412.609] -- 0:00:14
252000 -- (-412.860) (-410.716) (-411.131) [-413.354] * [-412.397] (-412.347) (-412.188) (-410.636) -- 0:00:14
252500 -- (-415.443) [-411.719] (-410.847) (-412.132) * (-417.613) (-410.504) (-411.422) [-412.277] -- 0:00:14
253000 -- (-411.550) [-411.617] (-415.312) (-411.747) * [-412.882] (-411.503) (-411.039) (-412.690) -- 0:00:14
253500 -- [-411.212] (-411.937) (-411.247) (-412.537) * (-410.461) (-411.141) [-412.136] (-410.082) -- 0:00:14
254000 -- (-411.387) (-410.683) [-409.492] (-410.745) * (-414.444) [-411.885] (-414.677) (-411.207) -- 0:00:14
254500 -- (-413.232) (-412.198) [-409.470] (-411.075) * (-412.197) [-410.257] (-411.717) (-410.530) -- 0:00:14
255000 -- (-410.819) (-412.347) (-409.581) [-413.292] * [-409.401] (-412.265) (-410.350) (-409.318) -- 0:00:14
Average standard deviation of split frequencies: 0.015216
255500 -- (-409.870) [-412.354] (-410.931) (-410.932) * (-409.934) (-413.263) [-413.247] (-411.661) -- 0:00:14
256000 -- (-416.203) (-412.778) [-412.123] (-412.444) * (-411.901) (-410.165) (-412.016) [-412.510] -- 0:00:14
256500 -- [-413.528] (-415.978) (-410.510) (-412.763) * (-411.943) (-409.939) [-411.592] (-415.188) -- 0:00:14
257000 -- (-412.059) [-412.160] (-412.820) (-412.076) * (-410.287) (-411.075) (-410.307) [-411.844] -- 0:00:15
257500 -- (-411.813) (-409.731) [-410.970] (-410.392) * (-412.126) [-411.514] (-410.933) (-410.509) -- 0:00:15
258000 -- (-412.123) (-412.198) [-413.867] (-411.105) * [-412.191] (-411.060) (-410.993) (-411.078) -- 0:00:15
258500 -- (-411.080) [-411.673] (-409.912) (-410.850) * (-409.810) (-412.388) (-414.743) [-411.674] -- 0:00:14
259000 -- [-410.639] (-413.271) (-410.104) (-411.258) * (-412.545) (-412.841) (-411.428) [-411.161] -- 0:00:14
259500 -- (-413.036) [-411.180] (-409.997) (-412.717) * (-412.001) (-413.193) (-410.070) [-409.970] -- 0:00:14
260000 -- (-421.991) [-413.651] (-410.784) (-412.079) * (-410.018) [-413.476] (-409.280) (-409.947) -- 0:00:14
Average standard deviation of split frequencies: 0.015372
260500 -- (-410.864) (-412.797) [-410.371] (-411.998) * (-412.144) [-411.668] (-412.592) (-410.022) -- 0:00:14
261000 -- (-414.768) [-410.608] (-413.614) (-410.266) * [-411.325] (-412.045) (-413.369) (-410.298) -- 0:00:14
261500 -- (-417.248) (-411.162) (-409.545) [-409.388] * (-413.102) (-411.897) [-410.766] (-411.075) -- 0:00:14
262000 -- (-410.652) (-411.204) (-410.067) [-410.754] * (-413.560) [-410.690] (-410.118) (-411.775) -- 0:00:14
262500 -- (-414.233) [-413.407] (-409.723) (-410.019) * (-416.140) [-414.117] (-411.043) (-410.373) -- 0:00:14
263000 -- (-411.270) (-412.514) [-410.866] (-410.045) * (-410.593) (-411.542) [-409.768] (-412.660) -- 0:00:14
263500 -- (-414.609) (-410.493) (-410.194) [-412.619] * [-413.589] (-410.008) (-409.991) (-411.109) -- 0:00:14
264000 -- (-409.751) (-410.612) [-410.314] (-412.808) * (-411.479) [-410.552] (-411.048) (-411.116) -- 0:00:14
264500 -- [-411.619] (-411.964) (-412.384) (-412.230) * [-409.954] (-411.416) (-410.596) (-411.397) -- 0:00:14
265000 -- (-411.650) (-411.078) [-414.525] (-412.522) * [-409.632] (-410.833) (-414.700) (-412.455) -- 0:00:14
Average standard deviation of split frequencies: 0.015483
265500 -- (-414.766) (-412.129) (-415.542) [-409.731] * [-412.819] (-411.904) (-417.385) (-410.662) -- 0:00:14
266000 -- (-413.431) (-412.124) (-411.834) [-412.837] * (-412.764) (-412.383) [-410.818] (-412.983) -- 0:00:14
266500 -- (-411.894) (-410.170) [-413.257] (-415.646) * (-411.482) [-410.971] (-409.006) (-412.567) -- 0:00:14
267000 -- (-413.408) (-414.397) [-409.663] (-409.863) * [-411.464] (-410.607) (-413.926) (-411.704) -- 0:00:13
267500 -- (-414.693) [-411.782] (-411.440) (-410.034) * (-409.596) [-409.595] (-410.865) (-410.897) -- 0:00:13
268000 -- (-414.465) (-411.050) (-411.700) [-410.396] * (-410.709) (-411.591) (-410.117) [-411.808] -- 0:00:13
268500 -- (-411.566) (-414.561) (-413.775) [-410.747] * [-410.870] (-411.184) (-411.079) (-411.557) -- 0:00:13
269000 -- (-411.322) (-412.842) (-412.246) [-411.050] * (-410.523) (-409.990) (-410.674) [-413.283] -- 0:00:13
269500 -- (-410.119) (-413.421) (-410.968) [-410.716] * (-411.907) [-409.741] (-412.052) (-414.162) -- 0:00:13
270000 -- (-409.803) (-412.569) (-410.732) [-410.765] * (-412.637) (-411.433) [-414.715] (-413.099) -- 0:00:13
Average standard deviation of split frequencies: 0.014666
270500 -- [-416.755] (-413.873) (-414.351) (-413.028) * (-410.822) [-410.082] (-412.115) (-416.044) -- 0:00:13
271000 -- (-411.674) (-411.359) [-414.994] (-414.324) * (-411.556) [-410.231] (-412.786) (-415.879) -- 0:00:13
271500 -- [-412.024] (-409.469) (-411.279) (-411.186) * (-412.269) [-412.864] (-411.376) (-409.750) -- 0:00:13
272000 -- (-415.102) [-410.632] (-410.269) (-412.644) * (-412.093) [-409.684] (-413.521) (-409.498) -- 0:00:13
272500 -- (-410.535) [-412.212] (-413.323) (-412.796) * (-411.418) (-411.577) [-411.327] (-409.512) -- 0:00:13
273000 -- (-410.285) (-410.400) (-413.338) [-416.061] * [-411.573] (-419.563) (-412.404) (-411.804) -- 0:00:13
273500 -- [-413.025] (-419.203) (-412.844) (-411.831) * (-419.006) (-411.720) [-412.195] (-414.094) -- 0:00:13
274000 -- (-414.564) (-415.280) [-411.359] (-412.627) * (-410.015) (-410.622) [-411.033] (-411.987) -- 0:00:13
274500 -- (-410.883) (-410.550) (-410.637) [-410.273] * (-416.068) (-412.305) (-411.773) [-409.812] -- 0:00:13
275000 -- (-412.422) [-412.250] (-412.398) (-412.821) * (-411.194) (-411.391) (-412.824) [-410.274] -- 0:00:13
Average standard deviation of split frequencies: 0.014293
275500 -- (-410.834) (-410.048) (-409.745) [-410.430] * [-410.946] (-414.683) (-413.219) (-412.067) -- 0:00:13
276000 -- [-411.248] (-410.671) (-412.947) (-409.962) * (-409.571) (-410.914) (-416.377) [-411.006] -- 0:00:13
276500 -- (-411.212) [-411.462] (-412.195) (-411.239) * [-414.901] (-409.336) (-412.684) (-410.094) -- 0:00:13
277000 -- [-413.042] (-411.545) (-410.288) (-412.117) * (-413.115) (-413.285) (-412.927) [-410.100] -- 0:00:13
277500 -- (-410.388) [-410.966] (-410.234) (-410.920) * (-411.395) (-410.016) (-409.926) [-409.553] -- 0:00:13
278000 -- [-413.812] (-410.565) (-410.753) (-410.616) * [-411.539] (-416.313) (-409.776) (-409.817) -- 0:00:13
278500 -- (-412.687) [-411.043] (-413.136) (-410.447) * (-415.702) (-410.885) (-411.533) [-411.365] -- 0:00:13
279000 -- (-410.370) (-409.842) [-411.351] (-412.774) * [-411.346] (-415.759) (-411.098) (-410.713) -- 0:00:13
279500 -- (-412.088) (-412.100) (-415.086) [-412.658] * (-410.402) (-410.445) [-410.655] (-411.606) -- 0:00:13
280000 -- [-409.605] (-412.318) (-415.600) (-411.982) * (-412.121) (-413.542) (-411.686) [-411.326] -- 0:00:13
Average standard deviation of split frequencies: 0.013250
280500 -- (-411.731) [-411.819] (-412.907) (-416.672) * (-410.298) (-409.661) [-410.886] (-411.616) -- 0:00:13
281000 -- [-410.380] (-409.649) (-410.093) (-418.020) * (-411.974) (-410.358) [-413.883] (-414.099) -- 0:00:13
281500 -- (-413.765) [-410.338] (-411.531) (-412.173) * (-413.637) (-410.360) [-415.797] (-409.601) -- 0:00:13
282000 -- [-414.569] (-409.985) (-409.678) (-413.093) * (-410.004) (-413.042) [-411.729] (-414.064) -- 0:00:13
282500 -- (-412.425) (-412.653) (-411.835) [-409.824] * [-409.631] (-412.060) (-411.241) (-411.606) -- 0:00:13
283000 -- (-413.052) (-412.495) [-412.452] (-413.194) * (-409.702) (-415.924) (-412.176) [-411.103] -- 0:00:13
283500 -- (-414.907) (-410.775) [-413.085] (-411.861) * (-410.294) (-413.131) (-410.342) [-414.382] -- 0:00:12
284000 -- (-414.371) (-412.210) [-411.738] (-414.478) * (-416.785) (-412.830) (-411.003) [-411.109] -- 0:00:12
284500 -- (-410.858) (-414.976) [-410.703] (-410.522) * [-410.656] (-410.827) (-411.155) (-410.586) -- 0:00:12
285000 -- (-411.015) (-411.554) (-410.934) [-409.940] * (-409.988) (-410.644) [-412.111] (-409.914) -- 0:00:12
Average standard deviation of split frequencies: 0.012454
285500 -- (-410.642) (-412.153) [-412.294] (-411.002) * [-412.050] (-410.480) (-412.133) (-411.745) -- 0:00:12
286000 -- [-409.800] (-409.762) (-411.016) (-412.665) * (-415.039) (-411.243) [-410.232] (-413.110) -- 0:00:12
286500 -- (-411.267) (-410.445) (-410.218) [-411.819] * [-414.298] (-409.855) (-412.633) (-411.082) -- 0:00:12
287000 -- [-414.362] (-410.776) (-410.598) (-409.452) * (-410.966) [-410.525] (-412.712) (-409.856) -- 0:00:12
287500 -- (-411.215) [-409.742] (-413.140) (-410.471) * (-412.939) (-410.135) [-412.036] (-413.396) -- 0:00:12
288000 -- (-411.517) (-410.579) [-409.950] (-414.032) * (-411.987) [-410.262] (-409.687) (-410.486) -- 0:00:12
288500 -- (-410.825) [-410.968] (-409.661) (-412.510) * (-412.745) (-413.497) (-411.206) [-411.741] -- 0:00:12
289000 -- [-410.162] (-413.920) (-409.776) (-411.322) * (-411.367) [-410.666] (-411.091) (-412.920) -- 0:00:12
289500 -- (-415.348) (-412.463) (-412.440) [-412.119] * [-410.917] (-412.578) (-412.628) (-411.355) -- 0:00:12
290000 -- (-412.773) (-411.029) (-412.940) [-409.807] * (-412.282) (-410.497) (-411.083) [-409.727] -- 0:00:12
Average standard deviation of split frequencies: 0.013966
290500 -- (-412.567) (-412.304) [-413.119] (-410.499) * (-412.678) (-410.079) [-414.689] (-410.780) -- 0:00:12
291000 -- (-410.059) (-419.497) [-411.255] (-412.063) * [-409.179] (-411.350) (-411.106) (-409.629) -- 0:00:12
291500 -- (-412.576) [-412.075] (-411.547) (-410.648) * [-410.447] (-410.777) (-413.294) (-411.263) -- 0:00:12
292000 -- (-409.622) (-410.676) [-411.256] (-410.875) * (-411.465) (-411.776) (-413.585) [-411.066] -- 0:00:12
292500 -- (-410.358) (-411.386) [-411.407] (-415.260) * (-410.255) (-410.678) (-413.065) [-410.202] -- 0:00:12
293000 -- (-411.749) (-413.188) [-409.299] (-412.120) * (-415.542) [-409.753] (-412.489) (-413.358) -- 0:00:12
293500 -- (-412.808) (-410.345) [-409.430] (-410.147) * (-415.263) (-413.334) (-410.910) [-412.250] -- 0:00:12
294000 -- (-411.135) (-412.706) [-412.588] (-410.243) * (-413.765) (-413.051) [-412.557] (-410.904) -- 0:00:12
294500 -- [-410.889] (-417.728) (-412.927) (-411.761) * [-422.514] (-410.632) (-410.306) (-410.023) -- 0:00:12
295000 -- (-411.562) [-412.253] (-415.590) (-409.476) * (-412.165) [-410.427] (-411.436) (-415.596) -- 0:00:12
Average standard deviation of split frequencies: 0.014687
295500 -- [-410.778] (-413.319) (-411.129) (-411.130) * (-413.436) (-414.548) [-411.387] (-413.711) -- 0:00:12
296000 -- (-414.517) (-411.743) (-411.584) [-410.333] * (-410.442) (-412.012) (-411.765) [-411.583] -- 0:00:12
296500 -- (-411.289) (-410.681) [-411.407] (-412.464) * [-411.257] (-411.129) (-411.829) (-409.479) -- 0:00:12
297000 -- (-410.968) (-410.750) (-410.305) [-411.000] * (-414.155) (-413.333) (-411.371) [-412.459] -- 0:00:12
297500 -- (-411.370) [-410.701] (-411.154) (-413.284) * (-410.672) [-415.610] (-409.988) (-411.602) -- 0:00:12
298000 -- [-412.727] (-410.458) (-410.826) (-412.278) * (-413.688) (-411.638) (-411.442) [-410.576] -- 0:00:12
