--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:18:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML1011/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -572.35 -577.99
2 -572.40 -576.44
--------------------------------------
TOTAL -572.38 -577.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.500358 0.052995 0.101083 0.939600 0.464469 1323.41 1374.87 1.001
r(A<->C){all} 0.171380 0.021580 0.000314 0.464049 0.131056 211.28 322.36 1.000
r(A<->G){all} 0.168695 0.019535 0.000047 0.446833 0.134341 405.36 444.87 1.000
r(A<->T){all} 0.165111 0.021227 0.000046 0.457472 0.120420 256.89 263.98 1.000
r(C<->G){all} 0.156776 0.018980 0.000022 0.445604 0.118673 308.32 358.82 1.000
r(C<->T){all} 0.164102 0.018621 0.000081 0.440362 0.129142 320.91 334.69 1.000
r(G<->T){all} 0.173937 0.021991 0.000153 0.476540 0.135229 225.51 283.30 1.000
pi(A){all} 0.221622 0.000400 0.182973 0.259115 0.221046 1241.55 1338.82 1.001
pi(C){all} 0.335744 0.000515 0.291515 0.379624 0.335665 1073.45 1287.23 1.000
pi(G){all} 0.266044 0.000470 0.223316 0.308852 0.265816 1449.98 1475.49 1.000
pi(T){all} 0.176590 0.000345 0.141115 0.212391 0.176358 1306.76 1378.30 1.000
alpha{1,2} 0.402452 0.221782 0.000328 1.344947 0.233305 1103.49 1159.58 1.000
alpha{3} 0.455662 0.246486 0.000261 1.439950 0.287867 1317.27 1402.50 1.000
pinvar{all} 0.995925 0.000026 0.986550 0.999999 0.997590 1144.47 1183.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -563.166781
Model 2: PositiveSelection -563.166833
Model 0: one-ratio -563.166781
Model 7: beta -563.16682
Model 8: beta&w>1 -563.166826
Model 0 vs 1 0.0
Model 2 vs 1 1.0399999996479892E-4
Model 8 vs 7 1.1999999969702912E-5
>C1
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C2
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C3
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C4
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=140
C1 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C2 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C3 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C4 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
**************************************************
C1 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C2 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C3 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C4 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
**************************************************
C1 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C2 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C3 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C4 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 140 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 140 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [1680]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [1680]--->[1680]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.357 Mb, Max= 30.539 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C2 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C3 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C4 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
**************************************************
C1 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C2 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C3 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C4 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
**************************************************
C1 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C2 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C3 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C4 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
C2 TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
C3 TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
C4 TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
**************************************************
C1 GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
C2 GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
C3 GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
C4 GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
**************************************************
C1 TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
C2 TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
C3 TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
C4 TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
**************************************************
C1 CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
C2 CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
C3 CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
C4 CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
**************************************************
C1 CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
C2 CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
C3 CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
C4 CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
**************************************************
C1 GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
C2 GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
C3 GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
C4 GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
**************************************************
C1 AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
C2 AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
C3 AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
C4 AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
**************************************************
C1 TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
C2 TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
C3 TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
C4 TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
**************************************************
C1 GTGGGCGCAGCATCATCGGT
C2 GTGGGCGCAGCATCATCGGT
C3 GTGGGCGCAGCATCATCGGT
C4 GTGGGCGCAGCATCATCGGT
********************
>C1
TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
GTGGGCGCAGCATCATCGGT
>C2
TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
GTGGGCGCAGCATCATCGGT
>C3
TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
GTGGGCGCAGCATCATCGGT
>C4
TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
GTGGGCGCAGCATCATCGGT
>C1
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C2
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C3
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C4
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 4 taxa and 420 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579799829
Setting output file names to "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1337246001
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0279516671
Seed = 1630450950
Swapseed = 1579799829
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.35 % Dirichlet(Revmat{all})
1.35 % Slider(Revmat{all})
1.35 % Dirichlet(Pi{all})
1.35 % Slider(Pi{all})
2.70 % Multiplier(Alpha{1,2})
2.70 % Multiplier(Alpha{3})
2.70 % Slider(Pinvar{all})
13.51 % NNI(Tau{all},V{all})
13.51 % ParsSPR(Tau{all},V{all})
40.54 % Multiplier(V{all})
13.51 % Nodeslider(V{all})
5.41 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -784.152870 -- -26.620141
Chain 2 -- -784.152870 -- -26.620141
Chain 3 -- -784.152870 -- -26.620141
Chain 4 -- -784.152870 -- -26.620141
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -784.152870 -- -26.620141
Chain 2 -- -784.152870 -- -26.620141
Chain 3 -- -784.152870 -- -26.620141
Chain 4 -- -784.152870 -- -26.620141
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-784.153] (-784.153) (-784.153) (-784.153) * [-784.153] (-784.153) (-784.153) (-784.153)
500 -- [-581.698] (-579.712) (-582.603) (-578.202) * (-587.585) [-576.855] (-580.693) (-578.304) -- 0:00:00
1000 -- (-582.218) (-576.417) (-575.460) [-574.694] * (-574.922) (-581.628) [-576.523] (-583.735) -- 0:00:00
1500 -- [-577.889] (-576.310) (-577.967) (-576.483) * [-579.524] (-580.931) (-580.136) (-576.009) -- 0:00:00
2000 -- [-577.076] (-580.172) (-583.398) (-575.183) * (-587.215) (-575.436) [-575.950] (-576.725) -- 0:00:00
2500 -- [-576.083] (-578.656) (-578.562) (-579.454) * [-578.477] (-578.095) (-575.506) (-574.893) -- 0:00:00
3000 -- (-573.474) (-574.853) [-575.925] (-578.814) * [-578.540] (-584.259) (-578.026) (-574.485) -- 0:00:00
3500 -- (-577.519) (-577.861) (-580.077) [-575.995] * (-575.455) (-575.017) (-580.525) [-576.006] -- 0:00:00
4000 -- (-577.252) (-575.490) [-576.988] (-575.288) * (-574.957) (-579.264) (-579.847) [-575.614] -- 0:00:00
4500 -- (-581.659) (-579.759) [-578.605] (-575.553) * (-576.533) (-573.142) (-574.882) [-576.115] -- 0:00:00
5000 -- (-582.742) [-576.288] (-576.138) (-577.729) * (-574.497) [-573.605] (-577.210) (-575.145) -- 0:00:00
Average standard deviation of split frequencies: 0.052378
5500 -- (-579.463) (-579.915) (-574.854) [-576.456] * (-579.558) (-576.355) (-572.619) [-583.161] -- 0:00:00
6000 -- (-576.420) (-577.281) [-575.861] (-575.537) * (-581.069) [-577.988] (-573.850) (-574.430) -- 0:00:00
6500 -- (-579.354) (-580.439) [-574.399] (-576.835) * (-577.446) (-577.170) (-577.561) [-576.934] -- 0:00:00
7000 -- [-573.355] (-583.079) (-579.193) (-578.196) * (-578.615) [-574.293] (-574.359) (-577.304) -- 0:00:00
7500 -- (-577.426) (-578.840) (-577.690) [-574.788] * (-575.127) (-576.318) [-572.659] (-583.805) -- 0:00:00
8000 -- [-575.611] (-580.551) (-574.587) (-580.025) * (-575.254) (-574.538) (-575.093) [-578.122] -- 0:02:04
8500 -- (-580.155) (-579.613) (-573.397) [-572.242] * (-574.474) (-578.042) [-574.264] (-576.580) -- 0:01:56
9000 -- (-574.683) (-580.303) (-576.064) [-573.642] * (-582.480) (-581.264) (-572.228) [-573.950] -- 0:01:50
9500 -- (-579.669) [-576.557] (-577.125) (-578.845) * (-578.559) (-579.232) [-573.642] (-579.577) -- 0:01:44
10000 -- (-576.493) (-575.906) (-577.624) [-580.290] * (-574.994) (-580.100) [-573.671] (-572.132) -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- [-579.411] (-581.387) (-575.519) (-577.057) * (-575.446) (-574.362) [-573.436] (-572.076) -- 0:01:34
11000 -- (-579.020) (-582.230) (-580.174) [-574.218] * [-577.146] (-577.515) (-571.367) (-574.276) -- 0:01:29
11500 -- (-580.661) (-581.284) [-579.159] (-577.517) * (-577.872) (-574.305) (-573.933) [-572.799] -- 0:01:25
12000 -- [-574.185] (-582.261) (-579.992) (-581.893) * (-576.736) (-580.607) (-570.877) [-573.298] -- 0:01:22
12500 -- (-580.499) (-581.734) [-577.481] (-576.710) * [-576.649] (-575.643) (-571.779) (-572.480) -- 0:01:19
13000 -- (-579.529) (-575.042) [-574.918] (-578.611) * (-575.985) (-572.187) (-571.674) [-573.178] -- 0:01:15
13500 -- (-577.091) [-574.976] (-576.101) (-576.569) * (-576.851) [-573.178] (-572.144) (-571.953) -- 0:01:13
14000 -- [-575.281] (-582.044) (-574.407) (-576.036) * (-577.242) (-575.814) (-571.900) [-571.969] -- 0:01:10
14500 -- (-575.617) [-577.525] (-577.560) (-578.380) * (-577.601) (-574.093) [-575.215] (-573.322) -- 0:01:07
15000 -- (-577.444) [-576.505] (-577.058) (-580.686) * [-581.441] (-574.722) (-572.564) (-572.598) -- 0:01:05
Average standard deviation of split frequencies: 0.019642
15500 -- (-575.712) (-580.383) (-586.283) [-577.141] * (-580.207) [-573.417] (-572.921) (-572.844) -- 0:01:03
16000 -- (-576.764) (-582.064) [-574.527] (-576.049) * (-580.735) (-574.049) [-575.534] (-572.567) -- 0:01:01
16500 -- (-584.377) [-582.120] (-579.735) (-578.258) * [-576.277] (-572.564) (-573.120) (-578.703) -- 0:00:59
17000 -- (-573.867) (-578.105) [-576.368] (-576.893) * (-583.647) [-573.367] (-573.007) (-572.731) -- 0:00:57
17500 -- (-582.857) [-580.059] (-576.467) (-574.518) * (-578.600) (-572.694) [-575.662] (-576.177) -- 0:00:56
18000 -- (-574.216) [-574.895] (-580.292) (-577.765) * (-576.754) [-570.960] (-570.964) (-572.220) -- 0:00:54
18500 -- (-576.718) (-580.495) (-576.920) [-574.098] * (-578.016) (-571.449) (-578.668) [-573.065] -- 0:00:53
19000 -- (-577.852) (-575.408) [-575.057] (-584.985) * [-579.159] (-572.539) (-573.745) (-573.579) -- 0:00:51
19500 -- [-575.327] (-577.910) (-575.994) (-576.756) * (-574.700) (-572.962) (-571.267) [-572.205] -- 0:00:50
20000 -- [-580.406] (-577.397) (-577.467) (-579.534) * (-577.504) (-576.871) (-579.936) [-573.732] -- 0:00:49
Average standard deviation of split frequencies: 0.060826
20500 -- (-575.864) (-576.187) (-575.325) [-573.250] * [-574.199] (-573.425) (-573.565) (-572.838) -- 0:00:47
21000 -- (-577.468) (-578.821) [-575.252] (-580.904) * [-574.106] (-571.198) (-572.884) (-573.365) -- 0:00:46
21500 -- (-573.671) (-582.647) (-575.942) [-576.182] * (-575.436) [-571.205] (-576.890) (-573.239) -- 0:00:45
22000 -- (-576.868) (-578.003) [-577.056] (-575.616) * (-579.843) (-573.049) [-571.440] (-571.850) -- 0:00:44
22500 -- (-581.313) [-574.153] (-577.426) (-577.146) * [-575.388] (-571.579) (-572.045) (-571.823) -- 0:00:43
23000 -- (-578.347) [-575.196] (-578.062) (-579.123) * (-573.923) [-571.876] (-576.301) (-571.219) -- 0:00:42
23500 -- (-576.051) (-576.936) [-576.346] (-578.071) * (-577.092) [-571.716] (-574.484) (-573.599) -- 0:00:41
24000 -- (-575.703) (-581.411) [-572.807] (-579.616) * (-581.768) (-572.459) (-572.080) [-574.926] -- 0:00:40
24500 -- (-579.395) [-576.951] (-579.399) (-577.410) * (-578.175) (-570.999) (-574.553) [-572.268] -- 0:01:19
25000 -- (-578.033) [-572.851] (-577.170) (-574.955) * (-580.985) (-573.331) (-572.746) [-575.132] -- 0:01:18
Average standard deviation of split frequencies: 0.060436
25500 -- [-574.855] (-578.369) (-580.454) (-583.134) * [-577.288] (-577.294) (-573.376) (-571.042) -- 0:01:16
26000 -- (-575.712) [-578.984] (-587.552) (-578.010) * (-579.326) (-572.331) [-571.413] (-573.319) -- 0:01:14
26500 -- (-571.698) [-577.169] (-578.230) (-583.291) * (-575.746) [-571.668] (-571.737) (-573.690) -- 0:01:13
27000 -- (-571.403) (-578.895) [-579.145] (-580.784) * [-575.238] (-573.753) (-575.616) (-571.778) -- 0:01:12
27500 -- (-573.353) (-579.705) [-577.291] (-581.392) * (-578.091) (-576.433) (-571.349) [-573.123] -- 0:01:10
28000 -- (-575.640) (-583.554) (-572.754) [-576.519] * (-576.340) (-575.696) [-574.783] (-571.972) -- 0:01:09
28500 -- (-580.964) (-576.890) (-581.394) [-578.111] * (-576.935) (-578.408) [-571.789] (-572.789) -- 0:01:08
29000 -- (-577.824) [-581.995] (-576.417) (-582.189) * (-580.039) (-573.806) (-572.188) [-571.964] -- 0:01:06
29500 -- (-573.462) (-577.072) [-577.440] (-579.511) * (-574.874) (-573.524) (-572.927) [-573.739] -- 0:01:05
30000 -- [-571.670] (-576.205) (-577.610) (-577.742) * (-581.042) (-574.734) [-577.436] (-584.243) -- 0:01:04
Average standard deviation of split frequencies: 0.051240
30500 -- (-576.620) [-577.722] (-581.604) (-573.743) * (-575.655) [-573.504] (-578.099) (-581.559) -- 0:01:03
31000 -- (-572.548) [-576.488] (-575.772) (-576.058) * (-575.720) (-571.582) (-572.184) [-572.318] -- 0:01:02
31500 -- (-573.196) (-575.342) (-575.964) [-573.025] * (-578.321) (-572.558) (-573.205) [-575.501] -- 0:01:01
32000 -- (-571.394) (-577.709) [-579.755] (-575.807) * (-575.598) [-575.101] (-571.752) (-572.855) -- 0:01:00
32500 -- [-571.270] (-575.017) (-575.567) (-579.408) * (-576.839) (-573.366) [-576.020] (-572.393) -- 0:00:59
33000 -- (-572.536) (-575.623) (-578.887) [-575.231] * (-573.745) (-572.716) (-572.492) [-572.114] -- 0:00:58
33500 -- (-573.873) [-578.587] (-581.902) (-576.289) * [-574.430] (-573.220) (-572.161) (-573.747) -- 0:00:57
34000 -- (-571.886) (-582.212) (-581.101) [-575.916] * (-577.772) (-574.392) (-573.451) [-574.135] -- 0:00:56
34500 -- (-573.731) (-577.674) (-576.145) [-575.754] * (-580.405) [-571.729] (-572.150) (-573.857) -- 0:00:55
35000 -- [-573.215] (-580.522) (-583.841) (-574.001) * [-576.921] (-573.766) (-571.079) (-572.515) -- 0:00:55
Average standard deviation of split frequencies: 0.043649
35500 -- (-573.405) [-580.039] (-579.111) (-573.872) * (-573.649) (-576.723) (-573.064) [-575.844] -- 0:00:54
36000 -- (-574.077) [-577.384] (-579.400) (-581.210) * (-581.430) [-577.160] (-575.860) (-574.569) -- 0:00:53
36500 -- (-572.192) [-575.071] (-574.621) (-579.754) * [-577.727] (-571.100) (-580.072) (-578.503) -- 0:00:52
37000 -- (-571.226) [-575.305] (-577.224) (-577.200) * (-578.728) (-572.891) (-576.247) [-573.228] -- 0:00:52
37500 -- (-571.132) (-576.302) (-577.714) [-576.483] * (-578.912) (-573.737) (-571.883) [-572.634] -- 0:00:51
38000 -- (-576.167) (-576.157) [-574.553] (-577.894) * (-582.468) [-577.311] (-578.503) (-573.203) -- 0:00:50
38500 -- [-574.417] (-577.991) (-576.796) (-582.480) * (-576.263) (-575.987) (-580.072) [-574.248] -- 0:00:49
39000 -- (-573.874) (-580.610) [-580.114] (-581.081) * (-574.426) (-571.629) (-575.766) [-571.668] -- 0:00:49
39500 -- [-573.857] (-582.002) (-579.362) (-584.430) * (-576.609) (-571.919) (-574.877) [-571.279] -- 0:00:48
40000 -- (-574.056) (-579.258) [-580.004] (-572.960) * [-573.660] (-572.244) (-574.354) (-574.359) -- 0:00:48
Average standard deviation of split frequencies: 0.038640
40500 -- (-571.469) (-578.344) [-575.033] (-572.280) * (-573.807) (-573.569) (-574.470) [-573.173] -- 0:00:47
41000 -- (-573.951) (-575.715) [-574.733] (-572.606) * (-573.308) (-572.831) [-573.266] (-575.997) -- 0:00:46
41500 -- (-572.298) (-579.320) (-582.256) [-571.536] * (-573.054) (-572.143) (-573.331) [-574.684] -- 0:00:46
42000 -- (-572.448) (-577.301) [-576.937] (-573.761) * (-575.047) (-575.189) (-572.732) [-572.363] -- 0:00:45
42500 -- (-571.185) [-577.612] (-581.302) (-573.926) * (-572.211) (-574.402) (-571.645) [-573.381] -- 0:00:45
43000 -- (-572.002) [-576.111] (-576.160) (-573.702) * (-570.890) (-576.957) (-573.204) [-571.489] -- 0:00:44
43500 -- (-573.440) [-580.206] (-576.071) (-571.865) * (-571.592) (-579.356) (-572.814) [-573.498] -- 0:00:43
44000 -- [-571.483] (-581.113) (-574.275) (-572.231) * (-571.386) [-573.904] (-575.734) (-574.134) -- 0:00:43
44500 -- [-574.510] (-578.811) (-579.333) (-572.379) * (-574.078) [-571.596] (-574.713) (-572.958) -- 0:00:42
45000 -- (-572.863) (-582.789) (-576.812) [-572.170] * (-571.329) (-573.790) (-576.267) [-573.274] -- 0:01:03
Average standard deviation of split frequencies: 0.034160
45500 -- [-572.265] (-575.696) (-575.217) (-572.885) * (-570.751) (-572.484) [-574.244] (-571.509) -- 0:01:02
46000 -- [-572.700] (-581.660) (-575.087) (-572.252) * [-572.036] (-572.282) (-576.223) (-575.968) -- 0:01:02
46500 -- (-572.358) (-577.377) [-578.981] (-571.767) * (-573.610) (-574.061) (-573.851) [-575.589] -- 0:01:01
47000 -- (-576.469) [-578.731] (-575.717) (-571.860) * [-573.191] (-572.476) (-577.016) (-572.011) -- 0:01:00
47500 -- (-572.717) (-577.378) (-577.006) [-573.152] * [-574.732] (-573.747) (-573.039) (-575.989) -- 0:01:00
48000 -- (-572.022) (-576.015) [-577.844] (-578.072) * [-575.319] (-572.886) (-573.289) (-574.126) -- 0:00:59
48500 -- (-576.246) (-578.484) (-579.258) [-574.542] * (-574.336) [-576.241] (-575.804) (-578.340) -- 0:00:58
49000 -- (-573.886) (-576.325) (-579.774) [-572.592] * (-575.072) (-572.507) (-571.038) [-572.433] -- 0:00:58
49500 -- (-575.201) (-586.512) (-579.310) [-575.244] * (-574.849) [-576.460] (-571.679) (-574.063) -- 0:00:57
50000 -- (-573.490) (-580.078) (-579.753) [-573.227] * [-575.088] (-573.435) (-571.002) (-573.422) -- 0:00:57
Average standard deviation of split frequencies: 0.024811
50500 -- (-572.139) (-573.661) [-576.019] (-572.239) * (-574.137) [-574.504] (-572.180) (-573.402) -- 0:00:56
51000 -- (-570.848) (-574.145) [-579.192] (-572.344) * (-572.137) [-571.652] (-571.900) (-572.861) -- 0:00:55
51500 -- (-572.933) (-572.710) [-577.487] (-574.158) * (-573.449) (-572.356) (-573.331) [-572.975] -- 0:00:55
52000 -- [-573.465] (-573.861) (-576.291) (-575.643) * (-575.564) (-572.303) (-573.059) [-571.093] -- 0:00:54
52500 -- (-572.617) (-579.494) [-577.032] (-574.546) * (-571.510) (-579.158) [-575.414] (-572.807) -- 0:00:54
53000 -- (-571.815) [-575.207] (-581.392) (-574.238) * (-573.114) (-583.188) (-571.639) [-571.707] -- 0:00:53
53500 -- (-573.822) [-582.038] (-578.055) (-573.401) * (-578.625) (-575.374) (-572.843) [-574.589] -- 0:00:53
54000 -- (-573.039) (-579.846) [-578.705] (-573.445) * (-572.400) (-571.758) [-571.628] (-573.406) -- 0:00:52
54500 -- [-574.716] (-575.764) (-576.942) (-573.032) * (-572.443) [-573.644] (-571.819) (-575.641) -- 0:00:52
55000 -- (-573.197) (-574.680) [-578.563] (-572.192) * (-572.564) (-572.219) (-572.695) [-572.042] -- 0:00:51
Average standard deviation of split frequencies: 0.022448
55500 -- (-572.984) [-576.587] (-577.750) (-576.383) * [-573.434] (-577.049) (-571.925) (-573.482) -- 0:00:51
56000 -- [-575.837] (-578.274) (-578.507) (-584.848) * [-572.276] (-571.875) (-572.562) (-576.085) -- 0:00:50
56500 -- (-575.750) (-575.100) [-577.230] (-588.706) * (-571.854) [-575.051] (-579.627) (-576.667) -- 0:00:50
57000 -- (-573.616) (-581.702) (-578.268) [-572.805] * [-572.137] (-572.301) (-575.035) (-577.405) -- 0:00:49
57500 -- (-571.514) (-576.014) (-583.299) [-570.758] * [-573.090] (-573.091) (-571.547) (-574.984) -- 0:00:49
58000 -- (-572.320) (-582.552) (-576.643) [-570.745] * (-572.870) [-573.775] (-572.286) (-571.771) -- 0:00:48
58500 -- (-573.546) [-575.315] (-584.474) (-571.262) * (-575.318) (-571.186) (-576.281) [-573.544] -- 0:00:48
59000 -- [-573.872] (-574.391) (-575.230) (-572.163) * (-571.927) [-572.570] (-573.374) (-572.590) -- 0:00:47
59500 -- [-573.947] (-577.215) (-577.200) (-570.889) * [-572.096] (-576.712) (-574.344) (-573.031) -- 0:00:47
60000 -- (-577.998) (-581.327) (-578.965) [-572.921] * (-572.239) (-573.282) [-574.773] (-573.000) -- 0:00:47
Average standard deviation of split frequencies: 0.031082
60500 -- [-575.125] (-577.799) (-580.471) (-573.226) * (-573.839) (-573.737) [-572.312] (-572.297) -- 0:00:46
61000 -- (-576.600) [-575.536] (-575.199) (-571.544) * (-575.689) [-574.743] (-573.039) (-573.281) -- 0:00:46
61500 -- (-573.628) (-578.265) (-585.036) [-575.452] * (-576.594) (-572.713) [-572.654] (-574.004) -- 0:00:45
62000 -- (-575.134) [-582.084] (-582.518) (-573.214) * [-571.735] (-571.732) (-572.520) (-577.344) -- 0:00:45
62500 -- (-575.646) (-577.075) [-575.280] (-574.810) * [-575.965] (-572.609) (-572.519) (-576.023) -- 0:00:45
63000 -- (-573.589) (-577.538) (-573.285) [-574.008] * (-571.855) (-574.051) [-572.431] (-573.550) -- 0:00:44
63500 -- (-573.706) [-573.938] (-574.179) (-575.972) * (-571.721) (-573.148) [-573.425] (-584.170) -- 0:00:44
64000 -- (-575.581) (-572.927) (-572.943) [-572.267] * [-574.903] (-572.918) (-574.552) (-572.474) -- 0:00:43
64500 -- (-575.740) (-573.229) [-576.257] (-572.087) * (-573.865) (-571.790) (-572.552) [-575.069] -- 0:00:58
65000 -- (-574.787) (-573.571) (-574.166) [-572.708] * (-572.992) (-575.459) (-571.114) [-573.482] -- 0:00:57
Average standard deviation of split frequencies: 0.028570
65500 -- [-573.645] (-573.634) (-571.693) (-572.012) * (-570.901) (-574.621) (-572.052) [-571.581] -- 0:00:57
66000 -- (-577.215) (-572.871) [-573.652] (-572.529) * (-574.011) [-573.241] (-571.912) (-571.470) -- 0:00:56
66500 -- [-573.886] (-571.900) (-576.954) (-573.312) * [-571.622] (-573.951) (-570.958) (-581.095) -- 0:00:56
67000 -- (-574.864) [-572.734] (-573.845) (-572.452) * (-572.980) (-574.133) [-573.098] (-575.709) -- 0:00:55
67500 -- (-573.662) (-574.105) (-572.602) [-571.736] * (-572.328) (-571.916) (-573.384) [-571.859] -- 0:00:55
68000 -- (-573.703) (-573.697) (-574.903) [-573.601] * (-575.645) [-572.041] (-573.887) (-572.914) -- 0:00:54
68500 -- (-574.948) (-571.763) (-572.412) [-571.462] * (-574.470) [-572.427] (-573.047) (-572.579) -- 0:00:54
69000 -- (-575.792) (-573.571) [-571.878] (-573.519) * (-571.233) [-572.261] (-573.428) (-575.369) -- 0:00:53
69500 -- (-574.726) (-573.641) [-571.554] (-577.755) * (-574.767) (-574.185) (-573.759) [-574.776] -- 0:00:53
70000 -- (-570.978) (-572.180) [-571.859] (-572.574) * (-574.061) (-575.608) (-572.792) [-572.703] -- 0:00:53
Average standard deviation of split frequencies: 0.026683
70500 -- (-575.513) (-572.316) [-573.103] (-572.933) * (-575.650) (-573.732) (-572.772) [-574.958] -- 0:00:52
71000 -- (-575.987) (-571.301) [-573.670] (-572.182) * (-571.942) (-572.532) [-571.833] (-573.481) -- 0:00:52
71500 -- [-572.222] (-572.793) (-577.784) (-574.836) * (-572.489) [-578.183] (-577.843) (-579.339) -- 0:00:51