298500 -- (-415.023) [-411.624] (-414.555) (-411.374) * [-410.758] (-410.721) (-412.361) (-410.101) -- 0:00:12
299000 -- (-417.823) [-410.727] (-414.885) (-410.316) * (-410.792) [-414.945] (-410.619) (-409.584) -- 0:00:12
299500 -- (-412.427) (-413.734) (-409.972) [-412.305] * (-409.968) (-413.265) [-411.536] (-409.584) -- 0:00:12
300000 -- (-413.555) [-411.314] (-411.682) (-411.576) * (-410.845) (-413.168) (-412.021) [-409.625] -- 0:00:12
Average standard deviation of split frequencies: 0.014024
300500 -- (-411.405) (-410.144) (-415.039) [-412.222] * (-412.046) (-410.231) [-410.884] (-410.061) -- 0:00:11
301000 -- (-411.021) (-410.720) [-411.844] (-410.423) * (-411.196) [-412.496] (-412.506) (-412.169) -- 0:00:11
301500 -- (-412.590) (-413.241) (-409.519) [-412.720] * (-411.410) [-412.073] (-411.020) (-412.110) -- 0:00:11
302000 -- (-414.538) (-411.836) (-416.655) [-409.766] * (-412.092) (-411.407) (-410.896) [-411.009] -- 0:00:11
302500 -- (-409.846) [-409.228] (-412.981) (-411.179) * (-413.753) (-410.243) [-413.438] (-411.909) -- 0:00:11
303000 -- (-411.025) (-410.582) [-417.291] (-411.179) * [-411.689] (-411.439) (-411.227) (-410.374) -- 0:00:11
303500 -- [-409.594] (-411.293) (-411.626) (-410.914) * (-414.327) [-409.728] (-414.668) (-416.676) -- 0:00:11
304000 -- [-410.337] (-410.455) (-410.071) (-409.660) * (-414.124) [-410.779] (-412.346) (-415.753) -- 0:00:11
304500 -- (-413.960) [-409.624] (-411.844) (-412.217) * [-410.628] (-410.430) (-411.157) (-411.359) -- 0:00:11
305000 -- (-412.391) [-411.462] (-411.390) (-412.193) * (-411.338) [-410.514] (-412.711) (-411.717) -- 0:00:11
Average standard deviation of split frequencies: 0.013266
305500 -- (-412.830) (-412.416) [-411.881] (-410.878) * (-411.740) [-410.518] (-413.449) (-410.417) -- 0:00:11
306000 -- (-413.610) (-409.271) (-412.502) [-410.805] * (-410.802) (-410.697) (-411.877) [-410.149] -- 0:00:11
306500 -- (-410.180) [-409.282] (-409.470) (-414.253) * (-411.802) [-413.128] (-410.780) (-409.231) -- 0:00:11
307000 -- (-410.773) (-409.347) [-409.751] (-412.065) * (-417.628) (-412.261) [-411.392] (-410.009) -- 0:00:11
307500 -- [-416.304] (-410.519) (-411.396) (-410.098) * (-410.164) (-410.894) (-410.045) [-410.176] -- 0:00:11
308000 -- (-416.822) (-413.810) (-412.106) [-410.789] * [-411.291] (-409.797) (-419.018) (-410.573) -- 0:00:11
308500 -- (-413.957) (-412.100) (-411.603) [-410.427] * (-412.001) [-412.042] (-410.723) (-415.370) -- 0:00:11
309000 -- (-411.367) (-411.721) [-410.511] (-410.059) * (-416.893) (-414.899) (-411.986) [-414.624] -- 0:00:11
309500 -- (-412.426) (-413.334) [-412.641] (-413.777) * (-411.885) [-412.049] (-413.119) (-410.852) -- 0:00:11
310000 -- (-412.294) [-412.409] (-412.410) (-417.963) * [-412.789] (-411.898) (-412.359) (-409.923) -- 0:00:11
Average standard deviation of split frequencies: 0.013319
310500 -- (-411.266) [-410.680] (-418.978) (-410.527) * (-409.510) (-417.527) (-409.835) [-409.984] -- 0:00:11
311000 -- (-412.137) (-411.054) (-414.553) [-409.474] * [-411.360] (-411.591) (-411.943) (-413.328) -- 0:00:11
311500 -- (-410.407) [-409.442] (-409.431) (-409.608) * (-411.926) (-410.790) [-411.372] (-410.530) -- 0:00:11
312000 -- (-409.220) (-410.511) (-410.669) [-411.304] * [-409.994] (-411.008) (-413.030) (-413.098) -- 0:00:11
312500 -- (-411.915) [-409.872] (-411.862) (-414.193) * [-416.162] (-410.292) (-409.261) (-412.617) -- 0:00:11
313000 -- (-410.528) (-410.317) (-413.329) [-412.500] * (-412.209) [-411.653] (-413.794) (-411.690) -- 0:00:11
313500 -- (-414.159) (-410.483) (-411.694) [-409.578] * (-411.272) [-412.417] (-409.822) (-409.741) -- 0:00:11
314000 -- (-410.518) (-411.596) [-409.876] (-414.143) * (-416.571) [-410.882] (-412.733) (-412.180) -- 0:00:11
314500 -- (-409.968) (-413.427) [-416.045] (-414.963) * (-410.412) (-412.018) (-412.383) [-411.017] -- 0:00:11
315000 -- (-411.603) [-409.686] (-412.029) (-414.696) * (-410.795) (-411.769) [-410.843] (-419.074) -- 0:00:11
Average standard deviation of split frequencies: 0.013583
315500 -- (-412.359) (-411.940) [-410.949] (-413.321) * [-410.484] (-411.126) (-412.045) (-413.049) -- 0:00:11
316000 -- (-412.364) (-412.511) [-417.913] (-410.697) * (-415.529) (-410.173) (-409.460) [-410.380] -- 0:00:11
316500 -- (-411.142) (-413.144) (-410.869) [-409.460] * (-409.582) [-412.424] (-410.449) (-416.315) -- 0:00:11
317000 -- (-411.340) (-413.153) [-411.563] (-413.349) * (-409.979) [-412.971] (-412.200) (-411.334) -- 0:00:10
317500 -- [-409.820] (-416.123) (-410.147) (-410.651) * (-411.570) [-411.323] (-411.067) (-411.827) -- 0:00:10
318000 -- (-412.410) [-410.690] (-410.140) (-409.496) * (-410.242) [-412.173] (-412.531) (-411.507) -- 0:00:10
318500 -- (-411.789) (-414.152) [-409.597] (-413.371) * (-409.751) (-413.691) [-411.385] (-411.600) -- 0:00:10
319000 -- (-410.846) [-410.225] (-409.278) (-410.955) * (-415.887) (-411.342) (-410.982) [-412.471] -- 0:00:10
319500 -- (-412.602) [-411.275] (-412.857) (-410.996) * (-414.668) (-410.138) [-411.322] (-417.949) -- 0:00:10
320000 -- [-410.505] (-412.569) (-414.814) (-417.024) * (-413.312) [-413.387] (-422.443) (-412.113) -- 0:00:10
Average standard deviation of split frequencies: 0.012659
320500 -- (-410.221) (-412.886) (-410.228) [-413.758] * (-410.710) (-412.195) (-411.334) [-415.324] -- 0:00:10
321000 -- (-410.849) (-410.453) [-410.124] (-413.252) * (-411.172) [-415.313] (-410.797) (-409.919) -- 0:00:10
321500 -- (-412.242) (-415.825) (-412.216) [-410.295] * (-412.309) [-410.822] (-412.914) (-411.603) -- 0:00:10
322000 -- (-409.864) (-410.768) [-411.803] (-409.172) * (-411.378) [-412.403] (-411.304) (-409.406) -- 0:00:10
322500 -- (-412.532) (-411.057) (-410.555) [-411.130] * (-412.939) (-412.062) (-413.489) [-409.538] -- 0:00:10
323000 -- (-411.167) (-410.617) (-411.595) [-409.468] * (-412.816) (-415.566) [-412.238] (-412.550) -- 0:00:10
323500 -- [-409.677] (-412.924) (-413.352) (-410.608) * (-411.254) (-414.274) [-412.021] (-413.431) -- 0:00:10
324000 -- (-410.374) (-413.975) [-411.064] (-410.212) * [-410.251] (-409.642) (-410.411) (-410.930) -- 0:00:10
324500 -- (-411.664) [-411.208] (-414.597) (-411.199) * (-412.140) (-411.246) (-409.980) [-412.050] -- 0:00:10
325000 -- (-411.001) [-409.597] (-412.412) (-412.217) * (-413.987) (-410.726) (-410.491) [-413.413] -- 0:00:10
Average standard deviation of split frequencies: 0.012693
325500 -- (-409.863) (-410.157) (-412.364) [-409.628] * (-413.670) [-411.748] (-410.307) (-414.407) -- 0:00:10
326000 -- (-411.225) [-409.319] (-411.220) (-409.417) * [-412.168] (-410.902) (-410.477) (-409.676) -- 0:00:10
326500 -- [-412.121] (-409.391) (-411.113) (-412.659) * [-412.870] (-413.320) (-411.461) (-411.561) -- 0:00:10
327000 -- (-417.845) (-411.879) (-409.527) [-410.740] * (-414.571) [-412.813] (-411.856) (-410.650) -- 0:00:10
327500 -- (-411.752) [-411.487] (-410.882) (-411.920) * (-411.724) (-412.691) [-410.424] (-410.177) -- 0:00:10
328000 -- (-411.806) (-410.006) [-411.666] (-412.760) * (-410.676) (-410.584) (-410.409) [-410.027] -- 0:00:10
328500 -- (-411.188) (-413.706) (-410.820) [-411.410] * (-414.517) (-410.333) [-410.245] (-413.040) -- 0:00:10
329000 -- (-415.031) (-409.078) (-413.880) [-414.142] * (-411.023) (-409.974) (-412.158) [-411.145] -- 0:00:10
329500 -- (-413.853) [-409.199] (-413.423) (-412.589) * (-413.855) (-411.196) [-413.659] (-410.523) -- 0:00:10
330000 -- [-411.270] (-415.663) (-410.424) (-411.624) * (-412.892) [-411.079] (-409.679) (-410.475) -- 0:00:10
Average standard deviation of split frequencies: 0.011959
330500 -- [-411.855] (-410.091) (-414.024) (-413.323) * [-412.859] (-412.040) (-410.422) (-410.999) -- 0:00:10
331000 -- [-409.864] (-412.052) (-414.727) (-410.631) * (-410.112) (-411.423) [-410.029] (-410.643) -- 0:00:10
331500 -- (-411.968) (-411.177) [-414.034] (-413.406) * [-415.657] (-411.690) (-409.942) (-415.817) -- 0:00:10
332000 -- [-412.906] (-410.444) (-411.461) (-409.265) * [-412.101] (-410.758) (-412.566) (-417.718) -- 0:00:10
332500 -- (-409.476) (-410.757) [-409.473] (-410.190) * (-413.649) [-412.125] (-411.444) (-410.278) -- 0:00:10
333000 -- [-410.356] (-413.123) (-410.343) (-410.121) * (-416.899) (-411.591) [-411.252] (-412.406) -- 0:00:10
333500 -- [-410.779] (-413.950) (-415.965) (-414.241) * (-417.197) (-411.408) [-411.459] (-412.550) -- 0:00:09
334000 -- (-410.043) (-410.698) (-410.861) [-410.055] * (-412.394) (-412.563) [-410.882] (-410.259) -- 0:00:09
334500 -- (-414.908) [-409.720] (-411.614) (-412.776) * (-411.841) (-414.844) (-412.522) [-410.222] -- 0:00:09
335000 -- [-412.891] (-412.012) (-412.635) (-412.422) * (-414.233) (-414.609) (-410.349) [-410.042] -- 0:00:09
Average standard deviation of split frequencies: 0.011141
335500 -- [-409.417] (-412.203) (-413.413) (-414.103) * (-415.846) [-411.479] (-411.417) (-411.594) -- 0:00:09
336000 -- (-409.951) (-412.522) (-412.829) [-410.638] * (-410.337) [-409.871] (-411.673) (-413.252) -- 0:00:09
336500 -- [-409.950] (-411.217) (-412.690) (-410.628) * (-409.934) [-411.685] (-411.110) (-410.610) -- 0:00:09
337000 -- (-410.226) (-409.580) [-411.678] (-410.564) * (-411.008) [-412.117] (-415.192) (-409.757) -- 0:00:09
337500 -- (-409.776) (-409.396) [-412.515] (-409.573) * (-410.432) (-411.655) [-411.448] (-412.672) -- 0:00:09
338000 -- (-415.281) (-410.099) (-410.955) [-410.534] * (-411.333) [-413.991] (-411.948) (-412.291) -- 0:00:09
338500 -- [-411.004] (-409.940) (-414.053) (-411.362) * (-411.317) (-418.597) [-414.948] (-411.250) -- 0:00:09
339000 -- (-410.230) [-414.379] (-413.302) (-415.363) * (-410.334) [-411.008] (-412.595) (-410.140) -- 0:00:09
339500 -- (-410.840) (-410.341) (-414.085) [-411.049] * [-410.776] (-411.422) (-410.549) (-409.647) -- 0:00:09
340000 -- (-409.613) (-411.673) [-412.684] (-409.805) * [-413.961] (-411.753) (-410.400) (-409.632) -- 0:00:09
Average standard deviation of split frequencies: 0.011147
340500 -- [-412.629] (-414.524) (-412.945) (-410.700) * (-412.766) (-411.931) [-409.864] (-409.485) -- 0:00:09
341000 -- (-410.600) [-412.202] (-412.549) (-410.062) * [-412.010] (-413.526) (-410.777) (-410.965) -- 0:00:09
341500 -- (-414.818) [-412.283] (-411.843) (-411.663) * [-411.045] (-414.396) (-411.219) (-411.590) -- 0:00:09
342000 -- [-409.082] (-412.596) (-409.872) (-422.787) * [-409.967] (-412.906) (-411.752) (-409.674) -- 0:00:09
342500 -- (-413.854) (-413.391) (-410.871) [-412.882] * (-411.284) [-410.324] (-409.940) (-414.287) -- 0:00:09
343000 -- (-410.399) [-410.994] (-409.693) (-412.275) * [-413.365] (-411.224) (-410.416) (-412.969) -- 0:00:09
343500 -- (-410.962) (-410.822) [-409.795] (-409.409) * (-412.996) (-413.357) (-410.377) [-410.641] -- 0:00:09
344000 -- (-412.754) (-409.586) [-410.433] (-409.915) * [-410.982] (-413.560) (-410.096) (-409.581) -- 0:00:09
344500 -- [-411.706] (-414.474) (-413.074) (-409.973) * (-411.514) (-411.079) (-412.324) [-412.817] -- 0:00:09
345000 -- (-412.096) (-415.679) [-410.958] (-409.687) * [-411.602] (-411.071) (-412.722) (-413.606) -- 0:00:09