72000 -- (-576.166) (-574.092) (-571.619) [-572.809] * (-575.710) [-574.469] (-574.744) (-573.774) -- 0:00:51
72500 -- (-576.067) (-578.435) (-571.656) [-572.112] * (-580.136) [-572.528] (-575.111) (-572.490) -- 0:00:51
73000 -- (-576.481) [-573.293] (-575.485) (-571.966) * (-572.672) (-573.157) (-572.610) [-572.190] -- 0:00:50
73500 -- [-571.350] (-572.165) (-578.528) (-571.372) * (-575.987) (-570.923) [-572.291] (-574.957) -- 0:00:50
74000 -- [-571.524] (-573.587) (-571.386) (-572.959) * [-571.736] (-571.429) (-576.607) (-572.715) -- 0:00:50
74500 -- [-571.857] (-574.075) (-571.756) (-580.795) * (-580.277) (-573.192) (-575.176) [-573.352] -- 0:00:49
75000 -- (-574.125) (-571.969) (-571.961) [-571.047] * (-575.706) (-573.051) [-574.169] (-573.019) -- 0:00:49
Average standard deviation of split frequencies: 0.020676
75500 -- [-572.409] (-571.707) (-572.097) (-574.920) * (-573.295) (-570.934) (-570.851) [-572.570] -- 0:00:48
76000 -- [-574.123] (-576.077) (-575.217) (-573.629) * (-576.318) (-572.943) [-573.593] (-580.244) -- 0:00:48
76500 -- (-577.717) [-572.906] (-575.880) (-574.080) * (-574.315) [-571.997] (-571.419) (-574.731) -- 0:00:48
77000 -- (-571.987) (-572.772) [-571.230] (-572.192) * (-573.528) (-576.447) (-574.758) [-573.289] -- 0:00:47
77500 -- (-573.056) (-572.240) [-572.096] (-573.413) * [-574.094] (-577.992) (-573.393) (-577.133) -- 0:00:47
78000 -- (-572.972) (-571.687) (-573.103) [-573.497] * (-571.700) (-578.297) [-571.308] (-575.861) -- 0:00:47
78500 -- (-573.289) (-571.129) (-572.176) [-571.256] * [-573.156] (-573.807) (-573.330) (-573.603) -- 0:00:46
79000 -- (-572.156) (-570.910) (-576.325) [-571.817] * (-570.839) [-574.987] (-577.800) (-574.943) -- 0:00:46
79500 -- (-576.346) (-574.056) (-573.032) [-573.857] * (-572.064) [-571.887] (-572.189) (-571.963) -- 0:00:46
80000 -- (-575.561) (-572.155) [-573.827] (-571.331) * [-574.499] (-571.539) (-573.206) (-572.322) -- 0:00:46
Average standard deviation of split frequencies: 0.023375
80500 -- [-572.817] (-571.374) (-574.752) (-572.240) * (-572.845) (-571.167) [-573.170] (-572.120) -- 0:00:45
81000 -- (-571.739) (-571.913) [-574.974] (-573.135) * (-574.242) [-571.859] (-573.233) (-573.977) -- 0:00:45
81500 -- (-575.081) (-573.443) (-572.901) [-571.622] * (-571.501) (-571.401) [-571.814] (-571.674) -- 0:00:45
82000 -- (-577.189) (-573.062) [-571.660] (-573.111) * [-575.084] (-572.489) (-575.702) (-571.797) -- 0:00:44
82500 -- (-571.628) (-573.047) [-571.674] (-575.256) * (-574.147) (-572.316) (-573.686) [-571.237] -- 0:00:44
83000 -- (-577.465) (-574.016) (-573.170) [-574.695] * (-572.276) (-572.684) [-571.275] (-571.558) -- 0:00:44
83500 -- (-573.117) (-580.965) (-571.590) [-573.172] * [-573.532] (-577.732) (-573.162) (-572.711) -- 0:00:43
84000 -- (-573.536) (-581.665) [-573.752] (-571.386) * (-573.092) (-572.898) (-571.046) [-572.170] -- 0:00:43
84500 -- (-572.992) [-573.448] (-572.032) (-570.848) * (-572.907) [-572.612] (-574.900) (-574.931) -- 0:00:43
85000 -- (-573.268) [-574.319] (-573.066) (-573.542) * (-573.681) [-571.332] (-571.342) (-572.029) -- 0:00:53
Average standard deviation of split frequencies: 0.018271
85500 -- [-570.766] (-573.085) (-571.437) (-571.703) * (-572.382) (-573.528) (-573.250) [-570.830] -- 0:00:53
86000 -- [-572.993] (-573.640) (-572.769) (-572.122) * (-571.534) (-573.148) (-572.455) [-571.613] -- 0:00:53
86500 -- [-575.158] (-573.539) (-578.436) (-571.684) * (-572.451) [-574.527] (-572.614) (-572.457) -- 0:00:52
87000 -- (-571.432) [-573.739] (-570.946) (-571.358) * (-571.753) (-572.736) (-572.194) [-576.055] -- 0:00:52
87500 -- (-572.997) (-575.612) [-571.504] (-572.219) * (-572.178) (-570.871) (-572.711) [-574.339] -- 0:00:52
88000 -- (-576.708) [-576.005] (-570.913) (-571.600) * [-572.397] (-576.159) (-573.524) (-571.108) -- 0:00:51
88500 -- (-575.533) (-576.179) (-571.464) [-575.865] * [-572.281] (-576.073) (-572.248) (-574.494) -- 0:00:51
89000 -- (-572.926) [-578.163] (-575.692) (-572.668) * (-573.121) (-575.293) (-572.342) [-571.833] -- 0:00:51
89500 -- (-576.156) (-571.184) [-571.356] (-576.043) * (-571.789) (-576.097) [-573.736] (-571.510) -- 0:00:50
90000 -- (-576.987) (-576.633) [-576.561] (-576.387) * [-572.618] (-575.493) (-573.515) (-575.695) -- 0:00:50
Average standard deviation of split frequencies: 0.010399
90500 -- (-573.102) (-573.541) (-582.261) [-571.776] * (-572.335) (-573.374) [-571.362] (-573.890) -- 0:00:50
91000 -- (-575.088) (-575.111) (-574.492) [-574.252] * (-574.366) [-572.745] (-571.492) (-572.854) -- 0:00:49
91500 -- (-574.933) (-573.914) (-574.069) [-574.309] * (-575.845) (-573.908) (-573.543) [-573.338] -- 0:00:49
92000 -- (-573.830) [-572.008] (-571.838) (-570.849) * (-573.789) [-571.163] (-575.047) (-573.050) -- 0:00:49
92500 -- [-572.309] (-575.384) (-571.736) (-573.054) * (-573.151) [-572.057] (-572.313) (-574.400) -- 0:00:49
93000 -- (-574.503) [-574.178] (-573.278) (-572.945) * (-582.932) [-572.316] (-571.267) (-571.565) -- 0:00:48
93500 -- (-572.410) (-571.270) [-571.345] (-574.089) * (-576.487) [-574.995] (-573.294) (-576.033) -- 0:00:48
94000 -- (-572.933) (-573.205) [-571.924] (-572.801) * (-572.252) (-573.476) [-572.559] (-574.308) -- 0:00:48
94500 -- [-572.916] (-572.353) (-573.407) (-572.277) * (-572.308) (-572.990) [-573.286] (-573.312) -- 0:00:47
95000 -- (-576.733) (-573.720) (-574.460) [-572.823] * (-573.379) (-572.433) (-572.716) [-572.811] -- 0:00:47
Average standard deviation of split frequencies: 0.019642
95500 -- (-572.661) (-571.208) [-572.870] (-573.643) * (-574.501) (-571.680) [-572.281] (-573.508) -- 0:00:47
96000 -- (-574.830) (-571.031) [-572.233] (-576.514) * (-575.680) (-577.592) [-571.984] (-574.599) -- 0:00:47
96500 -- [-574.011] (-575.392) (-572.218) (-571.283) * (-571.873) (-576.702) (-573.653) [-575.188] -- 0:00:46
97000 -- [-573.389] (-574.754) (-575.432) (-576.679) * (-573.443) [-572.205] (-579.229) (-584.288) -- 0:00:46
97500 -- (-576.208) (-573.318) [-572.772] (-572.832) * (-571.547) (-572.204) (-577.300) [-574.311] -- 0:00:46
98000 -- [-571.450] (-574.843) (-572.289) (-574.177) * (-575.749) (-572.782) (-572.257) [-571.198] -- 0:00:46
98500 -- [-572.652] (-572.303) (-572.320) (-572.316) * (-572.088) [-570.710] (-572.828) (-572.353) -- 0:00:45
99000 -- (-572.231) [-573.157] (-573.783) (-571.211) * (-572.690) (-572.696) [-574.015] (-573.168) -- 0:00:45
99500 -- (-571.224) [-572.504] (-571.214) (-571.985) * (-573.801) (-574.323) (-576.618) [-573.636] -- 0:00:45
100000 -- [-570.841] (-573.061) (-572.598) (-573.471) * (-576.504) [-573.126] (-576.350) (-577.808) -- 0:00:45
Average standard deviation of split frequencies: 0.024975
100500 -- (-572.517) (-573.886) [-571.874] (-573.473) * [-574.855] (-573.074) (-572.628) (-574.518) -- 0:00:44
101000 -- (-573.759) (-571.073) (-576.269) [-571.891] * (-573.542) [-571.844] (-572.221) (-575.388) -- 0:00:44
101500 -- [-571.315] (-575.467) (-573.456) (-581.569) * (-575.217) [-572.944] (-573.931) (-575.000) -- 0:00:44
102000 -- (-572.094) [-572.651] (-574.991) (-573.480) * [-576.054] (-571.360) (-572.426) (-571.091) -- 0:00:44
102500 -- (-571.800) (-571.971) (-575.379) [-577.170] * (-575.137) (-573.842) (-574.446) [-572.146] -- 0:00:43
103000 -- (-573.700) (-572.492) [-573.378] (-575.527) * [-575.888] (-572.825) (-575.288) (-572.667) -- 0:00:43
103500 -- (-577.855) [-576.841] (-572.972) (-573.595) * (-573.246) (-572.384) [-572.029] (-575.005) -- 0:00:43
104000 -- (-574.933) (-575.081) (-573.341) [-575.696] * (-574.795) (-576.950) (-572.005) [-575.911] -- 0:00:43
104500 -- (-572.167) (-576.345) (-572.422) [-573.217] * (-572.427) [-574.111] (-573.939) (-572.875) -- 0:00:42
105000 -- [-572.452] (-574.809) (-575.586) (-575.308) * (-573.645) (-572.748) [-572.947] (-571.864) -- 0:00:42
Average standard deviation of split frequencies: 0.023718
105500 -- (-573.053) (-573.900) (-571.538) [-572.337] * [-571.439] (-575.535) (-573.031) (-576.318) -- 0:00:42
106000 -- (-572.937) (-574.585) (-575.265) [-571.735] * (-572.391) (-577.336) (-573.891) [-571.714] -- 0:00:42
106500 -- (-573.702) (-572.670) [-573.586] (-573.424) * (-573.401) (-575.105) (-572.348) [-572.942] -- 0:00:41
107000 -- (-574.059) (-571.714) [-573.026] (-574.947) * [-572.094] (-573.282) (-572.966) (-573.688) -- 0:00:41
107500 -- [-573.623] (-571.131) (-571.843) (-571.370) * (-573.862) [-571.985] (-572.951) (-575.538) -- 0:00:49
108000 -- [-571.885] (-572.361) (-575.052) (-575.978) * (-573.795) (-572.327) (-573.478) [-574.070] -- 0:00:49
108500 -- (-577.705) (-575.807) [-571.206] (-579.130) * (-576.827) [-573.374] (-574.473) (-571.337) -- 0:00:49
109000 -- (-571.667) (-572.776) [-572.229] (-579.993) * (-575.470) (-572.205) (-577.007) [-572.154] -- 0:00:49
109500 -- [-572.716] (-575.523) (-572.416) (-572.164) * [-574.323] (-573.347) (-574.874) (-570.976) -- 0:00:48
110000 -- (-577.701) [-570.932] (-574.384) (-572.265) * [-571.575] (-573.616) (-581.371) (-573.685) -- 0:00:48
Average standard deviation of split frequencies: 0.017039
110500 -- (-573.489) (-571.103) [-575.854] (-571.442) * (-571.523) [-571.272] (-573.836) (-570.958) -- 0:00:48
111000 -- (-573.357) (-574.472) [-572.467] (-571.516) * (-572.191) (-573.924) [-574.451] (-574.084) -- 0:00:48
111500 -- [-576.654] (-572.314) (-574.589) (-572.269) * (-573.689) [-575.233] (-571.951) (-572.865) -- 0:00:47
112000 -- [-573.412] (-572.603) (-574.617) (-571.778) * [-573.069] (-573.228) (-572.332) (-572.283) -- 0:00:47
112500 -- (-574.146) (-575.415) (-573.879) [-573.977] * (-572.724) (-576.402) [-572.405] (-571.480) -- 0:00:47
113000 -- (-577.900) [-575.758] (-576.560) (-571.222) * (-577.312) (-577.817) (-578.691) [-572.404] -- 0:00:47
113500 -- (-575.163) [-572.671] (-574.345) (-576.694) * (-573.627) (-574.476) [-571.443] (-572.370) -- 0:00:46
114000 -- (-571.304) (-572.675) (-576.901) [-574.593] * (-571.843) (-574.032) (-573.956) [-572.462] -- 0:00:46
114500 -- (-573.699) (-573.922) (-573.802) [-572.082] * (-571.129) (-572.572) (-572.026) [-574.709] -- 0:00:46
115000 -- (-572.207) (-571.877) [-576.749] (-571.314) * (-572.486) (-574.555) (-571.809) [-572.974] -- 0:00:46
Average standard deviation of split frequencies: 0.016255
115500 -- [-574.362] (-575.103) (-574.943) (-572.414) * (-573.363) (-570.897) (-573.988) [-574.354] -- 0:00:45
116000 -- [-573.294] (-573.690) (-575.640) (-573.291) * (-572.742) (-572.249) [-573.778] (-573.962) -- 0:00:45
116500 -- (-574.358) (-571.406) [-574.359] (-572.145) * [-573.784] (-571.206) (-575.769) (-573.829) -- 0:00:45
117000 -- (-571.905) (-573.534) [-576.893] (-571.805) * (-575.214) (-573.630) (-576.494) [-573.309] -- 0:00:45
117500 -- [-575.231] (-572.073) (-575.529) (-571.189) * (-572.086) (-575.543) (-571.161) [-573.359] -- 0:00:45
118000 -- (-575.209) (-571.901) (-572.989) [-571.314] * [-571.839] (-573.446) (-571.153) (-572.271) -- 0:00:44
118500 -- [-571.047] (-571.909) (-575.934) (-572.413) * (-571.595) (-573.242) (-572.090) [-572.033] -- 0:00:44
119000 -- (-575.533) (-571.511) [-573.484] (-576.089) * (-571.949) (-571.226) (-575.728) [-571.861] -- 0:00:44
119500 -- (-577.068) (-573.042) [-575.068] (-573.689) * (-576.474) (-574.347) [-573.396] (-573.064) -- 0:00:44
120000 -- (-572.291) [-572.840] (-571.869) (-575.023) * (-572.765) [-573.183] (-573.418) (-573.857) -- 0:00:44
Average standard deviation of split frequencies: 0.005209
120500 -- [-570.948] (-573.566) (-573.353) (-574.567) * (-572.208) [-573.595] (-571.961) (-572.777) -- 0:00:43
121000 -- (-571.932) [-571.115] (-573.299) (-573.633) * (-572.077) (-571.972) (-572.240) [-571.121] -- 0:00:43
121500 -- [-573.973] (-571.701) (-572.576) (-576.021) * (-573.800) [-572.406] (-572.630) (-573.142) -- 0:00:43
122000 -- (-575.486) [-571.531] (-575.405) (-575.175) * [-572.778] (-574.264) (-572.603) (-573.342) -- 0:00:43
122500 -- (-577.411) (-572.355) [-572.282] (-574.861) * (-573.830) [-573.079] (-573.939) (-571.619) -- 0:00:42
123000 -- (-574.077) (-573.792) [-571.707] (-571.934) * (-575.371) (-571.835) (-578.215) [-573.198] -- 0:00:42
123500 -- (-572.980) (-571.987) (-570.962) [-574.714] * (-571.846) (-571.874) (-572.395) [-577.256] -- 0:00:42
124000 -- [-571.173] (-572.222) (-570.787) (-572.714) * (-571.722) (-571.325) [-572.591] (-574.068) -- 0:00:42
124500 -- (-571.528) (-571.975) (-571.071) [-573.737] * (-570.990) (-573.357) [-571.537] (-574.949) -- 0:00:42
125000 -- (-572.901) [-571.056] (-571.940) (-572.000) * [-570.848] (-573.151) (-576.642) (-576.271) -- 0:00:42
Average standard deviation of split frequencies: 0.012471
125500 -- (-573.954) (-572.241) [-573.718] (-571.333) * (-571.674) [-573.266] (-572.394) (-574.265) -- 0:00:41
126000 -- [-574.071] (-575.031) (-571.632) (-572.968) * (-571.758) (-572.900) (-574.985) [-572.280] -- 0:00:41
126500 -- (-573.608) [-573.282] (-575.681) (-572.559) * (-573.203) [-572.232] (-575.324) (-573.301) -- 0:00:41
127000 -- (-573.384) [-572.806] (-575.315) (-573.358) * [-573.800] (-572.173) (-575.570) (-572.585) -- 0:00:41
127500 -- (-570.740) (-576.190) [-576.575] (-575.738) * (-575.419) (-574.190) (-571.425) [-572.624] -- 0:00:41
128000 -- [-572.576] (-572.664) (-574.169) (-575.753) * (-572.851) [-577.219] (-573.617) (-572.906) -- 0:00:40
128500 -- [-574.497] (-572.728) (-571.412) (-572.790) * (-571.218) (-574.772) (-573.486) [-572.370] -- 0:00:40
129000 -- (-572.102) (-573.749) (-574.584) [-573.561] * (-572.039) [-573.342] (-574.445) (-571.311) -- 0:00:40
129500 -- (-574.840) (-574.310) [-579.415] (-575.075) * (-572.437) [-571.742] (-576.496) (-572.762) -- 0:00:40
130000 -- (-571.640) (-572.756) (-572.193) [-574.280] * (-572.187) (-572.804) (-572.738) [-572.448] -- 0:00:40
Average standard deviation of split frequencies: 0.012026
130500 -- (-575.082) [-571.816] (-575.355) (-581.622) * (-571.412) [-574.468] (-571.924) (-575.439) -- 0:00:46
131000 -- (-575.685) (-572.497) (-572.974) [-575.593] * (-571.693) [-572.091] (-572.717) (-571.436) -- 0:00:46
131500 -- (-572.337) [-573.600] (-578.150) (-576.156) * (-574.477) [-572.239] (-573.887) (-573.312) -- 0:00:46
132000 -- (-571.080) (-572.644) [-573.410] (-573.218) * (-571.709) (-574.981) (-572.877) [-574.122] -- 0:00:46
132500 -- [-571.487] (-573.363) (-573.178) (-573.734) * (-571.996) (-576.143) [-571.037] (-574.296) -- 0:00:45
133000 -- (-571.679) (-572.092) [-573.961] (-573.433) * [-571.813] (-576.398) (-576.356) (-571.997) -- 0:00:45
133500 -- (-574.465) (-572.350) [-572.454] (-573.249) * [-574.309] (-576.122) (-572.019) (-571.834) -- 0:00:45
134000 -- (-571.616) (-575.411) [-571.126] (-573.890) * [-573.281] (-574.963) (-578.347) (-571.531) -- 0:00:45
134500 -- [-574.699] (-574.076) (-573.085) (-573.270) * (-576.189) [-572.960] (-571.570) (-573.244) -- 0:00:45
135000 -- (-575.148) (-572.038) (-574.245) [-574.692] * (-577.719) [-573.974] (-571.490) (-573.207) -- 0:00:44
Average standard deviation of split frequencies: 0.016176
135500 -- (-573.364) [-573.008] (-574.176) (-572.131) * [-574.309] (-574.198) (-576.263) (-574.862) -- 0:00:44
136000 -- (-577.834) (-573.075) [-571.644] (-573.405) * (-572.663) (-574.342) [-572.612] (-573.325) -- 0:00:44
136500 -- (-571.081) (-573.992) [-571.961] (-572.411) * (-578.281) [-573.729] (-572.140) (-571.266) -- 0:00:44
137000 -- (-575.288) (-572.484) [-571.508] (-573.317) * (-575.554) (-575.528) (-571.643) [-572.889] -- 0:00:44
137500 -- [-572.905] (-573.744) (-572.074) (-572.272) * (-572.826) (-573.060) (-572.302) [-571.263] -- 0:00:43
138000 -- [-574.463] (-573.480) (-574.558) (-572.643) * [-575.549] (-572.299) (-575.218) (-572.174) -- 0:00:43
138500 -- [-574.130] (-574.014) (-574.891) (-574.380) * (-571.524) (-573.820) (-572.189) [-572.109] -- 0:00:43
139000 -- [-574.112] (-575.903) (-572.559) (-571.890) * (-571.249) (-572.243) (-571.757) [-572.464] -- 0:00:43
139500 -- (-573.257) (-577.845) [-572.147] (-573.591) * (-571.881) (-571.278) [-575.973] (-571.339) -- 0:00:43
140000 -- (-572.018) (-573.792) [-571.818] (-571.869) * (-577.782) (-573.795) [-573.174] (-572.145) -- 0:00:43
Average standard deviation of split frequencies: 0.017873
140500 -- (-572.184) (-573.807) [-572.126] (-573.142) * (-575.136) (-571.677) [-572.637] (-573.070) -- 0:00:42
141000 -- [-572.093] (-573.456) (-573.858) (-572.544) * (-572.768) (-571.463) [-573.259] (-575.837) -- 0:00:42
141500 -- (-575.085) (-572.200) (-575.084) [-574.179] * (-574.937) [-571.238] (-575.837) (-573.486) -- 0:00:42
142000 -- (-572.387) (-572.984) (-571.230) [-571.068] * (-573.476) (-571.774) [-573.530] (-574.607) -- 0:00:42
142500 -- [-573.387] (-572.838) (-574.339) (-572.350) * (-572.805) (-573.053) (-572.726) [-572.772] -- 0:00:42
143000 -- (-574.154) (-579.846) (-573.493) [-572.506] * (-574.380) (-571.167) (-573.411) [-573.078] -- 0:00:41
143500 -- (-573.650) [-575.109] (-575.135) (-576.298) * (-573.089) (-578.945) (-574.897) [-575.275] -- 0:00:41
144000 -- (-574.202) (-572.826) [-573.249] (-573.897) * (-572.128) [-577.889] (-572.801) (-572.606) -- 0:00:41
144500 -- (-573.476) (-578.016) (-574.643) [-572.792] * (-571.730) (-574.107) [-572.931] (-573.208) -- 0:00:41
145000 -- (-573.007) (-572.546) [-573.007] (-574.066) * (-573.834) (-573.409) (-574.324) [-574.464] -- 0:00:41
Average standard deviation of split frequencies: 0.019373
145500 -- (-573.334) [-571.006] (-572.069) (-573.675) * (-576.412) (-575.480) [-572.237] (-572.338) -- 0:00:41
146000 -- (-571.427) (-571.705) [-576.149] (-576.669) * (-576.470) (-572.667) (-572.892) [-572.281] -- 0:00:40
146500 -- (-573.015) [-574.195] (-572.596) (-577.997) * (-572.147) [-576.924] (-572.554) (-572.282) -- 0:00:40
147000 -- [-573.327] (-570.906) (-577.797) (-572.346) * [-572.057] (-574.366) (-573.057) (-574.467) -- 0:00:40
147500 -- (-571.630) [-571.619] (-575.640) (-571.996) * (-578.232) (-577.358) (-575.383) [-572.465] -- 0:00:40
148000 -- [-572.321] (-572.595) (-578.840) (-572.606) * (-571.897) (-572.001) (-578.017) [-575.876] -- 0:00:40
148500 -- [-572.357] (-575.444) (-572.077) (-577.394) * (-576.936) (-575.901) [-572.326] (-572.443) -- 0:00:40
149000 -- (-574.163) (-572.944) (-571.425) [-572.599] * (-582.208) [-573.852] (-572.382) (-571.475) -- 0:00:39
149500 -- (-572.306) (-573.797) (-573.087) [-572.515] * [-574.424] (-573.224) (-575.581) (-572.147) -- 0:00:39
150000 -- [-572.483] (-574.379) (-573.665) (-573.106) * [-572.538] (-573.832) (-571.711) (-574.509) -- 0:00:39
Average standard deviation of split frequencies: 0.020859
150500 -- (-571.730) (-574.528) [-571.339] (-574.983) * (-573.543) (-573.044) (-572.658) [-576.112] -- 0:00:39
151000 -- (-572.123) (-572.261) (-577.053) [-572.384] * (-578.897) (-571.420) (-571.663) [-574.586] -- 0:00:39
151500 -- (-572.035) (-571.616) [-572.878] (-573.775) * (-572.312) (-574.351) [-575.989] (-573.006) -- 0:00:39
152000 -- (-573.822) (-571.629) (-572.076) [-578.518] * [-572.475] (-571.125) (-573.588) (-572.166) -- 0:00:39
152500 -- (-572.806) (-571.595) [-571.882] (-574.729) * [-572.829] (-571.705) (-575.118) (-572.753) -- 0:00:38
153000 -- (-576.588) (-575.001) (-576.740) [-573.453] * (-571.418) (-573.346) (-574.893) [-573.894] -- 0:00:44
153500 -- (-572.192) (-573.123) (-573.592) [-572.126] * [-572.425] (-574.747) (-574.062) (-572.929) -- 0:00:44
154000 -- (-573.249) (-572.186) [-574.815] (-576.593) * [-571.170] (-572.416) (-572.819) (-572.766) -- 0:00:43
154500 -- [-572.676] (-575.604) (-572.044) (-573.976) * (-573.502) (-574.425) (-575.805) [-572.796] -- 0:00:43
155000 -- (-574.632) (-574.014) (-573.143) [-571.554] * [-574.301] (-574.627) (-571.604) (-573.034) -- 0:00:43
Average standard deviation of split frequencies: 0.014102
155500 -- (-573.972) (-572.020) (-571.619) [-575.320] * (-571.302) (-574.941) (-572.656) [-572.930] -- 0:00:43
156000 -- [-572.658] (-575.956) (-575.861) (-571.704) * (-573.732) (-572.357) (-575.712) [-572.880] -- 0:00:43
156500 -- (-571.889) [-574.843] (-570.806) (-572.470) * (-575.354) (-576.994) [-580.532] (-572.222) -- 0:00:43
157000 -- (-573.989) (-572.544) (-574.592) [-572.907] * (-574.588) (-579.911) (-572.040) [-571.959] -- 0:00:42
157500 -- (-574.334) [-571.907] (-572.881) (-571.976) * (-574.200) [-571.793] (-573.368) (-571.548) -- 0:00:42
158000 -- [-575.267] (-572.725) (-573.798) (-571.707) * [-571.960] (-577.028) (-574.824) (-574.860) -- 0:00:42
158500 -- [-573.299] (-573.276) (-573.456) (-575.742) * (-572.905) (-574.552) (-576.460) [-572.882] -- 0:00:42
159000 -- [-571.681] (-572.772) (-573.432) (-571.692) * [-572.146] (-571.613) (-573.919) (-573.195) -- 0:00:42
159500 -- (-575.351) [-573.950] (-574.808) (-571.753) * [-570.983] (-576.147) (-572.815) (-571.795) -- 0:00:42
160000 -- (-572.160) (-572.449) (-571.851) [-572.087] * (-572.705) (-574.271) [-572.106] (-572.980) -- 0:00:42
Average standard deviation of split frequencies: 0.019560
160500 -- [-574.920] (-575.293) (-573.261) (-573.506) * [-572.970] (-578.051) (-573.287) (-574.017) -- 0:00:41
161000 -- (-575.312) (-577.419) [-573.262] (-577.100) * [-574.582] (-572.351) (-571.681) (-571.153) -- 0:00:41
161500 -- [-573.196] (-573.920) (-572.759) (-572.893) * (-575.728) [-571.880] (-571.760) (-572.120) -- 0:00:41
162000 -- (-572.381) [-574.736] (-572.807) (-573.809) * [-572.928] (-571.038) (-572.342) (-575.532) -- 0:00:41
162500 -- (-572.133) (-577.024) [-576.865] (-573.600) * (-574.113) [-572.728] (-572.683) (-573.158) -- 0:00:41
163000 -- (-571.018) [-571.197] (-574.207) (-571.582) * (-571.603) (-573.916) [-574.212] (-572.849) -- 0:00:41
163500 -- (-575.401) (-579.130) [-576.235] (-573.140) * [-571.387] (-571.349) (-573.126) (-571.147) -- 0:00:40
164000 -- (-574.051) [-574.342] (-571.589) (-575.454) * (-573.056) (-573.087) [-573.095] (-573.557) -- 0:00:40
164500 -- (-574.827) (-578.696) (-574.563) [-572.345] * (-573.976) (-573.346) [-572.589] (-574.518) -- 0:00:40
165000 -- (-572.452) [-573.653] (-573.159) (-572.982) * (-572.002) (-573.762) (-573.011) [-572.971] -- 0:00:40
Average standard deviation of split frequencies: 0.022718
165500 -- (-573.614) (-573.259) (-575.016) [-572.101] * (-573.032) (-572.941) (-573.524) [-573.000] -- 0:00:40
166000 -- (-572.386) (-575.235) (-573.294) [-572.774] * (-571.642) (-574.492) (-571.805) [-575.148] -- 0:00:40
166500 -- (-572.381) (-574.799) [-572.036] (-573.685) * [-574.464] (-576.955) (-575.737) (-575.856) -- 0:00:40
167000 -- (-571.479) (-571.631) [-572.225] (-571.939) * (-571.758) [-574.044] (-578.812) (-573.958) -- 0:00:39
167500 -- (-571.640) (-574.414) (-572.914) [-571.576] * (-572.538) (-571.964) [-571.216] (-571.696) -- 0:00:39
168000 -- (-571.549) (-573.312) (-572.881) [-575.439] * (-572.870) (-572.504) (-572.426) [-574.988] -- 0:00:39
168500 -- (-572.114) (-572.775) (-577.245) [-572.385] * (-576.960) [-573.685] (-573.349) (-574.119) -- 0:00:39
169000 -- [-572.189] (-573.602) (-573.358) (-573.201) * [-574.878] (-576.086) (-571.792) (-573.263) -- 0:00:39
169500 -- (-572.179) (-572.633) [-572.765] (-573.023) * (-575.178) (-577.722) [-573.053] (-578.043) -- 0:00:39
170000 -- (-571.452) (-577.324) (-573.714) [-577.062] * [-572.085] (-580.704) (-573.753) (-573.202) -- 0:00:39
Average standard deviation of split frequencies: 0.020256
170500 -- (-572.203) (-573.996) [-572.077] (-578.651) * (-573.298) (-576.311) (-576.316) [-573.523] -- 0:00:38
171000 -- [-573.117] (-573.633) (-575.037) (-572.376) * (-572.785) (-573.729) (-573.480) [-573.388] -- 0:00:38
171500 -- (-571.301) (-571.821) [-572.187] (-574.862) * (-572.859) (-575.134) (-573.580) [-575.691] -- 0:00:38
172000 -- [-573.714] (-572.282) (-574.360) (-571.761) * (-573.048) (-574.195) [-575.760] (-575.808) -- 0:00:38
172500 -- (-574.788) (-572.420) [-572.508] (-571.594) * (-573.249) (-573.270) [-573.895] (-571.844) -- 0:00:38
173000 -- (-572.480) (-575.389) (-572.935) [-572.738] * [-574.039] (-572.479) (-573.544) (-570.978) -- 0:00:38
173500 -- [-572.515] (-572.213) (-573.974) (-571.783) * (-574.374) (-575.502) [-571.186] (-572.151) -- 0:00:38
174000 -- (-578.874) [-575.120] (-573.946) (-573.470) * (-573.163) [-572.830] (-573.656) (-573.136) -- 0:00:37
174500 -- [-572.310] (-574.115) (-571.282) (-570.998) * (-572.498) [-573.902] (-572.549) (-575.769) -- 0:00:37
175000 -- (-572.052) [-574.624] (-573.546) (-572.257) * (-572.275) (-575.007) (-574.616) [-572.931] -- 0:00:42
Average standard deviation of split frequencies: 0.016071
175500 -- (-572.687) (-573.085) (-573.795) [-573.068] * (-571.086) [-572.395] (-576.129) (-574.833) -- 0:00:42