Average standard deviation of split frequencies: 0.011051
345500 -- (-411.184) (-414.328) (-409.588) [-409.651] * (-411.343) (-410.544) (-413.529) [-415.457] -- 0:00:09
346000 -- (-409.154) (-414.343) (-416.093) [-410.630] * (-409.410) (-410.608) (-410.985) [-410.487] -- 0:00:09
346500 -- (-409.807) (-411.242) [-412.473] (-411.878) * (-411.434) (-410.783) (-412.082) [-410.662] -- 0:00:09
347000 -- (-410.864) (-413.928) [-412.441] (-411.057) * (-413.927) (-415.824) [-412.977] (-411.516) -- 0:00:09
347500 -- (-409.201) (-411.292) [-412.104] (-410.880) * (-409.607) (-409.794) (-412.007) [-409.684] -- 0:00:09
348000 -- (-409.918) (-409.326) (-409.716) [-410.580] * (-412.002) (-410.979) [-410.148] (-410.304) -- 0:00:09
348500 -- (-412.935) (-409.598) [-410.418] (-411.333) * (-411.435) (-412.896) (-412.360) [-411.469] -- 0:00:09
349000 -- [-414.083] (-409.805) (-416.978) (-414.490) * [-411.491] (-411.107) (-409.355) (-413.215) -- 0:00:09
349500 -- [-412.875] (-412.868) (-410.106) (-411.083) * (-411.911) [-410.053] (-412.245) (-411.979) -- 0:00:09
350000 -- (-410.798) (-410.363) (-411.732) [-410.637] * (-411.184) (-409.989) [-414.060] (-412.766) -- 0:00:09
Average standard deviation of split frequencies: 0.010381
350500 -- (-411.115) [-410.539] (-411.057) (-413.078) * (-413.215) (-409.979) (-410.493) [-411.362] -- 0:00:08
351000 -- (-411.105) [-413.848] (-410.867) (-410.900) * (-409.550) (-410.821) [-409.324] (-412.491) -- 0:00:08
351500 -- (-412.736) [-409.581] (-413.018) (-410.520) * (-414.159) (-412.522) (-411.647) [-413.721] -- 0:00:08
352000 -- (-414.399) (-410.626) (-411.394) [-411.124] * [-410.712] (-409.888) (-415.241) (-417.690) -- 0:00:08
352500 -- (-418.792) (-411.435) (-412.577) [-411.234] * (-409.933) [-412.855] (-411.576) (-418.820) -- 0:00:08
353000 -- (-410.935) (-412.061) (-409.851) [-413.570] * [-411.729] (-411.410) (-412.514) (-420.302) -- 0:00:08
353500 -- (-413.132) (-409.809) (-412.004) [-411.944] * [-410.331] (-410.652) (-412.485) (-416.766) -- 0:00:08
354000 -- (-410.745) [-410.210] (-410.646) (-416.133) * (-414.339) (-410.448) [-409.944] (-412.324) -- 0:00:08
354500 -- (-411.519) [-412.736] (-410.084) (-416.383) * (-411.974) (-411.514) [-412.733] (-410.047) -- 0:00:08
355000 -- (-410.493) [-414.016] (-410.804) (-417.240) * (-413.028) (-411.747) (-413.787) [-413.261] -- 0:00:08
Average standard deviation of split frequencies: 0.010446
355500 -- (-409.425) (-412.181) (-409.663) [-414.072] * (-409.752) (-412.860) (-413.782) [-413.041] -- 0:00:08
356000 -- [-410.413] (-411.929) (-417.128) (-410.618) * (-410.652) (-413.901) (-416.471) [-413.050] -- 0:00:08
356500 -- (-410.483) (-412.332) (-410.659) [-410.561] * (-410.216) (-410.228) [-410.355] (-411.843) -- 0:00:08
357000 -- [-413.309] (-412.707) (-410.962) (-412.469) * (-410.207) [-411.590] (-411.582) (-410.722) -- 0:00:08
357500 -- (-410.447) (-412.029) (-410.629) [-410.002] * (-409.992) (-411.799) (-409.942) [-411.667] -- 0:00:08
358000 -- [-409.516] (-412.110) (-410.489) (-409.978) * (-409.998) [-410.700] (-412.347) (-412.045) -- 0:00:08
358500 -- (-411.413) (-410.807) [-414.556] (-409.448) * (-410.799) (-412.771) (-410.414) [-411.883] -- 0:00:08
359000 -- [-409.208] (-412.925) (-411.282) (-412.984) * (-415.343) (-411.031) (-411.901) [-410.606] -- 0:00:08
359500 -- (-409.504) (-410.228) [-411.484] (-414.168) * [-409.361] (-409.746) (-411.765) (-411.635) -- 0:00:08
360000 -- (-410.790) (-409.886) [-411.609] (-413.760) * [-411.587] (-410.251) (-409.717) (-412.973) -- 0:00:08
Average standard deviation of split frequencies: 0.010303
360500 -- (-411.139) (-410.357) (-411.446) [-411.576] * (-410.751) (-410.735) [-409.923] (-412.514) -- 0:00:08
361000 -- (-410.798) (-411.315) [-411.243] (-411.318) * (-413.259) [-410.735] (-412.374) (-412.648) -- 0:00:08
361500 -- (-412.778) (-410.263) [-412.437] (-412.284) * (-416.083) (-411.186) (-411.192) [-413.203] -- 0:00:08
362000 -- [-410.575] (-410.186) (-410.175) (-411.455) * (-413.918) [-409.135] (-413.973) (-411.363) -- 0:00:08
362500 -- (-413.190) (-410.882) [-409.955] (-410.576) * (-414.214) [-410.969] (-413.802) (-409.954) -- 0:00:08
363000 -- (-410.557) [-412.620] (-410.299) (-410.605) * (-415.239) [-410.526] (-413.137) (-411.753) -- 0:00:08
363500 -- [-410.202] (-409.887) (-410.787) (-412.881) * [-412.366] (-410.030) (-412.841) (-409.435) -- 0:00:08
364000 -- [-413.489] (-414.429) (-409.397) (-411.743) * (-413.474) [-413.763] (-410.965) (-410.884) -- 0:00:08
364500 -- (-413.046) (-412.888) (-412.607) [-411.581] * (-414.830) (-417.138) (-411.889) [-412.838] -- 0:00:08
365000 -- (-410.728) (-410.890) [-411.224] (-412.044) * (-411.185) (-409.751) (-412.375) [-411.215] -- 0:00:08
Average standard deviation of split frequencies: 0.010077
365500 -- [-410.862] (-415.559) (-411.918) (-410.411) * (-411.160) [-410.731] (-412.930) (-413.502) -- 0:00:08
366000 -- (-410.570) [-409.417] (-410.934) (-412.149) * (-411.474) (-412.535) (-409.636) [-410.388] -- 0:00:08
366500 -- (-410.223) (-409.709) (-409.771) [-411.384] * (-409.636) (-411.007) [-409.960] (-410.139) -- 0:00:08
367000 -- [-413.875] (-410.580) (-410.519) (-411.136) * [-411.816] (-411.160) (-410.242) (-413.117) -- 0:00:07
367500 -- (-412.203) (-413.838) [-412.202] (-413.509) * (-409.423) (-412.389) (-419.845) [-416.527] -- 0:00:07
368000 -- (-412.390) (-410.951) (-410.274) [-411.666] * (-410.278) [-413.700] (-411.123) (-411.670) -- 0:00:07
368500 -- [-410.075] (-415.798) (-413.989) (-409.674) * [-411.033] (-410.185) (-409.914) (-412.611) -- 0:00:07
369000 -- [-409.434] (-410.957) (-410.395) (-416.251) * [-410.779] (-409.574) (-409.710) (-410.030) -- 0:00:07
369500 -- [-409.937] (-411.365) (-410.197) (-414.503) * (-411.064) (-411.996) (-410.892) [-409.935] -- 0:00:07
370000 -- (-411.055) [-412.271] (-412.019) (-410.455) * (-410.767) [-410.446] (-410.120) (-409.698) -- 0:00:07
Average standard deviation of split frequencies: 0.009725
370500 -- (-410.066) (-412.781) (-410.409) [-410.417] * (-411.357) (-410.839) (-410.002) [-414.109] -- 0:00:07
371000 -- [-410.552] (-409.179) (-413.994) (-412.996) * (-411.162) [-411.466] (-414.915) (-411.536) -- 0:00:07
371500 -- (-410.630) [-411.666] (-410.008) (-414.332) * (-411.918) [-410.326] (-412.178) (-410.742) -- 0:00:07
372000 -- [-411.699] (-410.755) (-411.895) (-415.376) * (-410.482) [-411.068] (-412.265) (-409.759) -- 0:00:07
372500 -- (-411.590) (-410.086) [-411.290] (-410.204) * (-412.366) [-412.054] (-415.725) (-410.490) -- 0:00:07
373000 -- (-410.398) [-410.263] (-410.814) (-413.294) * (-414.467) (-414.440) (-411.478) [-409.626] -- 0:00:07
373500 -- (-410.902) (-412.485) (-410.984) [-410.844] * [-410.848] (-410.421) (-411.671) (-412.583) -- 0:00:07
374000 -- [-410.313] (-414.837) (-411.420) (-411.109) * (-410.884) [-412.819] (-410.056) (-412.131) -- 0:00:07
374500 -- (-410.342) [-410.356] (-410.589) (-410.033) * (-412.907) [-410.049] (-410.590) (-411.899) -- 0:00:07
375000 -- (-410.927) (-410.196) [-410.132] (-412.426) * [-411.583] (-413.602) (-411.616) (-417.346) -- 0:00:07
Average standard deviation of split frequencies: 0.009440
375500 -- (-410.198) (-413.399) [-411.177] (-412.183) * [-410.856] (-412.742) (-410.132) (-411.293) -- 0:00:07
376000 -- (-411.633) (-413.534) (-413.363) [-412.595] * (-415.480) (-411.660) [-411.695] (-415.795) -- 0:00:07
376500 -- (-412.124) (-410.978) (-410.500) [-411.435] * (-410.471) [-409.977] (-412.765) (-412.111) -- 0:00:07
377000 -- (-412.461) (-412.535) (-412.930) [-409.175] * (-415.173) (-409.987) [-412.383] (-415.663) -- 0:00:07
377500 -- (-410.432) (-412.072) [-410.102] (-411.359) * (-414.048) (-410.154) [-409.664] (-412.255) -- 0:00:07
378000 -- (-411.696) (-411.243) (-409.402) [-410.667] * [-411.778] (-411.393) (-411.228) (-413.862) -- 0:00:07
378500 -- (-412.464) [-410.258] (-410.184) (-416.193) * (-411.139) [-410.322] (-411.012) (-413.227) -- 0:00:07
379000 -- (-409.799) (-411.596) (-412.415) [-411.307] * (-411.096) (-417.446) [-414.446] (-411.359) -- 0:00:07
379500 -- (-411.747) (-411.939) (-410.518) [-410.517] * (-409.730) (-412.693) (-416.620) [-409.973] -- 0:00:07
380000 -- (-413.732) [-410.724] (-411.074) (-411.591) * [-411.354] (-412.937) (-413.773) (-415.499) -- 0:00:07
Average standard deviation of split frequencies: 0.008887
380500 -- (-411.065) (-411.716) (-410.931) [-411.689] * (-410.533) (-413.085) [-410.023] (-410.675) -- 0:00:07
381000 -- (-412.139) (-409.798) [-414.103] (-411.229) * (-418.937) [-410.644] (-409.497) (-411.164) -- 0:00:07
381500 -- (-410.847) [-411.301] (-409.866) (-413.487) * (-412.227) [-413.517] (-409.372) (-411.000) -- 0:00:07
382000 -- [-410.056] (-412.266) (-410.379) (-417.200) * (-410.091) (-411.810) [-409.740] (-412.139) -- 0:00:07
382500 -- (-411.566) (-414.698) [-410.469] (-411.680) * (-410.565) [-412.478] (-411.366) (-410.565) -- 0:00:07
383000 -- [-412.539] (-411.550) (-411.463) (-409.993) * (-409.937) [-411.319] (-414.430) (-411.170) -- 0:00:07
383500 -- (-411.080) (-410.529) (-410.608) [-413.175] * [-410.092] (-409.998) (-414.452) (-413.085) -- 0:00:06
384000 -- (-411.121) (-410.215) [-410.012] (-411.319) * [-412.057] (-410.436) (-412.991) (-412.781) -- 0:00:06
384500 -- (-409.789) (-411.872) (-412.379) [-409.697] * (-413.856) (-414.071) (-413.487) [-410.889] -- 0:00:06
385000 -- (-411.644) (-414.053) [-415.101] (-409.507) * (-410.786) (-412.341) (-412.149) [-412.750] -- 0:00:06
Average standard deviation of split frequencies: 0.009555
385500 -- (-412.247) (-412.226) [-414.974] (-412.161) * (-415.612) (-413.864) [-410.833] (-411.526) -- 0:00:06
386000 -- (-415.524) (-415.636) [-411.040] (-411.763) * (-409.573) (-413.892) [-411.351] (-409.653) -- 0:00:06
386500 -- (-410.502) [-418.218] (-411.782) (-414.451) * (-410.714) (-412.275) (-412.078) [-410.449] -- 0:00:06
387000 -- [-412.464] (-410.944) (-411.618) (-411.502) * [-414.462] (-414.543) (-414.150) (-410.882) -- 0:00:06
387500 -- [-411.629] (-413.377) (-412.208) (-414.139) * [-418.192] (-414.414) (-410.679) (-414.884) -- 0:00:06
388000 -- [-410.606] (-412.435) (-411.708) (-413.137) * (-411.464) [-409.406] (-414.541) (-415.297) -- 0:00:06
388500 -- (-411.666) (-410.955) [-412.005] (-412.629) * (-412.083) [-411.701] (-412.879) (-409.899) -- 0:00:06
389000 -- (-414.367) (-410.862) (-412.838) [-412.363] * (-410.248) [-412.498] (-412.874) (-413.829) -- 0:00:06
389500 -- (-411.412) (-411.926) [-411.545] (-411.493) * (-411.412) (-410.355) [-410.206] (-412.729) -- 0:00:06
390000 -- (-412.636) [-411.177] (-411.395) (-415.028) * (-410.207) [-410.050] (-410.542) (-412.765) -- 0:00:06
Average standard deviation of split frequencies: 0.009582
390500 -- (-411.014) (-416.056) [-412.677] (-412.637) * (-413.062) (-410.761) [-412.854] (-410.924) -- 0:00:06
391000 -- (-416.205) [-413.090] (-410.236) (-413.505) * (-410.162) [-410.060] (-412.931) (-410.151) -- 0:00:06
391500 -- (-416.577) (-413.195) (-410.784) [-412.981] * [-410.241] (-409.514) (-413.849) (-410.030) -- 0:00:06
392000 -- (-412.302) [-415.338] (-412.135) (-416.810) * [-410.195] (-409.437) (-413.718) (-409.494) -- 0:00:06
392500 -- (-418.136) (-411.049) (-412.398) [-413.163] * (-409.591) [-409.710] (-415.401) (-411.381) -- 0:00:06
393000 -- (-413.331) (-409.973) [-409.838] (-409.797) * (-416.331) [-409.921] (-412.495) (-409.442) -- 0:00:06
393500 -- (-412.794) [-413.334] (-411.271) (-412.063) * (-410.980) (-410.798) [-410.183] (-413.775) -- 0:00:06
394000 -- [-411.865] (-409.680) (-410.312) (-409.851) * (-410.952) [-412.723] (-413.746) (-412.129) -- 0:00:06
394500 -- (-413.319) [-411.038] (-415.608) (-410.579) * (-413.636) (-411.766) [-409.353] (-411.842) -- 0:00:06
395000 -- (-412.112) [-411.098] (-412.122) (-410.400) * (-409.705) [-409.495] (-411.688) (-410.919) -- 0:00:06
Average standard deviation of split frequencies: 0.007738
395500 -- (-411.849) (-412.283) [-411.833] (-411.988) * [-412.489] (-412.977) (-412.565) (-410.287) -- 0:00:06
396000 -- [-412.746] (-410.858) (-412.020) (-412.031) * (-413.656) (-413.256) [-411.728] (-413.572) -- 0:00:06
396500 -- (-410.543) (-411.606) (-411.643) [-409.389] * (-412.161) (-411.453) (-412.017) [-411.415] -- 0:00:06
397000 -- (-409.760) (-410.105) (-412.418) [-409.756] * [-411.445] (-409.673) (-412.016) (-411.870) -- 0:00:06
397500 -- [-411.313] (-411.722) (-413.018) (-410.046) * (-410.854) (-409.995) (-410.841) [-410.441] -- 0:00:06
398000 -- (-410.068) (-409.951) (-415.048) [-410.984] * (-414.392) (-410.217) [-411.019] (-410.325) -- 0:00:06
398500 -- (-413.860) (-410.682) [-410.503] (-410.366) * [-410.077] (-409.881) (-413.204) (-411.942) -- 0:00:06
399000 -- (-412.639) (-410.902) [-411.908] (-410.950) * [-411.797] (-413.819) (-414.493) (-410.071) -- 0:00:06
399500 -- (-411.915) [-411.774] (-413.283) (-410.773) * (-412.983) [-411.639] (-410.486) (-410.991) -- 0:00:06
400000 -- (-411.064) (-411.591) [-412.604] (-411.591) * (-409.730) (-409.574) (-409.900) [-409.381] -- 0:00:06
Average standard deviation of split frequencies: 0.009118
400500 -- (-410.761) (-409.945) [-410.588] (-409.957) * [-412.441] (-410.273) (-410.007) (-410.395) -- 0:00:05
401000 -- (-411.497) (-409.967) [-410.604] (-412.673) * [-411.283] (-413.272) (-410.888) (-411.447) -- 0:00:05
401500 -- (-417.832) [-409.981] (-411.827) (-409.614) * (-411.895) (-413.407) (-410.874) [-410.731] -- 0:00:05
402000 -- [-416.084] (-409.662) (-409.512) (-409.695) * (-409.544) (-412.115) (-409.717) [-409.437] -- 0:00:05
402500 -- [-410.421] (-415.750) (-412.078) (-410.250) * (-414.164) (-412.913) [-413.283] (-411.263) -- 0:00:05
403000 -- (-410.823) [-413.132] (-410.416) (-409.603) * [-411.184] (-415.592) (-410.499) (-410.110) -- 0:00:05
403500 -- [-410.389] (-412.415) (-414.294) (-413.844) * (-411.496) [-409.882] (-409.443) (-413.502) -- 0:00:05
404000 -- (-414.403) (-411.578) (-413.729) [-409.413] * (-411.686) (-411.179) [-410.635] (-411.144) -- 0:00:05
404500 -- [-410.334] (-412.049) (-410.902) (-409.813) * (-412.030) (-412.298) [-409.507] (-413.667) -- 0:00:05
405000 -- (-411.728) (-418.970) (-411.284) [-409.417] * [-411.271] (-409.503) (-409.625) (-409.993) -- 0:00:05
Average standard deviation of split frequencies: 0.008273
405500 -- (-410.637) [-413.257] (-411.247) (-412.328) * (-410.112) (-409.896) [-409.520] (-410.523) -- 0:00:05
406000 -- (-412.324) (-411.981) [-412.487] (-412.610) * (-410.806) (-412.678) [-413.528] (-410.181) -- 0:00:05
406500 -- [-411.214] (-409.437) (-414.430) (-413.843) * [-413.558] (-412.091) (-410.441) (-412.349) -- 0:00:05
407000 -- (-410.332) [-412.095] (-417.331) (-412.436) * [-409.426] (-410.314) (-414.966) (-413.381) -- 0:00:05
407500 -- (-409.755) (-413.018) (-412.102) [-411.771] * [-409.384] (-412.254) (-414.430) (-417.717) -- 0:00:05
408000 -- (-412.270) (-409.556) [-410.502] (-410.702) * [-410.408] (-412.938) (-413.408) (-412.103) -- 0:00:05
408500 -- (-412.210) [-413.761] (-409.727) (-410.454) * (-410.238) (-414.724) [-410.058] (-412.444) -- 0:00:05
409000 -- [-411.071] (-418.039) (-410.312) (-412.053) * (-411.416) (-410.902) (-411.181) [-411.228] -- 0:00:05
409500 -- [-411.867] (-411.881) (-409.835) (-413.407) * (-412.403) (-409.719) [-411.482] (-410.563) -- 0:00:05
410000 -- (-411.439) (-411.905) (-411.001) [-411.762] * (-411.311) (-409.727) (-413.112) [-411.636] -- 0:00:05
Average standard deviation of split frequencies: 0.009183
410500 -- (-410.606) [-412.255] (-410.658) (-412.195) * (-413.360) [-410.731] (-411.151) (-412.750) -- 0:00:05
411000 -- (-413.351) [-410.569] (-411.773) (-411.683) * [-409.804] (-410.184) (-412.054) (-410.630) -- 0:00:05
411500 -- (-412.906) [-410.681] (-409.508) (-412.008) * [-410.909] (-410.617) (-415.042) (-409.925) -- 0:00:05
412000 -- (-412.107) (-410.876) [-412.030] (-409.611) * (-410.381) (-411.828) (-410.401) [-410.629] -- 0:00:05
412500 -- (-411.360) [-410.397] (-411.617) (-409.979) * (-412.158) (-410.730) (-409.786) [-409.374] -- 0:00:05
413000 -- (-410.090) [-413.213] (-412.721) (-411.583) * (-412.608) (-413.283) (-415.075) [-412.646] -- 0:00:05
413500 -- (-411.177) (-412.234) (-411.095) [-409.612] * (-411.331) [-410.163] (-412.203) (-409.866) -- 0:00:05
414000 -- (-415.359) [-413.132] (-410.404) (-410.303) * (-411.944) (-412.587) [-411.905] (-410.118) -- 0:00:05
414500 -- [-412.336] (-413.161) (-411.877) (-409.836) * [-410.708] (-411.783) (-411.152) (-411.114) -- 0:00:05
415000 -- (-411.489) (-412.950) [-412.386] (-410.141) * (-409.796) (-413.157) [-409.935] (-415.363) -- 0:00:05
Average standard deviation of split frequencies: 0.008853
415500 -- (-413.427) (-416.029) (-409.787) [-410.198] * (-410.934) [-411.340] (-410.336) (-413.478) -- 0:00:05
416000 -- (-410.209) (-411.412) (-410.370) [-411.532] * (-413.416) [-411.969] (-411.720) (-413.779) -- 0:00:05
416500 -- (-410.921) [-411.350] (-411.187) (-412.606) * (-410.203) (-410.011) [-411.578] (-419.351) -- 0:00:05
417000 -- (-410.783) [-412.188] (-413.353) (-409.849) * (-412.376) [-410.614] (-410.920) (-413.654) -- 0:00:04
417500 -- (-410.629) [-410.183] (-412.854) (-409.418) * (-411.622) (-410.652) [-409.994] (-411.783) -- 0:00:04
418000 -- (-411.127) [-410.144] (-412.365) (-410.131) * [-411.326] (-411.091) (-411.106) (-409.813) -- 0:00:04
418500 -- (-410.914) (-409.889) [-411.500] (-411.290) * [-410.274] (-413.217) (-409.157) (-416.636) -- 0:00:04
419000 -- [-410.480] (-410.875) (-413.588) (-413.555) * (-412.988) (-414.636) [-412.034] (-413.304) -- 0:00:04
419500 -- [-409.972] (-411.457) (-411.301) (-410.170) * (-409.843) (-414.280) [-411.333] (-412.601) -- 0:00:04
420000 -- (-410.258) (-410.142) (-413.036) [-411.781] * [-410.405] (-411.903) (-412.436) (-410.655) -- 0:00:04
Average standard deviation of split frequencies: 0.008615
420500 -- (-409.448) [-411.058] (-412.420) (-413.355) * (-415.426) [-413.007] (-409.098) (-410.208) -- 0:00:04
421000 -- [-409.554] (-410.807) (-409.470) (-413.768) * (-413.847) [-411.757] (-412.490) (-412.782) -- 0:00:04
421500 -- (-409.647) (-413.884) [-411.517] (-412.921) * (-409.658) [-412.089] (-413.256) (-412.038) -- 0:00:04
422000 -- (-410.903) (-413.719) [-413.638] (-415.348) * (-411.478) [-409.316] (-412.131) (-409.611) -- 0:00:04
422500 -- [-410.812] (-411.317) (-414.390) (-410.867) * (-412.597) (-412.020) [-413.620] (-409.306) -- 0:00:04
423000 -- (-411.186) (-410.452) [-411.167] (-413.010) * (-409.901) (-412.570) (-413.239) [-410.393] -- 0:00:04
423500 -- [-410.595] (-417.056) (-412.787) (-410.175) * [-413.279] (-411.467) (-410.741) (-409.730) -- 0:00:04
424000 -- [-409.254] (-413.122) (-414.628) (-409.455) * (-410.843) (-411.482) [-410.358] (-410.576) -- 0:00:04
424500 -- (-413.222) (-409.328) [-409.487] (-409.441) * (-409.543) (-410.869) [-409.673] (-412.631) -- 0:00:04
425000 -- (-409.846) (-410.565) [-410.037] (-413.361) * (-411.967) [-411.975] (-409.731) (-410.406) -- 0:00:04
Average standard deviation of split frequencies: 0.007746
425500 -- (-411.480) (-411.897) (-410.514) [-410.100] * [-411.027] (-411.144) (-410.568) (-410.137) -- 0:00:04
426000 -- (-409.858) [-412.092] (-412.231) (-409.370) * (-410.337) (-411.808) (-410.102) [-414.138] -- 0:00:04
426500 -- (-412.359) (-414.303) (-411.729) [-410.237] * (-412.270) (-410.294) [-410.986] (-413.122) -- 0:00:04
427000 -- (-411.248) (-412.430) (-410.865) [-411.804] * [-409.595] (-410.375) (-410.883) (-414.492) -- 0:00:04
427500 -- [-411.175] (-411.574) (-412.044) (-412.629) * (-409.892) [-413.801] (-410.810) (-410.910) -- 0:00:04
428000 -- (-412.702) (-413.398) (-412.287) [-412.140] * (-410.533) [-414.300] (-413.058) (-410.842) -- 0:00:04
428500 -- (-416.744) [-413.522] (-410.563) (-411.578) * (-414.039) (-415.755) [-411.364] (-418.769) -- 0:00:04
429000 -- (-411.681) (-410.620) [-409.515] (-412.257) * [-411.638] (-411.345) (-413.340) (-410.047) -- 0:00:04
429500 -- (-411.911) (-413.382) [-410.451] (-410.894) * (-412.112) (-409.654) [-412.506] (-411.063) -- 0:00:04
430000 -- (-411.342) [-410.258] (-418.608) (-411.967) * [-410.496] (-409.649) (-410.717) (-411.701) -- 0:00:04
Average standard deviation of split frequencies: 0.007252
430500 -- (-411.264) [-410.483] (-411.689) (-410.170) * [-409.732] (-409.515) (-411.561) (-413.262) -- 0:00:04
431000 -- [-409.592] (-411.925) (-411.420) (-409.719) * [-409.636] (-412.025) (-411.526) (-412.407) -- 0:00:04
431500 -- (-410.879) (-411.910) [-412.255] (-411.769) * (-414.986) [-416.195] (-411.442) (-411.712) -- 0:00:04
432000 -- (-410.477) [-411.239] (-410.599) (-412.317) * [-411.314] (-411.742) (-410.945) (-411.391) -- 0:00:04
432500 -- [-412.600] (-410.160) (-414.647) (-415.782) * (-410.172) (-409.811) (-410.383) [-410.705] -- 0:00:04
433000 -- (-411.815) [-410.517] (-412.388) (-415.798) * (-412.069) (-411.707) [-414.519] (-412.012) -- 0:00:04
433500 -- (-415.541) [-411.041] (-410.863) (-412.083) * (-413.724) (-411.769) (-413.471) [-413.453] -- 0:00:03
434000 -- (-412.402) [-411.347] (-410.283) (-410.729) * (-414.681) [-410.146] (-410.992) (-412.060) -- 0:00:03
434500 -- (-412.538) [-412.765] (-412.035) (-410.239) * (-412.063) (-411.024) (-413.955) [-411.235] -- 0:00:03
435000 -- (-411.133) [-411.177] (-414.212) (-410.784) * (-411.091) [-412.053] (-415.032) (-411.086) -- 0:00:03
Average standard deviation of split frequencies: 0.006848
435500 -- [-409.935] (-412.550) (-415.446) (-412.303) * (-421.201) (-410.919) (-412.079) [-410.706] -- 0:00:03
436000 -- [-418.959] (-413.819) (-411.514) (-412.074) * (-415.314) (-410.918) [-411.250] (-414.169) -- 0:00:03
436500 -- (-414.532) (-415.179) [-409.239] (-413.131) * (-411.239) (-412.730) (-410.052) [-409.619] -- 0:00:03
437000 -- (-417.947) [-413.480] (-410.685) (-413.575) * (-409.788) (-412.746) [-411.361] (-410.438) -- 0:00:03
437500 -- (-409.223) (-415.018) [-413.823] (-412.850) * (-409.949) [-409.420] (-413.549) (-410.193) -- 0:00:03
438000 -- [-412.586] (-409.967) (-413.512) (-411.495) * (-412.929) (-409.339) (-410.673) [-411.379] -- 0:00:03
438500 -- (-411.854) (-411.736) (-411.048) [-409.985] * (-410.688) (-413.142) (-412.159) [-410.576] -- 0:00:03