176000 -- (-573.771) [-571.800] (-574.856) (-573.191) * (-576.288) [-571.572] (-575.462) (-572.529) -- 0:00:42
176500 -- (-572.072) (-575.900) [-572.333] (-574.411) * (-572.501) [-572.813] (-573.626) (-575.113) -- 0:00:41
177000 -- (-571.297) (-574.183) (-572.865) [-575.908] * [-573.272] (-575.082) (-572.790) (-572.058) -- 0:00:41
177500 -- (-571.914) (-573.987) [-571.048] (-574.820) * (-576.254) [-574.026] (-575.580) (-575.258) -- 0:00:41
178000 -- (-571.961) (-571.776) [-571.744] (-576.063) * (-575.747) [-572.888] (-575.151) (-576.295) -- 0:00:41
178500 -- (-572.193) (-571.714) [-571.905] (-572.966) * [-573.482] (-572.722) (-571.709) (-577.532) -- 0:00:41
179000 -- (-575.207) (-573.764) (-573.997) [-572.529] * (-571.777) (-574.185) (-573.897) [-574.253] -- 0:00:41
179500 -- (-573.532) (-571.630) (-574.056) [-573.098] * [-572.735] (-573.871) (-574.313) (-574.095) -- 0:00:41
180000 -- [-573.273] (-575.838) (-572.113) (-571.307) * [-574.405] (-574.621) (-574.098) (-574.129) -- 0:00:41
Average standard deviation of split frequencies: 0.017395
180500 -- [-575.683] (-573.316) (-574.297) (-572.422) * (-574.824) (-580.826) [-573.488] (-571.870) -- 0:00:40
181000 -- [-573.227] (-575.054) (-573.188) (-575.044) * (-575.704) (-573.079) [-574.434] (-572.078) -- 0:00:40
181500 -- [-572.104] (-572.767) (-575.440) (-574.859) * (-576.549) (-575.330) (-575.184) [-571.851] -- 0:00:40
182000 -- (-574.826) (-574.782) [-575.216] (-571.467) * (-574.120) (-574.350) [-575.979] (-574.374) -- 0:00:40
182500 -- (-573.944) (-571.109) (-571.522) [-577.328] * [-571.865] (-574.779) (-572.821) (-579.954) -- 0:00:40
183000 -- (-573.392) (-575.394) (-574.861) [-571.510] * (-574.697) (-576.769) [-571.976] (-571.646) -- 0:00:40
183500 -- (-572.476) [-573.799] (-572.428) (-574.706) * [-572.924] (-574.423) (-573.630) (-571.912) -- 0:00:40
184000 -- (-574.890) (-575.103) [-571.528] (-572.573) * (-573.940) (-572.415) (-573.890) [-576.180] -- 0:00:39
184500 -- [-571.878] (-573.625) (-571.750) (-574.833) * (-574.425) (-572.616) (-574.477) [-575.086] -- 0:00:39
185000 -- (-571.326) [-572.371] (-573.433) (-571.674) * [-575.950] (-572.306) (-572.705) (-571.029) -- 0:00:39
Average standard deviation of split frequencies: 0.018586
185500 -- (-572.993) (-573.300) [-571.274] (-572.600) * [-571.690] (-575.585) (-573.823) (-571.798) -- 0:00:39
186000 -- (-574.449) (-572.664) [-571.670] (-576.019) * (-575.610) [-572.207] (-574.192) (-572.447) -- 0:00:39
186500 -- [-574.252] (-573.436) (-577.801) (-575.521) * (-572.431) (-573.810) [-572.797] (-571.317) -- 0:00:39
187000 -- (-573.775) (-571.949) [-572.242] (-571.482) * (-574.226) [-573.901] (-572.570) (-575.612) -- 0:00:39
187500 -- (-573.745) [-572.620] (-575.739) (-571.090) * (-571.839) [-571.833] (-572.585) (-577.481) -- 0:00:39
188000 -- (-571.796) [-574.183] (-578.814) (-571.961) * [-570.979] (-574.855) (-577.415) (-574.326) -- 0:00:38
188500 -- [-570.680] (-571.869) (-571.229) (-571.951) * (-572.591) (-574.377) (-573.346) [-572.329] -- 0:00:38
189000 -- [-572.540] (-573.279) (-572.450) (-571.593) * [-578.188] (-574.191) (-572.255) (-572.682) -- 0:00:38
189500 -- (-578.467) (-572.691) (-572.467) [-571.765] * (-574.570) (-573.506) (-572.840) [-572.867] -- 0:00:38
190000 -- (-572.785) [-576.781] (-574.471) (-573.988) * [-572.090] (-573.137) (-574.699) (-575.227) -- 0:00:38
Average standard deviation of split frequencies: 0.013186
190500 -- (-573.922) [-572.423] (-572.404) (-574.321) * [-572.678] (-572.077) (-573.659) (-572.560) -- 0:00:38
191000 -- (-573.915) (-573.028) (-575.391) [-572.193] * [-573.689] (-572.655) (-572.615) (-572.667) -- 0:00:38
191500 -- (-573.652) [-570.989] (-575.954) (-574.865) * (-576.368) (-571.568) [-573.736] (-572.616) -- 0:00:37
192000 -- [-572.699] (-571.820) (-571.995) (-575.087) * (-575.359) (-574.690) (-573.561) [-571.146] -- 0:00:37
192500 -- (-578.707) (-573.163) (-571.885) [-574.765] * [-571.967] (-573.054) (-574.821) (-573.552) -- 0:00:37
193000 -- (-574.519) (-573.396) (-576.089) [-576.465] * [-573.770] (-571.054) (-577.059) (-574.207) -- 0:00:37
193500 -- [-573.236] (-571.225) (-572.687) (-578.363) * (-577.312) [-571.133] (-573.505) (-572.172) -- 0:00:37
194000 -- (-572.963) (-571.504) [-570.990] (-573.858) * (-573.258) (-574.390) (-573.799) [-574.130] -- 0:00:37
194500 -- (-571.157) (-574.005) [-576.608] (-575.820) * (-573.276) [-574.682] (-573.156) (-573.896) -- 0:00:37
195000 -- [-572.159] (-574.480) (-575.778) (-581.173) * (-572.452) [-573.201] (-572.223) (-573.375) -- 0:00:37
Average standard deviation of split frequencies: 0.016034
195500 -- (-573.165) (-573.017) (-571.499) [-575.097] * (-574.521) (-571.887) [-576.243] (-572.337) -- 0:00:37
196000 -- [-573.276] (-571.951) (-571.542) (-571.823) * [-571.831] (-575.942) (-573.691) (-574.159) -- 0:00:36
196500 -- (-572.534) [-573.589] (-573.066) (-573.690) * [-572.520] (-575.379) (-572.103) (-572.470) -- 0:00:36
197000 -- (-572.611) (-574.876) (-571.423) [-575.208] * (-570.994) (-572.154) (-576.911) [-572.153] -- 0:00:36
197500 -- [-573.578] (-573.484) (-575.198) (-574.220) * (-584.491) [-572.501] (-573.104) (-572.080) -- 0:00:40
198000 -- (-573.703) (-573.388) (-572.961) [-571.613] * (-572.520) [-575.631] (-578.452) (-573.027) -- 0:00:40
198500 -- (-572.360) [-571.986] (-571.875) (-571.639) * [-573.016] (-572.548) (-573.617) (-571.617) -- 0:00:40
199000 -- (-572.354) [-576.269] (-572.138) (-578.624) * (-572.312) (-574.400) [-573.787] (-572.276) -- 0:00:40
199500 -- (-575.155) (-572.247) (-573.789) [-572.705] * (-574.882) [-573.160] (-575.820) (-573.109) -- 0:00:40
200000 -- (-575.076) (-575.211) [-572.384] (-574.243) * (-571.411) (-574.104) [-572.786] (-574.326) -- 0:00:40
Average standard deviation of split frequencies: 0.015661
200500 -- [-572.086] (-573.307) (-574.364) (-574.671) * (-572.375) [-574.850] (-572.875) (-571.788) -- 0:00:39
201000 -- [-571.357] (-573.126) (-574.997) (-576.058) * [-579.516] (-573.472) (-572.118) (-572.826) -- 0:00:39
201500 -- [-572.044] (-576.640) (-572.951) (-571.574) * [-573.787] (-572.931) (-573.211) (-575.690) -- 0:00:39
202000 -- (-571.446) (-573.053) (-578.537) [-571.495] * (-572.163) (-572.071) [-575.758] (-571.477) -- 0:00:39
202500 -- (-573.596) [-572.225] (-572.660) (-575.413) * (-572.835) [-572.556] (-570.832) (-574.266) -- 0:00:39
203000 -- (-572.984) (-574.071) [-571.790] (-571.980) * [-571.004] (-574.372) (-572.341) (-573.953) -- 0:00:39
203500 -- [-574.619] (-576.324) (-574.782) (-572.412) * (-571.601) (-575.080) (-576.333) [-570.910] -- 0:00:39
204000 -- (-573.996) (-571.955) [-572.873] (-572.636) * [-571.280] (-577.884) (-577.179) (-573.582) -- 0:00:39
204500 -- (-571.581) (-573.870) [-572.660] (-574.747) * (-572.784) (-571.210) (-580.160) [-574.517] -- 0:00:38
205000 -- (-571.064) [-574.808] (-574.412) (-572.236) * (-573.230) (-572.882) (-576.013) [-572.284] -- 0:00:38
Average standard deviation of split frequencies: 0.016781
205500 -- (-572.815) (-571.506) (-571.299) [-574.044] * (-573.795) [-571.509] (-572.622) (-573.413) -- 0:00:38
206000 -- (-572.155) (-575.761) [-572.360] (-573.299) * [-573.857] (-572.740) (-575.896) (-578.062) -- 0:00:38
206500 -- (-573.278) (-571.825) [-571.555] (-571.092) * (-571.890) (-572.350) (-575.699) [-572.529] -- 0:00:38
207000 -- (-575.109) (-573.807) (-573.740) [-571.776] * (-573.603) (-577.457) [-572.730] (-572.263) -- 0:00:38
207500 -- (-576.817) (-574.408) [-575.941] (-571.157) * (-577.685) (-571.707) (-573.841) [-575.864] -- 0:00:38
208000 -- (-575.894) [-573.735] (-574.185) (-571.783) * (-572.390) (-571.982) [-572.251] (-573.248) -- 0:00:38
208500 -- (-572.606) [-573.302] (-573.913) (-572.430) * (-572.419) [-573.698] (-571.666) (-574.465) -- 0:00:37
209000 -- (-572.562) [-574.400] (-572.062) (-573.658) * [-572.926] (-575.176) (-571.624) (-574.309) -- 0:00:37
209500 -- [-573.393] (-574.921) (-572.276) (-574.385) * [-571.941] (-574.136) (-571.876) (-573.991) -- 0:00:37
210000 -- (-572.637) [-574.531] (-573.223) (-571.436) * (-572.572) [-571.665] (-572.531) (-573.317) -- 0:00:37
Average standard deviation of split frequencies: 0.013426
210500 -- (-572.977) [-572.258] (-576.033) (-575.236) * [-571.537] (-572.987) (-574.395) (-575.812) -- 0:00:37
211000 -- (-572.983) (-574.190) [-571.277] (-574.958) * (-573.384) (-571.161) (-575.933) [-572.002] -- 0:00:37
211500 -- [-572.907] (-572.397) (-573.610) (-572.152) * [-573.314] (-574.147) (-580.094) (-573.229) -- 0:00:37
212000 -- (-574.050) (-571.094) [-572.555] (-573.887) * (-571.673) (-575.798) (-577.459) [-572.819] -- 0:00:37
212500 -- (-571.420) (-574.173) (-576.105) [-571.275] * (-572.234) (-571.968) [-573.525] (-571.898) -- 0:00:37
213000 -- (-574.577) (-572.467) (-575.194) [-572.264] * (-571.926) (-576.415) (-575.210) [-572.541] -- 0:00:36
213500 -- [-572.084] (-575.704) (-575.226) (-572.499) * (-573.054) (-572.536) [-572.239] (-574.234) -- 0:00:36
214000 -- [-572.702] (-572.796) (-572.607) (-573.187) * (-572.332) (-575.537) (-572.343) [-573.099] -- 0:00:36
214500 -- (-574.585) [-572.689] (-573.139) (-573.079) * [-571.000] (-575.450) (-573.961) (-574.039) -- 0:00:36
215000 -- (-572.799) [-575.020] (-571.669) (-575.681) * (-573.849) (-573.303) (-574.412) [-571.743] -- 0:00:36
Average standard deviation of split frequencies: 0.016004
215500 -- (-575.059) (-573.758) (-571.073) [-573.488] * [-573.750] (-573.385) (-573.174) (-571.982) -- 0:00:36
216000 -- (-573.383) [-571.827] (-574.264) (-575.292) * (-573.559) (-571.321) [-572.843] (-577.016) -- 0:00:36
216500 -- [-573.719] (-572.014) (-572.625) (-576.781) * (-574.252) [-575.695] (-572.955) (-576.199) -- 0:00:36
217000 -- [-572.710] (-576.181) (-573.211) (-576.998) * (-571.174) [-572.676] (-574.186) (-573.563) -- 0:00:36
217500 -- (-571.643) (-573.376) [-571.292] (-572.515) * (-577.500) (-571.372) (-571.380) [-576.542] -- 0:00:35
218000 -- [-572.468] (-572.304) (-572.135) (-572.072) * (-571.814) (-574.635) [-572.557] (-572.622) -- 0:00:35
218500 -- (-572.944) (-572.996) (-576.908) [-573.092] * (-574.211) (-571.361) (-571.533) [-572.902] -- 0:00:35
219000 -- (-572.665) [-572.357] (-571.855) (-573.553) * (-571.560) [-572.599] (-572.451) (-574.761) -- 0:00:35
219500 -- (-572.374) (-572.011) (-576.884) [-571.832] * (-574.624) (-571.754) (-572.356) [-573.062] -- 0:00:39
220000 -- (-575.357) (-573.524) [-572.448] (-571.413) * (-574.194) (-571.369) [-572.061] (-572.475) -- 0:00:39
Average standard deviation of split frequencies: 0.018514
220500 -- (-572.297) [-572.203] (-573.711) (-572.745) * [-572.669] (-573.165) (-576.760) (-573.519) -- 0:00:38
221000 -- (-572.714) (-571.573) (-574.351) [-573.741] * (-573.611) (-572.979) [-573.320] (-575.642) -- 0:00:38
221500 -- (-573.402) [-576.338] (-575.117) (-572.872) * (-572.350) (-571.433) (-573.989) [-571.908] -- 0:00:38
222000 -- (-573.170) [-577.027] (-581.991) (-574.320) * (-574.503) [-575.524] (-573.871) (-572.799) -- 0:00:38
222500 -- (-574.345) (-571.652) (-572.382) [-573.093] * (-576.177) [-573.400] (-572.233) (-571.549) -- 0:00:38
223000 -- (-577.586) [-571.237] (-574.157) (-573.776) * (-574.249) [-574.436] (-572.176) (-571.262) -- 0:00:38
223500 -- (-577.376) [-571.664] (-575.779) (-577.364) * [-572.566] (-573.187) (-572.289) (-571.858) -- 0:00:38
224000 -- (-575.618) (-575.145) [-571.321] (-572.340) * [-571.438] (-573.075) (-572.766) (-571.637) -- 0:00:38
224500 -- (-571.059) [-573.567] (-572.184) (-573.265) * (-570.829) [-573.023] (-574.353) (-572.229) -- 0:00:37
225000 -- [-571.669] (-571.071) (-573.461) (-571.792) * (-572.828) (-572.628) (-573.405) [-571.370] -- 0:00:37
Average standard deviation of split frequencies: 0.016687
225500 -- (-576.517) (-575.230) (-571.238) [-572.996] * (-575.425) (-573.580) [-571.866] (-574.557) -- 0:00:37
226000 -- [-571.685] (-572.240) (-573.031) (-575.249) * (-572.956) (-573.321) (-573.350) [-571.307] -- 0:00:37
226500 -- (-574.858) (-577.613) (-573.164) [-577.048] * [-572.609] (-571.610) (-571.966) (-571.273) -- 0:00:37
227000 -- (-574.608) (-574.447) (-571.421) [-572.272] * (-571.678) (-573.466) (-571.939) [-576.462] -- 0:00:37
227500 -- [-572.439] (-572.231) (-572.340) (-574.030) * (-573.975) (-576.070) (-571.219) [-571.314] -- 0:00:37