439000 -- (-413.279) (-410.079) (-411.610) [-410.186] * (-414.011) [-411.496] (-416.394) (-409.744) -- 0:00:03
439500 -- (-411.123) (-414.536) (-410.324) [-413.554] * (-411.403) (-410.699) [-415.777] (-411.203) -- 0:00:03
440000 -- (-416.099) (-411.992) (-412.352) [-410.828] * (-411.794) (-411.394) [-411.912] (-410.106) -- 0:00:03
Average standard deviation of split frequencies: 0.007889
440500 -- (-412.418) (-418.994) (-410.625) [-413.047] * [-414.028] (-412.318) (-410.116) (-411.570) -- 0:00:03
441000 -- (-412.679) [-413.428] (-410.543) (-413.575) * (-409.981) [-411.393] (-410.596) (-409.593) -- 0:00:03
441500 -- (-412.812) (-410.183) [-409.325] (-411.602) * (-412.192) (-415.947) [-410.276] (-411.606) -- 0:00:03
442000 -- (-410.086) (-411.231) [-411.695] (-413.957) * (-412.856) (-411.442) [-410.764] (-410.603) -- 0:00:03
442500 -- (-411.280) (-412.983) [-412.401] (-410.153) * [-415.414] (-410.697) (-413.574) (-416.267) -- 0:00:03
443000 -- (-410.108) (-410.926) [-412.525] (-412.173) * [-412.319] (-411.047) (-410.760) (-411.475) -- 0:00:03
443500 -- (-411.580) [-412.368] (-412.270) (-413.452) * (-411.626) (-409.888) (-412.171) [-409.500] -- 0:00:03
444000 -- (-410.439) (-413.132) (-412.536) [-416.740] * (-410.377) (-413.014) (-411.015) [-409.920] -- 0:00:03
444500 -- (-411.882) (-414.828) [-410.571] (-413.881) * (-415.003) (-411.644) (-411.576) [-410.246] -- 0:00:03
445000 -- (-414.065) (-412.618) [-410.292] (-414.529) * [-409.732] (-411.392) (-412.933) (-410.507) -- 0:00:03
Average standard deviation of split frequencies: 0.007068
445500 -- (-411.114) (-413.097) (-410.529) [-412.961] * (-409.353) (-413.536) [-409.428] (-410.966) -- 0:00:03
446000 -- (-415.087) (-410.195) [-410.228] (-413.097) * [-414.084] (-409.983) (-410.755) (-412.813) -- 0:00:03
446500 -- (-412.145) (-410.625) (-410.464) [-413.149] * (-412.232) (-410.795) (-413.104) [-409.726] -- 0:00:03
447000 -- (-410.445) (-411.671) (-409.522) [-409.742] * [-414.770] (-412.245) (-411.684) (-409.809) -- 0:00:03
447500 -- (-410.384) [-410.645] (-414.081) (-411.801) * [-410.889] (-410.235) (-419.408) (-409.033) -- 0:00:03
448000 -- (-410.359) (-412.455) (-411.159) [-411.345] * (-410.543) (-414.187) [-411.528] (-413.487) -- 0:00:03
448500 -- (-412.417) [-409.554] (-413.459) (-413.976) * [-410.559] (-410.743) (-410.785) (-413.984) -- 0:00:03
449000 -- [-409.557] (-410.366) (-412.659) (-412.741) * (-414.541) [-411.741] (-410.280) (-418.902) -- 0:00:03
449500 -- (-412.317) [-410.419] (-413.572) (-410.197) * (-410.722) [-414.225] (-412.775) (-413.360) -- 0:00:03
450000 -- (-412.331) (-410.271) [-415.218] (-410.140) * (-416.085) (-412.291) (-410.370) [-412.462] -- 0:00:03
Average standard deviation of split frequencies: 0.006995
450500 -- (-411.745) (-411.827) (-414.803) [-410.298] * [-412.422] (-410.661) (-411.514) (-414.698) -- 0:00:02
451000 -- (-415.171) [-409.770] (-411.428) (-413.365) * [-411.472] (-410.796) (-410.914) (-417.044) -- 0:00:02
451500 -- (-414.179) (-413.877) (-410.524) [-413.040] * (-417.009) (-412.066) [-409.821] (-411.548) -- 0:00:02
452000 -- (-411.354) (-409.966) [-410.539] (-411.362) * (-413.744) [-411.247] (-413.923) (-410.759) -- 0:00:02
452500 -- (-412.723) [-413.324] (-412.142) (-410.044) * (-412.725) [-413.263] (-409.731) (-412.505) -- 0:00:02
453000 -- [-413.938] (-409.470) (-411.691) (-413.944) * (-412.915) [-411.465] (-411.795) (-410.030) -- 0:00:02
453500 -- (-411.336) (-414.082) (-410.829) [-411.196] * [-415.869] (-411.272) (-409.533) (-411.711) -- 0:00:02
454000 -- (-410.363) (-412.037) [-410.456] (-410.531) * [-413.645] (-409.570) (-409.254) (-409.793) -- 0:00:02
454500 -- (-412.927) (-410.042) (-409.986) [-411.302] * (-409.777) (-414.471) (-410.816) [-412.297] -- 0:00:02
455000 -- [-409.911] (-409.787) (-409.720) (-409.646) * (-413.685) (-410.276) [-410.441] (-412.001) -- 0:00:02
Average standard deviation of split frequencies: 0.007030
455500 -- (-411.825) [-411.373] (-412.933) (-410.954) * (-410.253) [-410.034] (-410.302) (-413.698) -- 0:00:02
456000 -- (-410.427) (-412.247) (-409.674) [-410.302] * (-413.378) [-409.878] (-411.393) (-411.942) -- 0:00:02
456500 -- (-411.187) (-412.725) [-409.946] (-411.004) * (-413.620) [-412.564] (-410.528) (-411.738) -- 0:00:02
457000 -- [-413.074] (-415.250) (-415.286) (-412.390) * (-410.856) (-411.694) (-410.200) [-410.551] -- 0:00:02
457500 -- (-413.463) [-415.753] (-410.262) (-409.402) * (-412.889) (-413.272) [-409.187] (-412.598) -- 0:00:02
458000 -- (-414.006) (-410.661) [-412.998] (-413.043) * (-409.331) (-409.931) [-409.934] (-410.394) -- 0:00:02
458500 -- (-410.865) [-413.310] (-410.789) (-411.115) * (-411.467) [-411.143] (-412.541) (-411.254) -- 0:00:02
459000 -- [-409.163] (-412.819) (-412.168) (-410.975) * (-411.010) (-412.144) (-411.100) [-414.248] -- 0:00:02
459500 -- (-411.168) (-414.024) [-411.531] (-412.264) * (-411.461) (-409.873) [-413.425] (-414.943) -- 0:00:02
460000 -- [-412.159] (-411.877) (-417.680) (-409.677) * [-411.262] (-409.955) (-412.729) (-413.294) -- 0:00:02
Average standard deviation of split frequencies: 0.007709
460500 -- (-416.140) (-410.564) [-411.718] (-412.386) * (-411.179) [-411.352] (-411.475) (-411.023) -- 0:00:02
461000 -- (-413.633) [-410.086] (-411.047) (-414.421) * (-412.139) [-409.925] (-413.357) (-409.732) -- 0:00:02
461500 -- (-414.132) [-410.884] (-410.584) (-409.762) * (-409.896) (-414.259) (-413.221) [-410.426] -- 0:00:02
462000 -- (-410.822) [-414.469] (-411.514) (-414.344) * (-409.894) (-416.287) (-413.701) [-411.261] -- 0:00:02
462500 -- (-410.579) (-411.113) [-412.790] (-410.416) * [-410.524] (-410.053) (-411.894) (-413.308) -- 0:00:02
463000 -- (-411.776) [-412.585] (-410.153) (-412.149) * [-412.416] (-414.873) (-413.084) (-410.210) -- 0:00:02
463500 -- [-420.150] (-409.953) (-411.012) (-412.401) * (-411.933) (-412.348) (-411.717) [-409.760] -- 0:00:02
464000 -- [-416.346] (-411.203) (-410.545) (-410.765) * (-410.018) [-414.014] (-415.091) (-416.321) -- 0:00:02
464500 -- [-416.302] (-411.268) (-410.742) (-409.919) * (-409.297) (-413.838) (-413.398) [-410.946] -- 0:00:02
465000 -- (-411.057) (-415.627) (-410.427) [-411.300] * [-409.289] (-413.440) (-414.500) (-410.258) -- 0:00:02
Average standard deviation of split frequencies: 0.007688
465500 -- (-414.971) (-411.731) [-413.962] (-411.969) * (-411.287) (-411.223) (-410.783) [-409.937] -- 0:00:02
466000 -- (-414.759) (-409.997) (-411.522) [-410.900] * [-410.049] (-417.022) (-410.477) (-410.933) -- 0:00:02
466500 -- (-417.427) (-409.346) [-412.712] (-413.175) * (-410.443) (-411.301) [-412.067] (-411.076) -- 0:00:02
467000 -- (-412.929) [-411.714] (-414.114) (-412.833) * (-410.556) (-410.004) [-411.002] (-414.499) -- 0:00:01
467500 -- (-411.960) [-409.468] (-413.400) (-410.948) * [-411.137] (-412.666) (-413.458) (-412.304) -- 0:00:01
468000 -- (-410.729) (-417.395) (-411.155) [-409.725] * (-413.681) (-412.280) [-411.238] (-411.850) -- 0:00:01
468500 -- [-409.537] (-411.905) (-410.702) (-409.858) * (-410.178) (-415.414) (-413.013) [-410.131] -- 0:00:01
469000 -- (-412.625) (-415.026) [-412.836] (-414.828) * (-409.957) (-413.528) [-412.337] (-410.158) -- 0:00:01
469500 -- (-414.894) [-411.236] (-416.606) (-412.674) * (-412.896) (-410.716) [-410.090] (-411.283) -- 0:00:01
470000 -- (-409.744) (-409.836) [-412.536] (-409.973) * [-410.916] (-412.859) (-410.324) (-410.261) -- 0:00:01
Average standard deviation of split frequencies: 0.007612
470500 -- (-411.765) (-410.336) [-411.219] (-409.566) * (-411.067) (-411.802) (-410.286) [-410.874] -- 0:00:01
471000 -- (-409.490) (-411.199) (-411.228) [-411.032] * (-409.317) (-415.989) [-409.493] (-414.476) -- 0:00:01
471500 -- (-409.995) [-413.321] (-411.977) (-411.927) * (-410.030) [-409.230] (-410.108) (-411.344) -- 0:00:01
472000 -- [-410.586] (-412.930) (-411.053) (-411.715) * (-410.264) [-410.790] (-409.466) (-410.405) -- 0:00:01
472500 -- (-414.397) (-415.969) [-409.288] (-411.235) * (-410.978) (-409.715) (-413.552) [-410.720] -- 0:00:01
473000 -- (-409.898) (-410.258) (-410.316) [-412.026] * (-410.672) (-412.517) [-413.089] (-411.755) -- 0:00:01
473500 -- (-410.240) [-414.197] (-411.426) (-413.811) * (-412.431) (-409.797) (-410.987) [-411.556] -- 0:00:01
474000 -- (-412.713) [-411.248] (-413.864) (-416.265) * [-414.133] (-411.588) (-413.703) (-412.210) -- 0:00:01
474500 -- (-415.814) (-410.815) [-409.482] (-412.343) * [-412.321] (-412.483) (-414.744) (-410.162) -- 0:00:01
475000 -- (-412.351) (-411.629) [-412.503] (-410.477) * (-412.884) [-411.236] (-410.994) (-410.948) -- 0:00:01
Average standard deviation of split frequencies: 0.008187
475500 -- [-410.499] (-411.351) (-412.961) (-412.185) * (-413.678) (-409.836) (-412.146) [-409.987] -- 0:00:01
476000 -- [-410.052] (-414.736) (-412.842) (-409.600) * (-409.811) (-413.628) (-411.728) [-411.588] -- 0:00:01
476500 -- (-411.870) (-412.804) (-410.797) [-413.346] * (-411.550) [-410.573] (-413.547) (-410.133) -- 0:00:01
477000 -- [-410.588] (-410.134) (-413.916) (-414.239) * (-411.916) (-415.507) (-412.088) [-410.392] -- 0:00:01
477500 -- (-413.997) (-409.942) (-409.969) [-413.751] * (-411.097) (-410.238) (-414.222) [-412.529] -- 0:00:01
478000 -- [-410.170] (-409.296) (-412.673) (-410.641) * (-409.953) [-412.177] (-412.489) (-412.274) -- 0:00:01
478500 -- (-411.835) (-411.199) (-411.539) [-410.232] * [-414.118] (-414.702) (-412.755) (-410.956) -- 0:00:01
479000 -- (-412.038) (-410.154) (-410.883) [-410.825] * [-410.703] (-412.133) (-411.112) (-410.549) -- 0:00:01
479500 -- (-411.097) (-416.678) (-409.918) [-412.536] * [-412.973] (-411.570) (-411.513) (-411.138) -- 0:00:01
480000 -- (-413.701) (-411.047) [-416.356] (-411.448) * (-411.663) [-410.992] (-417.723) (-413.982) -- 0:00:01
Average standard deviation of split frequencies: 0.007911
480500 -- (-410.327) (-410.105) [-413.232] (-410.258) * (-413.202) [-411.706] (-410.655) (-412.120) -- 0:00:01
481000 -- (-411.806) [-409.695] (-415.772) (-411.757) * (-413.683) [-409.887] (-413.060) (-417.195) -- 0:00:01
481500 -- [-410.722] (-411.784) (-412.369) (-412.434) * (-410.519) [-410.689] (-413.408) (-414.316) -- 0:00:01
482000 -- (-410.170) (-416.924) (-411.584) [-409.739] * (-411.415) (-413.989) [-412.246] (-409.937) -- 0:00:01
482500 -- (-413.989) (-412.099) [-410.712] (-410.147) * (-410.294) [-411.066] (-410.705) (-412.265) -- 0:00:01
483000 -- (-411.162) (-409.965) (-410.525) [-409.839] * (-412.233) (-413.658) [-410.539] (-412.074) -- 0:00:01
483500 -- [-412.325] (-414.545) (-413.737) (-410.603) * (-413.603) [-411.220] (-410.265) (-411.219) -- 0:00:00
484000 -- [-411.764] (-410.734) (-411.290) (-410.057) * (-412.771) (-411.002) [-410.919] (-414.368) -- 0:00:00
484500 -- [-410.012] (-412.022) (-412.153) (-409.849) * [-411.505] (-410.262) (-411.053) (-414.383) -- 0:00:00
485000 -- (-412.197) [-410.330] (-409.809) (-409.375) * (-410.890) (-413.142) [-412.838] (-413.191) -- 0:00:00
Average standard deviation of split frequencies: 0.008148
485500 -- (-409.684) (-412.149) (-413.297) [-416.051] * (-410.293) (-410.670) (-411.793) [-410.147] -- 0:00:00
486000 -- (-409.859) (-410.961) (-414.452) [-409.954] * (-410.697) [-410.368] (-411.501) (-409.030) -- 0:00:00
486500 -- [-417.646] (-412.556) (-419.119) (-412.071) * [-410.143] (-413.026) (-411.527) (-409.467) -- 0:00:00
487000 -- (-414.015) (-410.931) (-419.137) [-410.994] * [-411.540] (-411.093) (-412.254) (-417.697) -- 0:00:00
487500 -- (-413.773) (-409.981) [-413.542] (-414.100) * (-411.031) (-411.676) (-416.033) [-411.056] -- 0:00:00
488000 -- (-410.681) [-410.853] (-410.711) (-411.866) * (-411.631) [-410.387] (-415.627) (-409.974) -- 0:00:00
488500 -- [-410.258] (-410.677) (-411.433) (-410.789) * (-410.858) [-415.925] (-415.770) (-410.271) -- 0:00:00
489000 -- (-413.897) (-409.863) (-410.523) [-410.420] * (-411.493) [-412.637] (-412.543) (-410.590) -- 0:00:00
489500 -- (-412.342) (-411.459) (-410.745) [-412.136] * (-410.390) [-409.667] (-411.105) (-411.366) -- 0:00:00
490000 -- (-410.111) (-409.639) [-411.031] (-411.499) * (-410.948) (-412.567) [-411.739] (-410.294) -- 0:00:00
Average standard deviation of split frequencies: 0.008262
490500 -- (-415.698) (-410.568) [-414.001] (-411.001) * (-409.659) [-410.671] (-412.542) (-410.916) -- 0:00:00
491000 -- [-411.064] (-411.601) (-412.619) (-413.348) * [-412.304] (-410.654) (-413.335) (-411.834) -- 0:00:00
491500 -- (-410.221) (-412.293) (-411.843) [-411.152] * (-410.355) [-410.554] (-414.130) (-412.426) -- 0:00:00
492000 -- (-410.310) (-411.035) (-410.000) [-410.243] * [-411.089] (-410.538) (-412.386) (-411.360) -- 0:00:00
492500 -- (-411.263) (-414.253) [-410.428] (-410.337) * (-412.206) (-412.999) [-409.369] (-409.397) -- 0:00:00
493000 -- (-410.677) (-411.935) (-410.793) [-414.306] * (-411.515) (-410.678) (-409.950) [-410.885] -- 0:00:00
493500 -- [-411.021] (-416.125) (-410.478) (-412.030) * (-411.402) [-413.064] (-412.554) (-410.427) -- 0:00:00
494000 -- (-412.473) (-409.843) [-410.848] (-413.975) * (-409.481) (-410.112) [-410.521] (-411.949) -- 0:00:00
494500 -- (-410.667) [-411.593] (-412.126) (-417.421) * [-409.878] (-410.439) (-409.290) (-410.158) -- 0:00:00
495000 -- (-409.961) [-409.315] (-412.377) (-412.402) * (-410.376) (-411.243) (-410.075) [-412.336] -- 0:00:00
Average standard deviation of split frequencies: 0.008174
495500 -- (-410.258) (-409.861) (-418.938) [-410.294] * (-414.790) (-412.167) [-411.247] (-410.451) -- 0:00:00
496000 -- [-413.032] (-412.053) (-413.199) (-411.769) * [-410.186] (-411.144) (-411.552) (-413.405) -- 0:00:00
496500 -- [-410.231] (-411.703) (-413.359) (-414.794) * (-416.372) (-414.913) [-411.180] (-414.705) -- 0:00:00
497000 -- (-414.418) (-411.700) (-411.096) [-411.138] * (-416.707) [-413.862] (-409.418) (-411.959) -- 0:00:00
497500 -- (-411.660) [-410.193] (-412.204) (-412.238) * (-414.638) (-414.098) [-409.558] (-409.838) -- 0:00:00
498000 -- [-409.448] (-412.846) (-410.692) (-411.930) * (-412.035) [-410.935] (-412.065) (-411.334) -- 0:00:00
498500 -- (-410.122) (-414.153) (-410.078) [-417.185] * (-409.983) [-413.460] (-413.266) (-411.177) -- 0:00:00
499000 -- (-409.936) (-409.524) (-409.326) [-412.186] * (-409.894) (-411.331) (-410.430) [-409.371] -- 0:00:00
499500 -- (-410.706) [-409.490] (-413.055) (-411.525) * (-409.840) (-410.350) [-410.604] (-410.991) -- 0:00:00
500000 -- [-412.117] (-411.798) (-417.982) (-411.057) * [-414.230] (-411.138) (-410.109) (-410.253) -- 0:00:00
Average standard deviation of split frequencies: 0.007784
Analysis completed in 30 seconds
Analysis used 28.62 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -409.00
Likelihood of best state for "cold" chain of run 2 was -409.00
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
79.4 % ( 81 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
45.2 % ( 43 %) Dirichlet(Pi{all})
46.7 % ( 35 %) Slider(Pi{all})
88.3 % ( 83 %) Multiplier(Alpha{1,2})
88.1 % ( 82 %) Multiplier(Alpha{3})
27.1 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.4 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 88 %) ParsSPR(Tau{all},V{all})
30.8 % ( 21 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
35.4 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
77.7 % ( 74 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
45.4 % ( 31 %) Dirichlet(Pi{all})
45.2 % ( 32 %) Slider(Pi{all})
88.3 % ( 83 %) Multiplier(Alpha{1,2})
87.9 % ( 79 %) Multiplier(Alpha{3})
26.0 % ( 25 %) Slider(Pinvar{all})
98.5 % ( 99 %) ExtSPR(Tau{all},V{all})
69.8 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
30.7 % ( 27 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
35.6 % ( 17 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83706 0.82 0.67
3 | 82984 83196 0.84
4 | 83517 83429 83168
Chain swap information for run 2:
1 2 3 4
------------------------------
1 | 0.81 0.64 0.50
2 | 83620 0.82 0.67
3 | 82918 83247 0.83
4 | 83423 83635 83157
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 1250
Summarizing parameters in files /data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -410.52
| 2 |
| 11 1 1 2 1 |
| 1 2 111 2 2 2 1 2 |
|2 * 2 21 2* 2 2 |
| 22 1 22 2 212 2 21 1 2 2 1|
| 1 2 22 11 1 2 11 1 12 2 2 22|
| *21 1 1* 21 1 2 1 1 2 1 1 1 |
| 2 2 2 1 1 1 2 2 * 2 1 |
| 1 2 11 2 2 2 1 2 2* 2 1 |
| 2 1 1 |
|1 2 1 |
| 21 1 1 |
| 1 1 |
| 1 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -412.97
^ ^
125000 500000
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -410.71 -414.95
2 -410.71 -415.95
--------------------------------------
TOTAL -410.71 -415.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891595 0.086694 0.389599 1.476849 0.871692 736.90 743.95 1.000
r(A<->C){all} 0.165012 0.017422 0.000191 0.423813 0.135443 57.53 86.04 0.999
r(A<->G){all} 0.173203 0.019967 0.000106 0.467606 0.134661 126.06 167.40 1.000
r(A<->T){all} 0.177602 0.022238 0.000176 0.486647 0.138969 51.66 155.17 1.012
r(C<->G){all} 0.150010 0.016769 0.000050 0.405511 0.119989 82.30 118.21 1.004
r(C<->T){all} 0.172007 0.018404 0.000044 0.435323 0.143001 128.94 184.46 0.999
r(G<->T){all} 0.162166 0.017377 0.000141 0.412029 0.133751 53.29 81.75 1.027
pi(A){all} 0.200783 0.000517 0.158132 0.247094 0.200021 713.39 715.23 1.002
pi(C){all} 0.297059 0.000742 0.243247 0.346549 0.296551 603.39 672.05 0.999
pi(G){all} 0.308385 0.000726 0.258925 0.360285 0.308398 625.16 681.91 1.000
pi(T){all} 0.193774 0.000555 0.152500 0.244594 0.192467 647.61 694.76 1.001
alpha{1,2} 0.389153 0.196845 0.000187 1.309811 0.236156 501.25 511.62 1.001
alpha{3} 0.457442 0.259130 0.000266 1.493053 0.282043 301.34 431.00 0.999
pinvar{all} 0.994569 0.000047 0.982502 0.999985 0.996859 349.67 514.07 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 1250
Summarizing trees in files "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 1001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 2002 trees in 2 files (sampling 1502 of them)
(Each file contained 1001 trees of which 751 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ...*.*
9 -- .**...
10 -- ....**
11 -- ...**.
12 -- .*.***
13 -- .*...*
14 -- .***.*
15 -- ..*..*
16 -- ..*.*.
17 -- .*..*.
18 -- .**.**
19 -- ..****
20 -- .*.*..
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 230 0.153129 0.007532 0.147803 0.158455 2
8 226 0.150466 0.009416 0.143808 0.157124 2
9 225 0.149800 0.006591 0.145140 0.154461 2
10 221 0.147137 0.012240 0.138482 0.155792 2
11 221 0.147137 0.000942 0.146471 0.147803 2
12 218 0.145140 0.003766 0.142477 0.147803 2
13 218 0.145140 0.005649 0.141145 0.149134 2
14 213 0.141811 0.025422 0.123835 0.159787 2
15 211 0.140479 0.010357 0.133156 0.147803 2
16 210 0.139814 0.015065 0.129161 0.150466 2
17 209 0.139148 0.004708 0.135819 0.142477 2
18 206 0.137150 0.005649 0.133156 0.141145 2
19 206 0.137150 0.001883 0.135819 0.138482 2
20 204 0.135819 0.007532 0.130493 0.141145 2
21 202 0.134487 0.000000 0.134487 0.134487 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096680 0.009796 0.000062 0.300513 0.065337 1.000 2
length{all}[2] 0.097692 0.008870 0.000262 0.287318 0.067869 1.000 2
length{all}[3] 0.102116 0.009395 0.000010 0.290662 0.077164 1.001 2
length{all}[4] 0.101460 0.009546 0.000000 0.293872 0.075033 0.999 2
length{all}[5] 0.099828 0.009724 0.000049 0.306168 0.068081 1.000 2
length{all}[6] 0.100149 0.010537 0.000060 0.302527 0.069421 1.000 2
length{all}[7] 0.100656 0.008071 0.000609 0.281268 0.081152 0.999 2
length{all}[8] 0.099705 0.011420 0.000317 0.316437 0.066712 0.997 2
length{all}[9] 0.101983 0.013581 0.000287 0.317078 0.064763 0.998 2
length{all}[10] 0.091080 0.006590 0.000230 0.233029 0.071195 0.998 2
length{all}[11] 0.099728 0.009478 0.001460 0.309746 0.068427 0.995 2
length{all}[12] 0.094582 0.010438 0.000464 0.261101 0.061737 0.999 2
length{all}[13] 0.094614 0.010237 0.000028 0.273384 0.067418 1.054 2
length{all}[14] 0.093093 0.007943 0.000124 0.264719 0.068572 1.010 2
length{all}[15] 0.110420 0.011562 0.000075 0.333655 0.077994 1.007 2
length{all}[16] 0.099730 0.009214 0.000439 0.303435 0.072134 0.995 2
length{all}[17] 0.087860 0.007344 0.000503 0.295407 0.061855 0.995 2
length{all}[18] 0.096094 0.008608 0.001077 0.286491 0.069914 0.995 2
length{all}[19] 0.087017 0.007017 0.000035 0.284830 0.058431 0.996 2
length{all}[20] 0.109602 0.009222 0.001047 0.302830 0.076054 0.995 2
length{all}[21] 0.093495 0.012156 0.000919 0.296465 0.065521 0.996 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007784
Maximum standard deviation of split frequencies = 0.025422
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.054
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 43 trees
90 % credible set contains 89 trees
95 % credible set contains 96 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 300
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 100 / 100 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 100 / 100 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109680 0.099898 0.044435 0.108331 0.062887 0.067037 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -440.665052
Iterating by ming2
Initial: fx= 440.665052
x= 0.10968 0.09990 0.04444 0.10833 0.06289 0.06704 0.30000 1.30000
1 h-m-p 0.0000 0.0005 239.2991 +++ 414.698865 m 0.0005 14 | 1/8
2 h-m-p 0.0039 0.0196 23.5772 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 219.9890 +++ 405.575623 m 0.0002 47 | 2/8
4 h-m-p 0.0021 0.0465 17.4326 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 197.2054 ++ 403.927539 m 0.0000 79 | 3/8
6 h-m-p 0.0005 0.0718 14.1124 -----------.. | 3/8
7 h-m-p 0.0000 0.0003 170.6006 +++ 394.072815 m 0.0003 111 | 4/8
8 h-m-p 0.0043 0.1610 10.8246 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 140.0918 ++ 392.368362 m 0.0001 143 | 5/8
10 h-m-p 0.0011 0.2343 7.5267 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 99.2070 ++ 392.231751 m 0.0000 174 | 6/8
12 h-m-p 0.9597 8.0000 0.0000 -Y 392.231751 0 0.0600 186 | 6/8
13 h-m-p 0.0318 8.0000 0.0000 ---------Y 392.231751 0 0.0000 208
Out..