228000 -- (-572.840) (-572.533) (-573.269) [-572.208] * (-576.771) (-573.447) (-575.344) [-573.943] -- 0:00:37
228500 -- (-572.749) (-572.733) (-574.442) [-575.609] * (-573.255) [-573.780] (-573.346) (-571.740) -- 0:00:37
229000 -- (-571.742) (-573.385) (-572.323) [-573.441] * [-571.974] (-573.972) (-571.535) (-571.654) -- 0:00:37
229500 -- (-571.910) [-577.341] (-571.191) (-573.523) * (-576.273) [-572.199] (-576.069) (-574.495) -- 0:00:36
230000 -- [-573.924] (-571.669) (-573.783) (-571.865) * (-572.015) (-573.179) [-572.301] (-570.766) -- 0:00:36
Average standard deviation of split frequencies: 0.014987
230500 -- (-572.191) (-574.756) (-574.740) [-572.427] * (-573.054) [-571.546] (-573.920) (-571.168) -- 0:00:36
231000 -- [-572.790] (-572.979) (-571.810) (-572.942) * (-571.083) [-573.666] (-573.467) (-574.519) -- 0:00:36
231500 -- (-578.311) (-572.428) [-572.216] (-578.039) * (-571.521) (-571.291) [-571.670] (-571.556) -- 0:00:36
232000 -- (-576.186) [-575.822] (-571.637) (-574.682) * (-574.471) [-571.939] (-573.568) (-572.017) -- 0:00:36
232500 -- (-575.663) [-575.325] (-571.697) (-572.379) * (-571.719) (-572.943) (-572.775) [-572.252] -- 0:00:36
233000 -- (-572.399) (-573.307) (-571.363) [-572.550] * (-572.181) (-572.940) (-572.230) [-571.839] -- 0:00:36
233500 -- (-571.829) (-571.050) (-573.902) [-571.980] * (-575.113) [-572.380] (-572.721) (-572.771) -- 0:00:36
234000 -- (-575.885) [-574.036] (-574.092) (-572.865) * [-576.317] (-572.898) (-576.517) (-573.765) -- 0:00:36
234500 -- (-573.749) (-574.717) [-571.459] (-571.283) * (-574.644) (-572.357) (-572.285) [-574.328] -- 0:00:35
235000 -- (-574.132) (-575.225) [-572.436] (-572.045) * (-575.682) (-572.678) (-574.724) [-581.811] -- 0:00:35
Average standard deviation of split frequencies: 0.017311
235500 -- [-571.231] (-571.784) (-575.121) (-574.069) * (-576.412) (-573.868) (-575.301) [-574.037] -- 0:00:35
236000 -- (-573.342) [-575.192] (-572.125) (-571.672) * (-572.988) (-572.372) (-574.213) [-573.556] -- 0:00:35
236500 -- [-572.329] (-574.524) (-574.480) (-573.509) * [-573.138] (-574.527) (-570.829) (-574.148) -- 0:00:35
237000 -- (-571.076) (-574.335) [-572.080] (-573.495) * (-571.919) (-577.332) (-575.040) [-575.055] -- 0:00:35
237500 -- (-573.120) (-573.977) (-572.760) [-571.542] * (-572.134) [-572.361] (-577.281) (-573.766) -- 0:00:35
238000 -- [-572.570] (-573.814) (-575.915) (-573.242) * [-573.130] (-572.583) (-572.595) (-576.460) -- 0:00:35
238500 -- (-574.276) (-574.618) [-572.715] (-572.238) * (-574.883) (-572.501) (-574.291) [-572.357] -- 0:00:35
239000 -- [-573.413] (-576.213) (-577.911) (-574.530) * (-574.623) [-574.056] (-574.340) (-571.593) -- 0:00:35
239500 -- (-575.147) [-572.328] (-573.684) (-573.315) * (-573.007) (-571.607) (-573.707) [-573.514] -- 0:00:34
240000 -- (-574.354) (-572.873) (-572.493) [-572.468] * (-577.504) (-572.879) (-576.816) [-578.174] -- 0:00:34
Average standard deviation of split frequencies: 0.019587
240500 -- [-577.428] (-574.906) (-571.478) (-574.668) * (-576.446) [-573.547] (-579.301) (-573.146) -- 0:00:34
241000 -- (-571.408) (-572.258) (-571.158) [-571.307] * (-572.873) (-572.873) [-572.086] (-572.085) -- 0:00:34
241500 -- (-572.950) (-572.593) (-574.950) [-572.606] * (-573.534) (-571.979) [-574.351] (-571.885) -- 0:00:37
242000 -- [-571.798] (-572.563) (-574.210) (-572.715) * (-573.134) [-572.231] (-572.256) (-574.757) -- 0:00:37
242500 -- (-571.052) (-575.627) (-572.505) [-572.272] * (-576.576) [-574.493] (-571.534) (-573.033) -- 0:00:37
243000 -- (-572.509) (-572.624) [-571.400] (-572.504) * (-571.331) (-572.386) [-571.941] (-573.772) -- 0:00:37
243500 -- [-573.431] (-573.507) (-571.837) (-571.077) * (-573.331) (-571.869) (-573.661) [-572.204] -- 0:00:37
244000 -- [-571.189] (-571.522) (-571.917) (-571.987) * (-571.555) [-572.905] (-576.117) (-574.456) -- 0:00:37
244500 -- (-575.204) [-573.024] (-573.076) (-571.466) * (-573.212) [-574.353] (-574.011) (-571.938) -- 0:00:37
245000 -- (-576.414) (-571.876) (-571.660) [-572.171] * (-575.534) [-573.264] (-573.885) (-572.514) -- 0:00:36
Average standard deviation of split frequencies: 0.021718
245500 -- (-574.191) (-575.714) (-574.498) [-572.603] * (-574.072) (-573.379) (-573.496) [-573.270] -- 0:00:36
246000 -- (-574.075) (-576.002) (-572.586) [-572.054] * (-576.380) (-572.213) [-573.807] (-575.037) -- 0:00:36
246500 -- (-576.805) [-575.985] (-574.637) (-572.073) * [-573.107] (-571.498) (-578.859) (-574.682) -- 0:00:36
247000 -- (-574.980) (-574.409) [-571.386] (-574.465) * (-574.122) (-571.739) [-573.425] (-577.481) -- 0:00:36
247500 -- (-577.940) (-572.505) [-571.191] (-572.508) * [-572.886] (-574.846) (-574.919) (-577.932) -- 0:00:36
248000 -- (-574.596) (-571.916) [-575.134] (-571.632) * [-573.581] (-575.045) (-580.121) (-572.994) -- 0:00:36
248500 -- (-572.215) (-571.797) (-573.318) [-574.391] * (-574.632) (-571.423) (-582.268) [-571.909] -- 0:00:36
249000 -- (-572.164) (-572.121) [-571.206] (-572.424) * (-573.877) [-572.695] (-577.684) (-573.345) -- 0:00:36
249500 -- [-573.469] (-570.911) (-572.038) (-573.342) * [-571.840] (-573.588) (-576.307) (-572.938) -- 0:00:36
250000 -- [-572.415] (-572.029) (-571.327) (-572.605) * (-572.176) (-574.844) (-574.263) [-572.855] -- 0:00:36
Average standard deviation of split frequencies: 0.023821
250500 -- (-572.271) [-572.509] (-571.818) (-572.789) * [-572.228] (-574.331) (-572.288) (-571.659) -- 0:00:35
251000 -- (-574.901) (-573.010) [-571.318] (-572.459) * (-575.917) (-573.854) [-571.638] (-571.601) -- 0:00:35
251500 -- (-571.613) (-574.773) (-571.477) [-573.227] * [-572.736] (-572.359) (-573.479) (-572.722) -- 0:00:35
252000 -- (-574.116) [-572.361] (-573.173) (-574.057) * (-576.679) (-572.057) (-575.845) [-573.706] -- 0:00:35
252500 -- (-571.869) (-571.777) [-575.873] (-573.366) * (-573.762) (-572.645) (-572.840) [-572.363] -- 0:00:35
253000 -- (-573.917) (-571.819) [-573.781] (-571.396) * (-575.815) (-573.419) (-574.818) [-572.706] -- 0:00:35
253500 -- (-572.157) (-572.396) (-574.232) [-571.459] * (-572.626) (-574.039) (-571.893) [-575.439] -- 0:00:35
254000 -- (-576.252) (-574.033) (-573.820) [-572.222] * (-572.886) (-575.234) (-572.086) [-575.974] -- 0:00:35
254500 -- [-575.525] (-571.395) (-575.110) (-574.053) * (-573.835) (-573.201) [-571.147] (-575.677) -- 0:00:35
255000 -- [-572.330] (-571.621) (-574.730) (-577.447) * (-572.717) (-572.346) [-574.375] (-571.671) -- 0:00:35
Average standard deviation of split frequencies: 0.027008
255500 -- (-576.060) [-570.847] (-574.707) (-577.006) * [-573.012] (-571.533) (-574.242) (-571.624) -- 0:00:34
256000 -- (-574.941) (-575.283) [-573.693] (-575.677) * (-574.593) [-571.668] (-572.422) (-573.264) -- 0:00:34
256500 -- (-576.304) (-575.076) [-573.370] (-572.753) * [-572.515] (-571.736) (-573.981) (-572.766) -- 0:00:34
257000 -- [-571.883] (-572.109) (-571.745) (-572.499) * [-572.122] (-573.564) (-572.576) (-573.934) -- 0:00:34
257500 -- [-575.548] (-571.906) (-573.361) (-572.543) * (-573.838) (-571.896) [-572.033] (-574.859) -- 0:00:34
258000 -- (-573.593) [-573.812] (-574.458) (-571.427) * (-573.361) (-572.908) (-572.389) [-573.076] -- 0:00:34
258500 -- (-572.579) (-572.353) [-571.147] (-573.361) * (-572.037) (-573.645) [-571.688] (-577.058) -- 0:00:34
259000 -- (-572.468) (-573.430) (-573.688) [-571.190] * (-571.868) (-571.231) [-573.338] (-574.799) -- 0:00:34
259500 -- (-575.329) (-574.564) [-574.715] (-573.486) * (-575.478) (-571.975) [-573.164] (-574.930) -- 0:00:34
260000 -- (-572.859) (-574.952) (-573.973) [-576.230] * (-573.158) [-575.175] (-571.840) (-577.127) -- 0:00:34
Average standard deviation of split frequencies: 0.022907
260500 -- [-573.844] (-574.527) (-572.829) (-576.741) * (-575.058) [-573.829] (-573.455) (-575.554) -- 0:00:34
261000 -- (-574.178) [-574.822] (-574.609) (-575.943) * (-576.811) [-573.169] (-574.074) (-575.004) -- 0:00:33
261500 -- (-575.732) [-574.006] (-572.840) (-576.316) * (-571.635) (-573.907) (-576.771) [-571.397] -- 0:00:33
262000 -- (-575.029) (-572.046) [-574.326] (-574.677) * (-572.175) [-573.709] (-573.262) (-575.332) -- 0:00:33
262500 -- (-572.125) (-573.372) (-575.806) [-571.236] * [-571.766] (-576.575) (-571.655) (-573.088) -- 0:00:33
263000 -- (-574.431) (-572.457) (-573.222) [-573.926] * (-575.100) [-571.503] (-573.413) (-572.436) -- 0:00:33
263500 -- (-573.004) (-573.067) [-571.197] (-574.617) * [-573.915] (-575.697) (-571.261) (-573.019) -- 0:00:33
264000 -- (-572.891) [-574.512] (-572.731) (-570.876) * [-573.130] (-576.308) (-571.766) (-573.538) -- 0:00:33
264500 -- (-572.512) [-572.281] (-573.029) (-573.399) * (-571.327) (-574.553) [-572.544] (-571.795) -- 0:00:36
265000 -- (-572.328) (-572.379) [-579.831] (-571.754) * (-577.716) (-571.723) [-571.329] (-574.444) -- 0:00:36
Average standard deviation of split frequencies: 0.018903
265500 -- [-573.467] (-573.463) (-573.959) (-572.800) * [-572.040] (-573.276) (-572.227) (-574.701) -- 0:00:35
266000 -- (-572.880) [-572.324] (-572.861) (-574.456) * (-570.844) (-573.061) (-572.275) [-573.486] -- 0:00:35
266500 -- (-572.141) (-571.645) (-571.325) [-571.085] * (-572.325) [-572.322] (-571.514) (-571.333) -- 0:00:35
267000 -- [-577.380] (-572.322) (-572.120) (-572.918) * (-575.839) (-572.097) (-571.844) [-571.149] -- 0:00:35
267500 -- (-573.093) (-572.443) (-572.133) [-572.878] * [-577.285] (-572.347) (-574.734) (-574.426) -- 0:00:35
268000 -- [-573.742] (-573.433) (-571.485) (-573.809) * (-573.159) (-572.157) [-574.427] (-572.561) -- 0:00:35
268500 -- (-574.653) [-573.362] (-572.265) (-576.426) * [-573.243] (-575.676) (-574.252) (-575.999) -- 0:00:35
269000 -- (-574.032) (-572.080) (-572.221) [-572.556] * (-571.843) (-572.558) (-577.540) [-573.909] -- 0:00:35
269500 -- (-571.597) [-575.015] (-571.374) (-573.201) * (-574.310) (-572.269) (-576.349) [-575.503] -- 0:00:35
270000 -- (-571.130) (-574.707) [-573.927] (-578.649) * (-574.683) [-573.672] (-573.514) (-573.408) -- 0:00:35
Average standard deviation of split frequencies: 0.024383
270500 -- (-571.322) (-571.971) (-572.479) [-572.769] * (-575.412) (-576.826) [-572.927] (-577.079) -- 0:00:35
271000 -- (-571.583) (-575.619) (-572.707) [-573.246] * (-573.925) (-573.521) (-574.258) [-573.867] -- 0:00:34
271500 -- [-572.421] (-573.396) (-572.137) (-574.165) * (-571.243) (-575.438) [-573.687] (-573.674) -- 0:00:34
272000 -- (-571.872) (-574.940) (-571.924) [-573.018] * (-573.774) (-573.524) [-573.326] (-574.234) -- 0:00:34
272500 -- (-571.660) [-571.786] (-571.408) (-572.064) * (-573.271) [-572.793] (-573.072) (-571.761) -- 0:00:34
273000 -- [-572.769] (-575.708) (-573.803) (-574.710) * (-574.534) (-575.759) [-574.658] (-573.117) -- 0:00:34
273500 -- (-573.547) (-573.355) (-575.907) [-572.769] * (-573.594) (-572.058) [-573.922] (-571.734) -- 0:00:34
274000 -- (-575.088) [-573.881] (-574.913) (-580.256) * (-574.538) (-575.976) (-572.026) [-572.840] -- 0:00:34
274500 -- (-574.742) (-574.768) [-575.280] (-572.903) * [-573.052] (-574.419) (-572.086) (-575.411) -- 0:00:34
275000 -- (-571.966) (-573.994) [-573.097] (-570.984) * (-571.761) [-575.424] (-573.976) (-575.011) -- 0:00:34
Average standard deviation of split frequencies: 0.023912
275500 -- (-575.288) [-571.672] (-575.384) (-573.243) * (-573.369) [-575.239] (-574.827) (-573.716) -- 0:00:34
276000 -- [-571.501] (-572.634) (-572.654) (-577.728) * (-580.417) (-574.144) (-572.570) [-573.108] -- 0:00:34
276500 -- [-574.114] (-575.735) (-574.452) (-574.979) * (-576.571) (-573.873) (-575.888) [-571.769] -- 0:00:34
277000 -- (-571.266) [-572.434] (-575.029) (-572.280) * [-574.947] (-571.990) (-576.707) (-571.159) -- 0:00:33
277500 -- [-575.832] (-571.426) (-574.181) (-571.308) * (-575.644) [-574.259] (-573.358) (-574.865) -- 0:00:33
278000 -- (-573.645) (-571.545) (-572.446) [-572.698] * (-574.184) (-576.043) [-572.130] (-572.627) -- 0:00:33
278500 -- (-573.197) (-572.955) (-571.039) [-571.863] * (-573.292) (-571.394) (-576.105) [-572.152] -- 0:00:33
279000 -- (-577.736) (-572.358) (-571.204) [-571.630] * [-571.537] (-576.701) (-574.464) (-572.287) -- 0:00:33
279500 -- (-573.510) (-571.978) (-573.127) [-572.006] * (-571.788) [-573.497] (-577.498) (-573.704) -- 0:00:33