lnL = -392.231751
209 lfun, 209 eigenQcodon, 1254 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021158 0.054221 0.031089 0.100453 0.103427 0.044206 0.299916 0.507250 0.513672
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.033694
np = 9
lnL0 = -426.621625
Iterating by ming2
Initial: fx= 426.621625
x= 0.02116 0.05422 0.03109 0.10045 0.10343 0.04421 0.29992 0.50725 0.51367
1 h-m-p 0.0000 0.0002 234.1266 +++ 414.513628 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0005 116.3220 ++ 409.669895 m 0.0005 27 | 2/9
3 h-m-p 0.0000 0.0002 223.6612 ++ 405.156150 m 0.0002 39 | 3/9
4 h-m-p 0.0000 0.0001 383.7891 ++ 402.023683 m 0.0001 51 | 4/9
5 h-m-p 0.0000 0.0001 1546.1047 ++ 392.529599 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 669.6114 ++ 392.231733 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 392.231733 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.0585 ---------N 392.231733 0 0.0000 111 | 6/9
9 h-m-p 0.0160 8.0000 0.0003 +++++ 392.231733 m 8.0000 129 | 6/9
10 h-m-p 0.0053 2.2802 0.3927 --------Y 392.231733 0 0.0000 152 | 6/9
11 h-m-p 0.0160 8.0000 0.0003 +++++ 392.231733 m 8.0000 170 | 6/9
12 h-m-p 0.0071 2.8407 0.3432 ---------Y 392.231733 0 0.0000 194 | 6/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 392.231733 m 8.0000 212 | 6/9
14 h-m-p 0.0051 2.5409 0.3149 ------------.. | 6/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231733 m 8.0000 255 | 6/9
16 h-m-p 0.0051 2.5336 0.2919 --------Y 392.231733 0 0.0000 278 | 6/9
17 h-m-p 0.0160 8.0000 0.0002 +++++ 392.231733 m 8.0000 296 | 6/9
18 h-m-p 0.0039 1.5001 0.3809 ----------Y 392.231733 0 0.0000 321 | 6/9
19 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231733 m 8.0000 339 | 6/9
20 h-m-p 0.0012 0.5800 1.1402 -----------.. | 6/9
21 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231733 m 8.0000 378 | 6/9
22 h-m-p 0.0160 8.0000 0.0387 +++++ 392.231706 m 8.0000 396 | 6/9
23 h-m-p 0.5019 2.5095 0.4211 ----------------.. | 6/9
24 h-m-p 0.0160 8.0000 0.0002 +++++ 392.231706 m 8.0000 443 | 6/9
25 h-m-p 0.0130 6.4926 0.1704 ----------Y 392.231706 0 0.0000 468 | 6/9
26 h-m-p 0.0160 8.0000 0.0003 +++++ 392.231706 m 8.0000 486 | 6/9
27 h-m-p 0.0065 0.8189 0.3215 ------------.. | 6/9
28 h-m-p 0.0160 8.0000 0.0002 +++++ 392.231705 m 8.0000 529 | 6/9
29 h-m-p 0.0131 6.5574 0.1695 ------------N 392.231705 0 0.0000 556 | 6/9
30 h-m-p 0.0160 8.0000 0.0044 +++++ 392.231699 m 8.0000 574 | 6/9
31 h-m-p 0.1913 5.6738 0.1822 -------------Y 392.231699 0 0.0000 602 | 6/9
32 h-m-p 0.0160 8.0000 0.0018 +++++ 392.231696 m 8.0000 620 | 6/9
33 h-m-p 0.0831 5.4512 0.1740 ------------Y 392.231696 0 0.0000 647 | 6/9
34 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231696 m 8.0000 665 | 6/9
35 h-m-p 0.0109 5.4448 0.1744 ---------Y 392.231696 0 0.0000 689 | 6/9
36 h-m-p 0.0160 8.0000 0.0001 +++++ 392.231696 m 8.0000 707 | 6/9
37 h-m-p 0.0103 5.1448 0.1863 -----------C 392.231696 0 0.0000 733 | 6/9
38 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231696 m 8.0000 751 | 6/9
39 h-m-p 0.0118 5.8756 0.1648 ------------Y 392.231696 0 0.0000 778 | 6/9
40 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/9
41 h-m-p 0.0160 8.0000 0.0002 +++++ 392.231695 m 8.0000 822 | 6/9
42 h-m-p 0.0160 8.0000 0.1456 ---------Y 392.231695 0 0.0000 846 | 6/9
43 h-m-p 0.0021 1.0290 0.0103 +++++ 392.231693 m 1.0290 864 | 7/9
44 h-m-p 0.0696 6.9576 0.1287 -----------C 392.231693 0 0.0000 890 | 7/9
45 h-m-p 0.0032 1.6012 0.0671 +++++ 392.231665 m 1.6012 907 | 8/9
46 h-m-p 0.3961 8.0000 0.0318 -----------Y 392.231665 0 0.0000 932 | 8/9
47 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231665 m 8.0000 948 | 8/9
48 h-m-p 0.0005 0.2592 1.0082 +++++ 392.231659 m 0.2592 964 | 9/9
49 h-m-p 0.0160 8.0000 0.0000 N 392.231659 0 0.0160 976 | 9/9
50 h-m-p 0.0160 8.0000 0.0000 N 392.231659 0 0.0160 988
Out..
lnL = -392.231659
989 lfun, 2967 eigenQcodon, 11868 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.098067 0.099250 0.090357 0.012601 0.049839 0.059445 0.000100 0.871583 0.175298 0.325669 1.536933
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.291762
np = 11
lnL0 = -430.318930
Iterating by ming2
Initial: fx= 430.318930
x= 0.09807 0.09925 0.09036 0.01260 0.04984 0.05944 0.00011 0.87158 0.17530 0.32567 1.53693
1 h-m-p 0.0000 0.0000 215.5748 ++ 429.879781 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0006 124.7291 +++ 423.137438 m 0.0006 31 | 2/11
3 h-m-p 0.0003 0.0016 52.8223 ++ 408.326348 m 0.0016 45 | 3/11
4 h-m-p 0.0021 0.0103 21.7470 ++ 401.171252 m 0.0103 59 | 4/11
5 h-m-p 0.0000 0.0001 1729.7402 ++ 396.098782 m 0.0001 73 | 5/11
6 h-m-p 0.0032 0.0159 5.8899 ------------.. | 5/11
7 h-m-p 0.0000 0.0001 164.9785 ++ 393.231329 m 0.0001 111 | 6/11
8 h-m-p 0.0160 8.0000 2.4132 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 137.8471 ++ 392.302995 m 0.0000 150 | 7/11
10 h-m-p 0.0037 1.2453 1.2915 ------------.. | 7/11
11 h-m-p 0.0000 0.0000 98.2695 ++ 392.231730 m 0.0000 188 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 C 392.231730 0 0.0160 202 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 Y 392.231730 0 0.0160 219 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231730 m 8.0000 239 | 8/11
15 h-m-p 0.0025 1.2387 0.3822 +++++ 392.231729 m 1.2387 259 | 9/11
16 h-m-p 0.0113 5.6476 23.8277 ++++Y 392.231659 0 2.8916 280 | 9/11
17 h-m-p 1.6000 8.0000 0.0000 N 392.231659 0 1.6000 294 | 9/11
18 h-m-p 0.0160 8.0000 0.0000 N 392.231659 0 0.0160 310
Out..
lnL = -392.231659
311 lfun, 1244 eigenQcodon, 5598 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -392.251231 S = -392.232052 -0.007354
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:05
did 20 / 41 patterns 0:05
did 30 / 41 patterns 0:05
did 40 / 41 patterns 0:05
did 41 / 41 patterns 0:05
Time used: 0:05
Model 3: discrete
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.109658 0.011469 0.098335 0.100407 0.058382 0.025442 0.000100 0.311023 0.050686 0.649923 1.639608 2.672014
ntime & nrate & np: 6 4 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 5.951589
np = 12
lnL0 = -430.077016
Iterating by ming2
Initial: fx= 430.077016
x= 0.10966 0.01147 0.09833 0.10041 0.05838 0.02544 0.00011 0.31102 0.05069 0.64992 1.63961 2.67201
1 h-m-p 0.0000 0.0000 218.0042 ++ 429.530685 m 0.0000 17 | 1/12
2 h-m-p 0.0000 0.0024 60.3719 +++ 422.181902 m 0.0024 33 | 2/12
3 h-m-p 0.0002 0.0008 43.4050 ++ 416.054019 m 0.0008 48 | 3/12
4 h-m-p 0.0014 0.0336 21.7481 +++ 400.202935 m 0.0336 64 | 4/12
5 h-m-p 0.0000 0.0000 1939.7968 ++ 399.534001 m 0.0000 79 | 5/12
6 h-m-p 0.0002 0.0079 148.9122 +++ 392.965114 m 0.0079 95 | 6/12
7 h-m-p 0.0000 0.0000 48114.4374 ++ 392.310215 m 0.0000 110 | 7/12
8 h-m-p 0.0000 0.0000 2780.7430 ++ 392.231715 m 0.0000 125 | 8/12
9 h-m-p 1.6000 8.0000 0.0031 ++ 392.231715 m 8.0000 140 | 8/12
10 h-m-p 0.0160 8.0000 9.2653 -------------.. | 8/12
11 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231715 m 8.0000 188 | 8/12
12 h-m-p 0.0160 8.0000 0.5461 ------------C 392.231715 0 0.0000 219 | 8/12
13 h-m-p 0.0160 8.0000 0.0003 +++++ 392.231715 m 8.0000 241 | 8/12
14 h-m-p 0.0160 8.0000 8.3418 -------------.. | 8/12
15 h-m-p 0.0160 8.0000 0.0000 +++++ 392.231715 m 8.0000 289 | 8/12
16 h-m-p 0.0160 8.0000 0.2586 +++++ 392.231670 m 8.0000 311 | 8/12
17 h-m-p 0.5378 2.6890 1.4445 ++ 392.231659 m 2.6890 330 | 8/12
18 h-m-p -0.0000 -0.0000 0.0088
h-m-p: -5.17425104e-15 -2.58712552e-14 8.77229569e-03 392.231659
.. | 9/12
19 h-m-p 0.0160 8.0000 0.0000 Y 392.231659 0 0.0160 361 | 9/12
20 h-m-p 0.0160 8.0000 2.4144 ------Y 392.231659 0 0.0000 385 | 9/12
21 h-m-p 0.9065 8.0000 0.0000 Y 392.231659 0 0.2266 400 | 9/12
22 h-m-p 1.6000 8.0000 0.0000 +Y 392.231659 0 6.4000 419 | 9/12
23 h-m-p 0.0196 8.0000 0.0000 --Y 392.231659 0 0.0003 439
Out..
lnL = -392.231659
440 lfun, 1760 eigenQcodon, 7920 P(t)
Time used: 0:07
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.035763 0.030341 0.060576 0.046506 0.027445 0.032230 0.000100 1.088534 1.132165
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.851696
np = 9
lnL0 = -414.611909
Iterating by ming2
Initial: fx= 414.611909
x= 0.03576 0.03034 0.06058 0.04651 0.02745 0.03223 0.00011 1.08853 1.13217
1 h-m-p 0.0000 0.0000 230.3151 ++ 413.309625 m 0.0000 14 | 1/9
2 h-m-p 0.0003 0.0595 19.4464 ----------.. | 1/9
3 h-m-p 0.0000 0.0003 230.9320 +++ 398.939318 m 0.0003 47 | 2/9
4 h-m-p 0.0040 0.0849 13.9165 ------------.. | 2/9
5 h-m-p 0.0000 0.0000 216.8605 ++ 397.525509 m 0.0000 81 | 3/9
6 h-m-p 0.0007 0.1583 7.9929 -----------.. | 3/9
7 h-m-p 0.0000 0.0000 194.3736 ++ 396.786392 m 0.0000 114 | 4/9
8 h-m-p 0.0005 0.1882 6.8914 -----------.. | 4/9
9 h-m-p 0.0000 0.0000 168.4051 ++ 395.747848 m 0.0000 147 | 5/9
10 h-m-p 0.0009 0.2290 5.8232 -----------.. | 5/9
11 h-m-p 0.0000 0.0001 137.6001 ++ 393.631485 m 0.0001 180 | 6/9
12 h-m-p 0.0026 0.3383 4.1952 ------------.. | 6/9
13 h-m-p 0.0000 0.0001 97.7067 ++ 392.231730 m 0.0001 214 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 392.231730 m 8.0000 226 | 7/9
15 h-m-p 0.0394 8.0000 0.0002 ----C 392.231730 0 0.0000 244
Out..