280000 -- [-571.826] (-572.178) (-572.976) (-571.559) * (-574.656) [-571.670] (-578.540) (-571.884) -- 0:00:33
Average standard deviation of split frequencies: 0.027993
280500 -- (-573.581) (-572.722) [-574.201] (-576.398) * (-572.820) [-571.982] (-574.921) (-571.121) -- 0:00:33
281000 -- (-574.803) [-572.357] (-578.030) (-574.716) * (-572.471) (-571.029) (-573.166) [-572.678] -- 0:00:33
281500 -- (-572.130) [-572.326] (-573.641) (-575.897) * (-580.203) (-576.540) [-572.811] (-574.752) -- 0:00:33
282000 -- (-571.963) (-572.690) (-572.067) [-574.407] * [-571.861] (-573.243) (-573.089) (-572.766) -- 0:00:33
282500 -- [-571.033] (-576.216) (-571.597) (-571.345) * (-572.126) (-571.583) (-573.062) [-573.211] -- 0:00:33
283000 -- (-575.690) [-573.127] (-572.945) (-571.448) * [-573.630] (-573.096) (-576.074) (-572.954) -- 0:00:32
283500 -- [-573.256] (-574.119) (-578.489) (-571.311) * (-572.322) [-571.195] (-573.189) (-573.691) -- 0:00:32
284000 -- (-573.648) (-575.431) (-573.949) [-573.185] * (-573.679) (-571.823) [-572.018] (-571.788) -- 0:00:32
284500 -- (-573.631) [-576.139] (-572.495) (-571.263) * (-571.870) [-571.810] (-572.352) (-572.345) -- 0:00:32
285000 -- (-574.845) (-574.970) [-573.626] (-572.538) * (-579.218) [-571.471] (-572.378) (-577.944) -- 0:00:32
Average standard deviation of split frequencies: 0.029669
285500 -- (-571.277) (-573.357) [-572.800] (-571.736) * (-574.966) (-573.680) [-572.257] (-576.966) -- 0:00:32
286000 -- [-578.182] (-574.242) (-571.655) (-574.205) * (-570.957) [-572.429] (-571.777) (-574.199) -- 0:00:32
286500 -- [-573.035] (-573.980) (-573.758) (-571.737) * (-571.012) (-572.669) (-574.627) [-573.066] -- 0:00:34
287000 -- (-571.422) [-571.461] (-573.136) (-573.252) * (-572.839) (-573.763) (-577.833) [-575.393] -- 0:00:34
287500 -- [-571.306] (-571.640) (-572.167) (-572.252) * (-571.365) (-573.864) (-574.913) [-572.981] -- 0:00:34
288000 -- (-571.046) [-573.562] (-574.383) (-572.610) * (-574.933) (-573.012) [-573.438] (-573.926) -- 0:00:34
288500 -- (-572.910) [-571.872] (-572.296) (-572.711) * (-572.726) (-575.924) [-571.713] (-571.889) -- 0:00:34
289000 -- [-571.194] (-571.237) (-571.983) (-573.955) * (-573.983) (-572.560) [-575.051] (-572.254) -- 0:00:34
289500 -- [-573.830] (-572.271) (-574.452) (-575.525) * (-572.453) (-576.380) [-571.502] (-574.012) -- 0:00:34
290000 -- [-571.968] (-570.779) (-572.961) (-577.018) * (-572.248) (-571.844) [-571.315] (-572.190) -- 0:00:34
Average standard deviation of split frequencies: 0.027030
290500 -- (-571.953) (-576.559) [-574.628] (-573.286) * (-572.208) (-572.089) (-571.870) [-574.522] -- 0:00:34
291000 -- (-573.331) [-570.979] (-577.703) (-573.319) * (-574.337) (-572.957) [-572.412] (-574.386) -- 0:00:34
291500 -- (-573.236) (-575.858) [-574.771] (-572.885) * [-574.688] (-574.333) (-570.980) (-574.158) -- 0:00:34
292000 -- [-573.660] (-573.365) (-572.033) (-571.887) * (-572.148) (-571.506) (-570.962) [-575.358] -- 0:00:33
292500 -- (-572.402) (-571.469) (-571.255) [-573.405] * (-573.038) (-573.011) [-572.655] (-572.675) -- 0:00:33
293000 -- (-574.545) (-572.212) (-574.046) [-571.799] * (-574.403) [-572.250] (-574.137) (-574.669) -- 0:00:33
293500 -- [-572.475] (-573.350) (-572.118) (-571.078) * [-578.749] (-572.176) (-571.562) (-579.580) -- 0:00:33
294000 -- [-573.745] (-574.371) (-573.619) (-571.863) * (-573.156) (-576.367) [-572.768] (-577.495) -- 0:00:33
294500 -- (-571.643) (-571.781) [-573.301] (-571.173) * (-572.324) (-574.174) [-572.929] (-571.282) -- 0:00:33
295000 -- [-573.381] (-574.591) (-582.342) (-574.959) * (-571.400) (-571.717) [-571.297] (-573.580) -- 0:00:33
Average standard deviation of split frequencies: 0.028666
295500 -- (-575.188) [-573.258] (-575.945) (-574.503) * (-573.681) (-573.009) (-571.268) [-572.651] -- 0:00:33
296000 -- [-573.306] (-573.210) (-571.920) (-575.426) * (-573.965) (-575.812) [-572.218] (-572.852) -- 0:00:33
296500 -- (-572.717) (-574.554) [-573.473] (-576.408) * (-571.840) (-575.288) [-572.451] (-575.053) -- 0:00:33
297000 -- [-570.947] (-575.803) (-574.053) (-574.896) * (-574.453) (-572.996) (-572.564) [-571.806] -- 0:00:33
297500 -- (-570.816) [-573.738] (-574.419) (-573.717) * (-571.285) (-573.682) [-572.621] (-573.951) -- 0:00:33
298000 -- (-572.738) [-574.546] (-573.311) (-578.485) * (-572.202) (-575.155) (-573.122) [-572.916] -- 0:00:32
298500 -- (-575.906) (-573.366) [-572.208] (-574.357) * (-575.793) [-571.038] (-570.812) (-573.119) -- 0:00:32
299000 -- [-575.652] (-572.010) (-576.003) (-571.740) * (-573.732) (-572.769) (-577.257) [-573.128] -- 0:00:32
299500 -- (-572.799) [-571.657] (-573.077) (-571.444) * (-571.263) [-572.285] (-573.236) (-573.534) -- 0:00:32
300000 -- (-577.534) (-572.581) (-573.193) [-573.078] * (-573.962) (-574.282) [-571.633] (-571.332) -- 0:00:32
Average standard deviation of split frequencies: 0.027176
300500 -- [-574.773] (-575.284) (-571.918) (-572.798) * [-575.107] (-575.222) (-572.751) (-571.086) -- 0:00:32
301000 -- (-580.955) [-572.681] (-570.940) (-573.015) * (-572.647) (-576.369) (-574.191) [-572.651] -- 0:00:32
301500 -- [-572.312] (-578.250) (-576.447) (-574.559) * (-572.861) [-571.737] (-573.222) (-576.073) -- 0:00:32
302000 -- (-577.660) (-577.835) (-573.411) [-572.923] * (-574.574) [-575.572] (-573.808) (-572.735) -- 0:00:32
302500 -- (-573.773) [-572.894] (-572.140) (-572.703) * (-577.004) (-579.030) [-572.217] (-574.093) -- 0:00:32
303000 -- (-570.793) [-571.069] (-572.890) (-573.025) * (-576.762) (-573.461) (-573.874) [-575.497] -- 0:00:32
303500 -- (-575.219) [-573.490] (-572.161) (-573.449) * [-572.164] (-576.762) (-572.402) (-573.157) -- 0:00:32
304000 -- (-574.307) (-572.142) (-572.452) [-574.865] * (-574.556) [-571.268] (-573.671) (-573.310) -- 0:00:32
304500 -- (-572.048) (-574.287) [-573.350] (-575.392) * (-572.025) (-571.607) (-573.962) [-571.694] -- 0:00:31
305000 -- (-571.116) (-571.659) (-576.428) [-576.526] * [-572.727] (-573.265) (-571.670) (-572.053) -- 0:00:31
Average standard deviation of split frequencies: 0.027730
305500 -- [-573.470] (-575.280) (-575.463) (-573.320) * (-577.241) (-572.645) [-571.194] (-575.130) -- 0:00:31
306000 -- (-572.312) [-573.553] (-573.123) (-572.710) * (-573.636) (-572.168) (-571.870) [-571.257] -- 0:00:31
306500 -- (-573.547) [-571.392] (-572.597) (-571.244) * [-573.294] (-573.102) (-578.979) (-575.168) -- 0:00:31
307000 -- (-575.369) [-572.209] (-571.046) (-572.105) * (-574.555) [-575.726] (-577.092) (-575.219) -- 0:00:31
307500 -- (-572.846) (-573.538) (-572.910) [-571.654] * (-573.940) (-571.629) [-570.987] (-572.240) -- 0:00:31
308000 -- (-574.830) (-574.713) (-576.776) [-571.540] * [-572.199] (-573.706) (-571.319) (-572.445) -- 0:00:31
308500 -- (-575.913) (-572.968) (-573.003) [-572.445] * (-575.408) (-572.578) [-571.085] (-572.276) -- 0:00:31
309000 -- (-574.032) (-572.301) (-573.883) [-572.168] * (-571.384) (-572.058) [-573.937] (-572.940) -- 0:00:33
309500 -- [-575.843] (-572.834) (-575.461) (-571.879) * (-570.982) [-572.702] (-576.308) (-575.538) -- 0:00:33
310000 -- (-572.294) [-572.452] (-573.314) (-575.932) * (-571.661) (-574.440) [-573.633] (-578.125) -- 0:00:33
Average standard deviation of split frequencies: 0.028325
310500 -- [-571.943] (-571.965) (-572.086) (-571.476) * (-576.339) (-573.330) [-571.202] (-574.159) -- 0:00:33
311000 -- (-573.583) (-572.851) (-572.933) [-572.404] * [-572.879] (-572.518) (-572.404) (-574.350) -- 0:00:33
311500 -- (-573.532) (-573.173) (-572.529) [-573.310] * (-575.905) (-575.772) (-576.878) [-574.588] -- 0:00:33
312000 -- (-573.105) [-572.675] (-572.996) (-571.458) * (-576.146) (-572.678) (-571.508) [-572.686] -- 0:00:33
312500 -- (-571.742) (-573.586) [-575.353] (-572.160) * (-571.083) (-572.667) [-572.095] (-574.313) -- 0:00:33
313000 -- (-572.119) [-571.241] (-575.447) (-572.518) * (-571.826) (-572.217) (-574.926) [-573.683] -- 0:00:32
313500 -- (-570.932) (-575.054) (-573.284) [-571.767] * (-575.894) (-571.413) (-572.275) [-574.360] -- 0:00:32
314000 -- (-571.859) (-571.553) (-572.294) [-572.324] * [-572.131] (-574.357) (-576.000) (-572.317) -- 0:00:32
314500 -- (-575.584) (-575.504) (-571.277) [-573.222] * (-573.157) [-573.195] (-574.325) (-571.767) -- 0:00:32
315000 -- (-573.140) [-571.164] (-571.500) (-572.935) * (-574.569) (-574.062) [-572.421] (-571.673) -- 0:00:32
Average standard deviation of split frequencies: 0.028841
315500 -- (-577.667) [-572.655] (-580.000) (-578.175) * (-575.388) (-573.244) (-573.698) [-573.826] -- 0:00:32
316000 -- [-572.249] (-575.896) (-574.794) (-575.477) * (-577.471) (-574.147) [-571.422] (-575.448) -- 0:00:32
316500 -- (-572.982) [-571.353] (-574.041) (-573.916) * (-578.781) (-574.269) [-573.979] (-573.859) -- 0:00:32
317000 -- [-570.936] (-576.226) (-575.622) (-572.392) * [-575.072] (-573.087) (-575.681) (-577.959) -- 0:00:32
317500 -- (-571.424) (-571.536) (-572.960) [-573.352] * (-574.379) (-574.306) [-572.256] (-575.277) -- 0:00:32
318000 -- (-572.132) (-571.263) (-573.359) [-576.503] * (-575.133) [-573.648] (-573.525) (-573.801) -- 0:00:32
318500 -- (-572.206) (-572.816) (-574.567) [-572.815] * (-571.975) [-571.963] (-574.651) (-573.911) -- 0:00:32
319000 -- (-571.073) [-571.919] (-572.653) (-572.940) * (-577.250) [-574.939] (-572.794) (-573.136) -- 0:00:32
319500 -- [-571.334] (-572.907) (-572.543) (-573.704) * (-577.769) [-572.447] (-574.085) (-572.893) -- 0:00:31
320000 -- [-571.347] (-573.024) (-573.617) (-574.076) * (-571.627) [-573.454] (-573.663) (-576.343) -- 0:00:31
Average standard deviation of split frequencies: 0.025481
320500 -- (-571.403) (-571.930) [-576.083] (-573.048) * (-573.078) (-575.853) [-575.127] (-575.851) -- 0:00:31
321000 -- (-577.251) (-571.549) (-574.445) [-572.692] * [-573.555] (-573.524) (-572.546) (-574.677) -- 0:00:31
321500 -- (-574.088) (-572.816) [-572.090] (-572.681) * (-571.734) [-571.702] (-574.111) (-573.247) -- 0:00:31
322000 -- (-572.463) [-571.924] (-573.618) (-573.731) * [-573.459] (-574.518) (-574.513) (-575.478) -- 0:00:31
322500 -- (-571.976) (-572.743) (-571.207) [-571.625] * (-571.355) [-573.224] (-573.776) (-571.736) -- 0:00:31
323000 -- (-571.349) (-573.649) [-572.609] (-571.185) * (-571.468) [-574.089] (-573.692) (-573.341) -- 0:00:31
323500 -- (-574.174) (-572.657) [-571.494] (-573.631) * [-571.618] (-572.794) (-573.996) (-572.033) -- 0:00:31
324000 -- (-577.503) (-573.762) [-571.338] (-573.181) * (-573.507) (-572.343) (-575.379) [-573.256] -- 0:00:31
324500 -- (-572.148) (-571.000) [-572.525] (-573.722) * (-578.008) (-573.809) (-572.590) [-572.793] -- 0:00:31
325000 -- (-575.509) (-570.835) [-571.980] (-576.939) * [-574.354] (-571.360) (-573.780) (-573.531) -- 0:00:31
Average standard deviation of split frequencies: 0.025064
325500 -- (-575.581) (-572.463) [-571.891] (-571.343) * [-571.116] (-573.541) (-574.008) (-573.392) -- 0:00:31
326000 -- (-575.081) [-572.056] (-574.748) (-570.725) * (-570.994) (-571.960) (-573.027) [-573.577] -- 0:00:31
326500 -- [-573.636] (-573.160) (-579.603) (-573.718) * (-571.107) (-570.814) [-572.558] (-573.971) -- 0:00:30
327000 -- (-573.655) [-571.462] (-571.469) (-574.392) * [-571.842] (-572.192) (-572.060) (-573.840) -- 0:00:30
327500 -- (-572.334) (-576.540) (-573.356) [-576.079] * (-572.356) (-572.170) (-572.959) [-570.928] -- 0:00:30
328000 -- (-574.825) [-571.926] (-571.757) (-573.580) * (-573.436) (-572.792) (-573.411) [-573.125] -- 0:00:30
328500 -- (-571.734) [-575.061] (-572.162) (-574.097) * (-572.066) [-576.385] (-573.946) (-572.449) -- 0:00:30
329000 -- (-573.588) [-571.869] (-572.498) (-572.582) * (-571.863) (-579.488) (-573.205) [-573.832] -- 0:00:30
329500 -- (-571.793) (-573.927) (-573.560) [-571.964] * [-573.251] (-575.088) (-574.859) (-572.292) -- 0:00:30
330000 -- (-572.132) [-574.256] (-575.043) (-572.983) * (-572.539) [-574.353] (-573.173) (-574.124) -- 0:00:30
Average standard deviation of split frequencies: 0.022810
330500 -- (-576.818) [-574.013] (-572.750) (-573.543) * (-573.025) (-571.899) [-574.290] (-574.460) -- 0:00:30
331000 -- (-581.039) [-573.456] (-571.901) (-575.141) * (-571.430) (-571.954) [-573.692] (-573.902) -- 0:00:32
331500 -- (-572.464) [-573.286] (-572.102) (-573.202) * (-574.046) (-572.974) (-574.786) [-573.615] -- 0:00:32