lnL = -392.231730
245 lfun, 2695 eigenQcodon, 14700 P(t)
Time used: 0:11
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.060981 0.014190 0.086606 0.023339 0.107867 0.098346 0.000100 0.900000 1.072623 1.180463 1.299845
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.758831
np = 11
lnL0 = -428.856334
Iterating by ming2
Initial: fx= 428.856334
x= 0.06098 0.01419 0.08661 0.02334 0.10787 0.09835 0.00011 0.90000 1.07262 1.18046 1.29985
1 h-m-p 0.0000 0.0000 219.3326 ++ 428.446958 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0027 59.5521 ++++ 420.389510 m 0.0027 32 | 2/11
3 h-m-p 0.0001 0.0004 86.5761 ++ 416.001354 m 0.0004 46 | 3/11
4 h-m-p 0.0003 0.0044 103.5033 ++ 401.484706 m 0.0044 60 | 4/11
5 h-m-p 0.0000 0.0000 7505.8263 ++ 394.963027 m 0.0000 74 | 5/11
6 h-m-p 0.0003 0.0017 202.4099 ++ 392.891640 m 0.0017 88 | 6/11
7 h-m-p 0.0000 0.0002 2723.6355 ++ 392.231740 m 0.0002 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0013 ++ 392.231740 m 8.0000 116 | 7/11
9 h-m-p 0.1861 8.0000 0.0540 +++ 392.231738 m 8.0000 135 | 7/11
10 h-m-p 0.1577 0.7887 1.9350 +C 392.231736 0 0.5947 154 | 7/11
11 h-m-p 1.4200 7.0998 0.0529 Y 392.231736 0 0.1783 168 | 7/11
12 h-m-p 1.6000 8.0000 0.0000 ++ 392.231736 m 8.0000 186 | 7/11
13 h-m-p 0.0003 0.1723 1.6042 +++++ 392.231730 m 0.1723 207 | 8/11
14 h-m-p 0.1692 1.5707 0.7767 -------------Y 392.231730 0 0.0000 234 | 8/11
15 h-m-p 0.0010 0.4843 0.2163 +++++ 392.231727 m 0.4843 254 | 9/11
16 h-m-p 0.1867 6.9027 0.1492 +++ 392.231659 m 6.9027 272
QuantileBeta(0.15, 0.00494, 1.05031) = 3.738642e-162 2000 rounds
| 10/11
17 h-m-p 1.6000 8.0000 0.0000 N 392.231659 0 0.2000 288 | 10/11
18 h-m-p 0.2500 8.0000 0.0000 N 392.231659 0 0.0625 303 | 10/11
19 h-m-p 0.2000 8.0000 0.0000 Y 392.231659 0 0.2000 318 | 10/11
20 h-m-p 0.2500 8.0000 0.0000 N 392.231659 0 0.2500 333 | 10/11
21 h-m-p 0.3333 8.0000 0.0000 +N 392.231659 0 1.3333 349 | 10/11
22 h-m-p 0.0160 8.0000 3.0602 ++
QuantileBeta(0.15, 0.00500, 4.18392) = 5.573539e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 13.58473) = 1.574335e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
+ 392.231659 m 8.0000 367
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.519069e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53161) = 8.231699e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
| 10/11
23 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
Y 392.231659 0 1.6000 381
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.519069e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53210) = 8.231537e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53110) = 8.231868e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
| 10/11
24 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
C 392.231659 0 0.0160 396
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
Out..
lnL = -392.231659
397 lfun, 4764 eigenQcodon, 26202 P(t)
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -392.257057 S = -392.232052 -0.011012
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:18
did 20 / 41 patterns 0:18
did 30 / 41 patterns 0:18
did 40 / 41 patterns 0:18
did 41 / 41 patterns 0:18
QuantileBeta(0.15, 0.00500, 25.53160) = 8.231702e-162 2000 rounds
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=100
NC_011896_1_WP_010908761_1_2347_MLBR_RS11150 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
NC_002677_1_NP_302441_1_1313_ML2199 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT
**************************************************
NC_011896_1_WP_010908761_1_2347_MLBR_RS11150 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
NC_002677_1_NP_302441_1_1313_ML2199 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385 AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
**************************************************
>NC_011896_1_WP_010908761_1_2347_MLBR_RS11150 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC >NC_002677_1_NP_302441_1_1313_ML2199 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC >NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC >NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC >NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC >NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385 ATGTGCTCTGAGCCTAAACAAAGACTGGCGTTGCCCGCCAACGTGAACCT CGAGAAAGAAACGGTGATCACCGGTCGCGTGGTCGATCGCAAAGGGCAAG CCGTGGGTGGGGCGTTCGTCCGCCTGCTGGATTCGTCCAACGAGTTCACG GCCGAAGTGGTCACCTCGGCCACCGGTGACTTCCGGTTTTTCGCCGCGCC GGGGTCCTGGACACTGCGCGCGCTGTCTTCAGTAGGTAATGGCGACGCCA TGATGTCACCTTCGGGAACAGGCATCCACAAGGTCGACGTCAAGATCACC
>NC_011896_1_WP_010908761_1_2347_MLBR_RS11150 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT >NC_002677_1_NP_302441_1_1313_ML2199 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT >NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT >NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT >NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT >NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385 MCSEPKQRLALPANVNLEKETVITGRVVDRKGQAVGGAFVRLLDSSNEFT AEVVTSATGDFRFFAAPGSWTLRALSSVGNGDAMMSPSGTGIHKVDVKIT
#NEXUS
[ID: 5027309855]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908761_1_2347_MLBR_RS11150
NC_002677_1_NP_302441_1_1313_ML2199
NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605
NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265
NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065
NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908761_1_2347_MLBR_RS11150,
2 NC_002677_1_NP_302441_1_1313_ML2199,
3 NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605,
4 NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265,
5 NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065,
6 NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06533705,2:0.06786907,3:0.07716426,4:0.07503261,5:0.06808146,6:0.06942059);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06533705,2:0.06786907,3:0.07716426,4:0.07503261,5:0.06808146,6:0.06942059);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -410.71 -414.95
2 -410.71 -415.95
--------------------------------------
TOTAL -410.71 -415.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 1502 samples from 2 runs.
Each run produced 1001 samples of which 751 samples were included.
Parameter summaries saved to file "/data/8res/ML2199/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891595 0.086694 0.389599 1.476849 0.871692 736.90 743.95 1.000
r(A<->C){all} 0.165012 0.017422 0.000191 0.423813 0.135443 57.53 86.04 0.999
r(A<->G){all} 0.173203 0.019967 0.000106 0.467606 0.134661 126.06 167.40 1.000
r(A<->T){all} 0.177602 0.022238 0.000176 0.486647 0.138969 51.66 155.17 1.012
r(C<->G){all} 0.150010 0.016769 0.000050 0.405511 0.119989 82.30 118.21 1.004
r(C<->T){all} 0.172007 0.018404 0.000044 0.435323 0.143001 128.94 184.46 0.999
r(G<->T){all} 0.162166 0.017377 0.000141 0.412029 0.133751 53.29 81.75 1.027
pi(A){all} 0.200783 0.000517 0.158132 0.247094 0.200021 713.39 715.23 1.002
pi(C){all} 0.297059 0.000742 0.243247 0.346549 0.296551 603.39 672.05 0.999
pi(G){all} 0.308385 0.000726 0.258925 0.360285 0.308398 625.16 681.91 1.000
pi(T){all} 0.193774 0.000555 0.152500 0.244594 0.192467 647.61 694.76 1.001
alpha{1,2} 0.389153 0.196845 0.000187 1.309811 0.236156 501.25 511.62 1.001
alpha{3} 0.457442 0.259130 0.000266 1.493053 0.282043 301.34 431.00 0.999
pinvar{all} 0.994569 0.000047 0.982502 0.999985 0.996859 349.67 514.07 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/8res/ML2199/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 100
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 2 2 2 2 2 2 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 4 4 4 4 4 4
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 5 5 5 5 5 5 | CCG 1 1 1 1 1 1 | CAG 0 0 0 0 0 0 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 3 3 3 3 3 3 | ACC 4 4 4 4 4 4 | AAC 3 3 3 3 3 3 | AGC 0 0 0 0 0 0
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 3 3 3 3 3 3 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 0 0 0 0 0 0 | Asp GAT 2 2 2 2 2 2 | Gly GGT 4 4 4 4 4 4
GTC 5 5 5 5 5 5 | GCC 6 6 6 6 6 6 | GAC 3 3 3 3 3 3 | GGC 2 2 2 2 2 2
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 1 1 1 1 1 1
GTG 5 5 5 5 5 5 | GCG 4 4 4 4 4 4 | GAG 3 3 3 3 3 3 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908761_1_2347_MLBR_RS11150
position 1: T:0.17000 C:0.18000 A:0.24000 G:0.41000
position 2: T:0.29000 C:0.31000 A:0.22000 G:0.18000
position 3: T:0.12000 C:0.40000 A:0.14000 G:0.34000
Average T:0.19333 C:0.29667 A:0.20000 G:0.31000
#2: NC_002677_1_NP_302441_1_1313_ML2199
position 1: T:0.17000 C:0.18000 A:0.24000 G:0.41000
position 2: T:0.29000 C:0.31000 A:0.22000 G:0.18000
position 3: T:0.12000 C:0.40000 A:0.14000 G:0.34000
Average T:0.19333 C:0.29667 A:0.20000 G:0.31000
#3: NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605
position 1: T:0.17000 C:0.18000 A:0.24000 G:0.41000
position 2: T:0.29000 C:0.31000 A:0.22000 G:0.18000
position 3: T:0.12000 C:0.40000 A:0.14000 G:0.34000
Average T:0.19333 C:0.29667 A:0.20000 G:0.31000
#4: NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265
position 1: T:0.17000 C:0.18000 A:0.24000 G:0.41000
position 2: T:0.29000 C:0.31000 A:0.22000 G:0.18000
position 3: T:0.12000 C:0.40000 A:0.14000 G:0.34000
Average T:0.19333 C:0.29667 A:0.20000 G:0.31000
#5: NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065
position 1: T:0.17000 C:0.18000 A:0.24000 G:0.41000
position 2: T:0.29000 C:0.31000 A:0.22000 G:0.18000
position 3: T:0.12000 C:0.40000 A:0.14000 G:0.34000
Average T:0.19333 C:0.29667 A:0.20000 G:0.31000
#6: NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385
position 1: T:0.17000 C:0.18000 A:0.24000 G:0.41000
position 2: T:0.29000 C:0.31000 A:0.22000 G:0.18000
position 3: T:0.12000 C:0.40000 A:0.14000 G:0.34000
Average T:0.19333 C:0.29667 A:0.20000 G:0.31000
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 0 | Cys C TGT 0
TTC 24 | TCC 12 | TAC 0 | TGC 6
Leu L TTA 0 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 18 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 0 | Arg R CGT 0
CTC 6 | CCC 6 | CAC 6 | CGC 24
CTA 0 | CCA 0 | Gln Q CAA 12 | CGA 0
CTG 30 | CCG 6 | CAG 0 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 18 | ACC 24 | AAC 18 | AGC 0
ATA 0 | ACA 12 | Lys K AAA 18 | Arg R AGA 6
Met M ATG 18 | ACG 12 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 0 | Asp D GAT 12 | Gly G GGT 24
GTC 30 | GCC 36 | GAC 18 | GGC 12
GTA 6 | GCA 0 | Glu E GAA 12 | GGA 6
GTG 30 | GCG 24 | GAG 18 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17000 C:0.18000 A:0.24000 G:0.41000
position 2: T:0.29000 C:0.31000 A:0.22000 G:0.18000
position 3: T:0.12000 C:0.40000 A:0.14000 G:0.34000
Average T:0.19333 C:0.29667 A:0.20000 G:0.31000
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -392.231751 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299916 1.299845
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908761_1_2347_MLBR_RS11150: 0.000004, NC_002677_1_NP_302441_1_1313_ML2199: 0.000004, NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605: 0.000004, NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265: 0.000004, NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065: 0.000004, NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29992
omega (dN/dS) = 1.29985
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 229.1 70.9 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 229.1 70.9 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 229.1 70.9 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 229.1 70.9 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 229.1 70.9 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 229.1 70.9 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -392.231659 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908761_1_2347_MLBR_RS11150: 0.000004, NC_002677_1_NP_302441_1_1313_ML2199: 0.000004, NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605: 0.000004, NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265: 0.000004, NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065: 0.000004, NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -392.231659 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908761_1_2347_MLBR_RS11150: 0.000004, NC_002677_1_NP_302441_1_1313_ML2199: 0.000004, NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605: 0.000004, NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265: 0.000004, NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065: 0.000004, NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908761_1_2347_MLBR_RS11150)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 12): -392.231659 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000591 0.999320 0.000001 0.000001 0.271729
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908761_1_2347_MLBR_RS11150: 0.000004, NC_002677_1_NP_302441_1_1313_ML2199: 0.000004, NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605: 0.000004, NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265: 0.000004, NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065: 0.000004, NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00059 0.99932 0.00009
w: 0.00000 0.00000 0.27173
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Time used: 0:07
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -392.231730 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.088402 1.132237
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908761_1_2347_MLBR_RS11150: 0.000004, NC_002677_1_NP_302441_1_1313_ML2199: 0.000004, NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605: 0.000004, NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265: 0.000004, NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065: 0.000004, NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 1.08840 q = 1.13224
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.05674 0.15674 0.25239 0.34639 0.43991 0.53373 0.62861 0.72551 0.82604 0.93440
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 229.8 70.2 0.4900 0.0000 0.0000 0.0 0.0
7..2 0.000 229.8 70.2 0.4900 0.0000 0.0000 0.0 0.0
7..3 0.000 229.8 70.2 0.4900 0.0000 0.0000 0.0 0.0
7..4 0.000 229.8 70.2 0.4900 0.0000 0.0000 0.0 0.0
7..5 0.000 229.8 70.2 0.4900 0.0000 0.0000 0.0 0.0
7..6 0.000 229.8 70.2 0.4900 0.0000 0.0000 0.0 0.0
Time used: 0:11
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -392.231659 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 25.531600 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908761_1_2347_MLBR_RS11150: 0.000004, NC_002677_1_NP_302441_1_1313_ML2199: 0.000004, NZ_LVXE01000012_1_WP_010908761_1_415_A3216_RS05605: 0.000004, NZ_LYPH01000066_1_WP_010908761_1_2345_A8144_RS11265: 0.000004, NZ_CP029543_1_WP_010908761_1_2369_DIJ64_RS12065: 0.000004, NZ_AP014567_1_WP_010908761_1_2433_JK2ML_RS12385: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 25.53160
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 229.8 70.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908761_1_2347_MLBR_RS11150)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.101 0.101 0.101 0.100 0.100 0.099 0.099 0.099 0.098
Time used: 0:18
Model 1: NearlyNeutral -392.231659 Model 2: PositiveSelection -392.231659 Model 0: one-ratio -392.231751 Model 3: discrete -392.231659 Model 7: beta -392.23173 Model 8: beta&w>1 -392.231659 Model 0 vs 1 1.83999999990192E-4 Model 2 vs 1 0.0 Model 8 vs 7 1.4200000009623182E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