332000 -- (-572.375) (-573.057) [-571.323] (-574.692) * (-571.292) (-573.228) (-574.311) [-573.433] -- 0:00:32
332500 -- (-572.796) (-575.573) (-574.527) [-575.028] * (-570.909) [-573.208] (-571.690) (-573.104) -- 0:00:32
333000 -- (-572.115) [-574.046] (-573.531) (-572.990) * [-571.751] (-572.067) (-571.586) (-573.813) -- 0:00:32
333500 -- (-573.791) (-572.476) (-573.476) [-571.162] * (-572.479) (-573.195) [-571.169] (-573.307) -- 0:00:31
334000 -- (-572.590) (-576.723) (-576.166) [-573.303] * (-574.287) (-572.578) [-574.178] (-571.179) -- 0:00:31
334500 -- (-575.433) (-572.170) [-575.961] (-571.233) * [-572.953] (-572.725) (-573.295) (-572.084) -- 0:00:31
335000 -- (-574.754) (-573.157) [-573.708] (-574.651) * (-573.601) (-575.612) [-573.887] (-573.341) -- 0:00:31
Average standard deviation of split frequencies: 0.022448
335500 -- (-572.256) [-574.149] (-572.162) (-574.765) * (-571.757) (-577.091) [-571.041] (-575.553) -- 0:00:31
336000 -- [-576.329] (-573.716) (-572.045) (-577.189) * [-572.144] (-570.953) (-572.730) (-572.827) -- 0:00:31
336500 -- (-573.670) [-574.108] (-571.678) (-577.842) * (-576.092) (-572.703) (-571.190) [-572.390] -- 0:00:31
337000 -- [-571.361] (-576.498) (-573.032) (-574.463) * (-576.108) (-571.495) [-572.329] (-573.174) -- 0:00:31
337500 -- [-572.440] (-572.230) (-572.443) (-575.082) * (-574.911) (-572.601) [-571.976] (-572.258) -- 0:00:31
338000 -- (-573.143) (-573.374) (-574.287) [-571.711] * (-572.277) (-571.344) (-572.225) [-571.558] -- 0:00:31
338500 -- (-574.665) [-572.045] (-574.183) (-573.756) * (-572.809) [-572.171] (-575.259) (-571.501) -- 0:00:31
339000 -- [-574.264] (-571.956) (-573.101) (-573.842) * (-570.925) (-575.546) (-576.689) [-576.289] -- 0:00:31
339500 -- [-575.617] (-575.464) (-574.554) (-573.625) * (-572.222) [-572.696] (-571.888) (-571.759) -- 0:00:31
340000 -- (-574.524) [-575.921] (-572.341) (-575.876) * [-572.037] (-571.051) (-574.386) (-571.712) -- 0:00:31
Average standard deviation of split frequencies: 0.025830
340500 -- [-573.503] (-573.847) (-571.186) (-573.244) * (-572.364) (-572.657) [-575.589] (-574.781) -- 0:00:30
341000 -- (-576.113) [-572.618] (-571.165) (-574.391) * [-572.910] (-573.005) (-573.273) (-572.367) -- 0:00:30
341500 -- [-573.927] (-571.629) (-573.539) (-572.309) * (-573.787) [-572.834] (-571.876) (-575.482) -- 0:00:30
342000 -- [-572.487] (-571.392) (-572.080) (-577.521) * (-577.383) [-571.562] (-571.898) (-578.797) -- 0:00:30
342500 -- (-575.037) (-572.435) [-572.732] (-578.112) * [-573.233] (-570.847) (-574.325) (-571.247) -- 0:00:30
343000 -- (-574.738) (-572.495) (-575.728) [-571.623] * (-571.302) (-574.613) [-572.566] (-572.970) -- 0:00:30
343500 -- [-571.685] (-574.252) (-573.111) (-575.517) * (-574.689) (-574.292) [-573.694] (-572.118) -- 0:00:30
344000 -- (-571.655) [-571.987] (-572.335) (-572.729) * [-571.687] (-575.051) (-575.439) (-573.478) -- 0:00:30
344500 -- (-574.313) (-572.407) [-573.693] (-574.351) * (-571.458) (-574.562) [-573.906] (-574.598) -- 0:00:30
345000 -- (-576.094) (-571.903) [-573.441] (-576.509) * (-572.537) (-579.380) [-572.677] (-572.587) -- 0:00:30
Average standard deviation of split frequencies: 0.023616
345500 -- (-574.267) [-575.551] (-573.593) (-572.411) * (-576.399) [-571.628] (-573.067) (-574.791) -- 0:00:30
346000 -- (-571.848) (-571.465) [-573.937] (-573.249) * (-573.847) (-574.240) (-573.322) [-575.587] -- 0:00:30
346500 -- (-572.935) (-577.000) [-578.646] (-572.966) * [-573.914] (-574.488) (-572.015) (-573.852) -- 0:00:30
347000 -- (-572.127) [-571.241] (-576.777) (-574.425) * (-575.411) (-572.638) (-575.070) [-573.874] -- 0:00:30
347500 -- (-572.475) [-571.382] (-574.101) (-573.981) * (-571.428) (-574.163) (-573.414) [-575.195] -- 0:00:30
348000 -- (-571.859) (-572.263) [-572.216] (-573.548) * [-573.412] (-576.141) (-571.920) (-574.981) -- 0:00:29
348500 -- (-574.412) (-573.072) [-577.683] (-574.875) * [-570.969] (-574.152) (-572.422) (-573.147) -- 0:00:29
349000 -- (-575.230) (-572.428) (-572.823) [-572.280] * (-571.656) (-572.483) (-575.519) [-571.662] -- 0:00:29
349500 -- (-572.413) (-572.049) [-572.970] (-571.456) * [-572.243] (-573.387) (-575.156) (-572.978) -- 0:00:29
350000 -- (-573.453) (-574.146) [-575.725] (-571.371) * [-576.930] (-580.212) (-572.617) (-572.227) -- 0:00:29
Average standard deviation of split frequencies: 0.023301
350500 -- (-575.374) (-571.925) [-574.047] (-574.737) * (-575.583) [-572.202] (-573.911) (-573.579) -- 0:00:29
351000 -- (-581.048) [-572.454] (-574.513) (-577.591) * (-572.444) [-572.782] (-573.764) (-571.971) -- 0:00:29
351500 -- (-574.239) (-571.699) [-573.170] (-574.326) * (-571.102) (-571.919) [-573.843] (-572.358) -- 0:00:29
352000 -- (-573.269) (-571.781) (-574.070) [-571.249] * (-574.693) (-576.270) [-572.445] (-570.965) -- 0:00:29
352500 -- (-575.662) [-575.851] (-572.927) (-570.970) * (-574.960) (-571.857) (-572.368) [-573.196] -- 0:00:29
353000 -- (-573.938) [-571.590] (-573.517) (-573.591) * (-574.853) [-572.452] (-574.008) (-576.447) -- 0:00:29
353500 -- [-573.968] (-574.937) (-573.216) (-575.123) * (-572.468) (-573.631) (-573.163) [-573.297] -- 0:00:31
354000 -- (-574.309) (-575.825) [-571.851] (-573.839) * (-572.649) (-572.897) [-571.476] (-572.554) -- 0:00:31
354500 -- [-574.814] (-572.728) (-572.891) (-573.974) * (-571.118) (-572.538) [-571.337] (-574.091) -- 0:00:30
355000 -- (-574.353) (-573.102) (-573.638) [-573.549] * (-572.140) (-576.142) [-573.176] (-573.786) -- 0:00:30
Average standard deviation of split frequencies: 0.023835
355500 -- (-577.586) (-573.232) (-575.753) [-572.906] * (-574.029) (-572.627) [-574.052] (-573.174) -- 0:00:30
356000 -- (-578.251) (-576.226) (-573.217) [-575.547] * (-572.775) (-571.694) [-574.846] (-573.863) -- 0:00:30
356500 -- (-573.280) (-572.733) (-571.978) [-571.542] * (-574.121) [-572.816] (-573.183) (-574.700) -- 0:00:30
357000 -- [-573.457] (-576.070) (-575.485) (-571.061) * (-572.158) (-576.950) (-572.166) [-571.775] -- 0:00:30
357500 -- [-573.849] (-572.898) (-572.377) (-574.783) * (-571.955) [-573.082] (-572.449) (-572.369) -- 0:00:30
358000 -- (-576.524) (-574.195) [-574.247] (-574.080) * [-572.664] (-572.166) (-573.518) (-572.378) -- 0:00:30
358500 -- (-575.481) (-576.585) (-572.926) [-571.806] * [-572.163] (-572.286) (-574.794) (-573.803) -- 0:00:30
359000 -- [-574.418] (-573.518) (-577.734) (-571.561) * (-575.576) (-576.190) (-573.088) [-574.155] -- 0:00:30
359500 -- [-572.032] (-571.683) (-576.298) (-572.144) * (-574.325) (-576.516) [-572.069] (-575.490) -- 0:00:30
360000 -- [-572.099] (-575.736) (-571.483) (-571.164) * (-572.725) [-572.264] (-573.443) (-574.288) -- 0:00:30
Average standard deviation of split frequencies: 0.023527
360500 -- (-572.325) (-571.708) [-570.769] (-573.683) * (-575.256) (-574.413) (-575.794) [-571.355] -- 0:00:30
361000 -- (-572.680) (-574.150) (-571.329) [-571.623] * (-575.504) (-571.568) [-570.964] (-573.650) -- 0:00:30
361500 -- (-571.959) (-573.234) (-571.163) [-570.877] * (-573.018) (-571.829) [-571.377] (-574.435) -- 0:00:30
362000 -- [-572.755] (-574.440) (-572.873) (-574.414) * (-571.650) (-571.265) (-571.928) [-573.454] -- 0:00:29
362500 -- (-577.604) (-571.761) [-571.357] (-571.457) * [-574.046] (-571.290) (-571.168) (-572.222) -- 0:00:29
363000 -- (-573.224) (-571.481) (-572.507) [-574.269] * (-571.638) (-575.383) (-575.287) [-573.565] -- 0:00:29
363500 -- (-572.378) [-571.053] (-575.774) (-577.606) * (-572.659) (-574.242) (-571.500) [-571.052] -- 0:00:29
364000 -- (-573.873) (-574.230) (-572.586) [-577.840] * [-573.184] (-571.988) (-571.539) (-575.340) -- 0:00:29
364500 -- (-572.457) (-572.859) [-573.488] (-576.804) * [-573.130] (-571.570) (-572.962) (-575.580) -- 0:00:29
365000 -- (-575.022) (-573.128) (-573.336) [-572.187] * [-573.348] (-572.894) (-571.701) (-574.024) -- 0:00:29
Average standard deviation of split frequencies: 0.023184
365500 -- [-575.604] (-571.710) (-572.255) (-573.277) * [-574.250] (-574.338) (-572.947) (-571.650) -- 0:00:29
366000 -- [-572.193] (-572.357) (-581.545) (-572.831) * (-575.447) (-572.695) (-572.499) [-572.222] -- 0:00:29
366500 -- [-571.515] (-570.773) (-575.626) (-571.334) * (-573.016) (-573.252) (-573.582) [-574.004] -- 0:00:29
367000 -- (-575.202) [-570.807] (-577.968) (-571.260) * (-574.519) (-572.200) [-573.174] (-576.955) -- 0:00:29
367500 -- (-572.216) (-573.936) (-577.020) [-572.519] * [-572.567] (-574.731) (-571.999) (-578.954) -- 0:00:29
368000 -- [-573.236] (-572.890) (-573.158) (-571.059) * (-571.587) (-573.094) (-577.171) [-574.034] -- 0:00:29
368500 -- (-573.573) (-573.970) (-574.939) [-571.879] * (-571.975) (-572.002) [-571.707] (-574.372) -- 0:00:29
369000 -- [-574.952] (-572.425) (-574.018) (-576.841) * (-572.755) [-574.348] (-574.770) (-575.285) -- 0:00:29
369500 -- (-572.167) (-577.967) (-575.410) [-570.951] * (-572.793) (-574.674) (-575.399) [-574.559] -- 0:00:29
370000 -- (-574.275) [-578.576] (-571.768) (-571.954) * (-575.155) [-572.966] (-574.390) (-575.730) -- 0:00:28
Average standard deviation of split frequencies: 0.021196
370500 -- (-575.250) (-574.644) (-575.673) [-572.847] * (-572.263) (-573.003) (-573.584) [-574.357] -- 0:00:28
371000 -- (-573.274) (-571.118) (-574.814) [-574.923] * (-573.284) [-573.710] (-571.735) (-573.477) -- 0:00:28
371500 -- (-576.765) (-572.991) (-574.963) [-573.451] * [-571.723] (-573.958) (-574.818) (-572.081) -- 0:00:28
372000 -- [-572.749] (-571.449) (-576.039) (-574.343) * [-573.918] (-571.899) (-572.669) (-577.009) -- 0:00:28
372500 -- [-573.046] (-576.005) (-572.261) (-573.618) * (-575.374) (-573.155) [-572.579] (-572.575) -- 0:00:28
373000 -- (-573.610) [-573.394] (-573.779) (-573.440) * (-574.042) (-571.535) (-572.859) [-573.119] -- 0:00:28
373500 -- (-573.072) (-572.608) (-573.953) [-573.048] * (-572.163) (-574.213) (-576.198) [-578.717] -- 0:00:28
374000 -- (-576.814) [-571.705] (-576.689) (-573.469) * (-572.638) [-572.263] (-573.465) (-574.343) -- 0:00:28
374500 -- (-573.722) (-571.829) (-574.253) [-577.328] * (-572.114) [-571.055] (-572.717) (-573.658) -- 0:00:28
375000 -- (-574.338) [-577.652] (-572.132) (-571.596) * (-574.189) (-571.635) (-578.437) [-572.058] -- 0:00:28
Average standard deviation of split frequencies: 0.018388
375500 -- (-571.692) (-576.604) (-571.597) [-572.801] * (-577.692) [-572.812] (-575.747) (-572.968) -- 0:00:28
376000 -- (-572.973) (-572.164) (-574.236) [-572.912] * [-572.597] (-573.721) (-580.295) (-571.785) -- 0:00:29
376500 -- (-571.519) [-573.267] (-575.932) (-571.639) * (-572.850) (-572.174) (-571.822) [-572.871] -- 0:00:29
377000 -- [-572.962] (-572.730) (-576.418) (-576.765) * (-574.304) (-571.522) (-571.299) [-572.040] -- 0:00:29
377500 -- (-573.758) [-570.855] (-574.017) (-572.271) * [-577.919] (-574.008) (-571.951) (-571.993) -- 0:00:29
378000 -- (-573.823) [-571.544] (-572.857) (-573.803) * [-575.663] (-576.137) (-573.148) (-572.468) -- 0:00:29
378500 -- [-572.873] (-573.352) (-572.776) (-573.399) * (-573.209) (-575.004) [-577.795] (-573.087) -- 0:00:29
379000 -- (-578.400) (-572.291) [-572.628] (-576.059) * (-572.526) [-572.307] (-571.727) (-578.009) -- 0:00:29
379500 -- [-573.583] (-571.299) (-575.699) (-572.882) * (-575.493) (-572.768) (-571.553) [-574.670] -- 0:00:29
380000 -- [-572.495] (-572.913) (-573.011) (-575.587) * [-574.850] (-572.576) (-575.050) (-572.660) -- 0:00:29
Average standard deviation of split frequencies: 0.020639
380500 -- [-572.651] (-573.013) (-573.837) (-574.272) * [-572.801] (-572.014) (-572.986) (-573.296) -- 0:00:29
381000 -- [-572.949] (-577.085) (-573.267) (-574.282) * (-573.832) (-574.658) [-571.297] (-571.360) -- 0:00:29
381500 -- (-571.721) (-572.428) (-574.775) [-573.265] * (-573.691) [-572.949] (-571.344) (-573.124) -- 0:00:29
382000 -- [-572.436] (-573.169) (-571.101) (-572.225) * (-576.575) [-573.948] (-574.049) (-571.909) -- 0:00:29
382500 -- (-571.806) (-573.587) [-571.537] (-574.514) * (-575.386) [-575.900] (-572.956) (-573.544) -- 0:00:29
383000 -- (-573.125) [-571.703] (-576.688) (-572.007) * (-577.798) (-572.202) [-572.866] (-573.617) -- 0:00:28
383500 -- (-571.891) (-574.294) [-571.777] (-571.262) * (-571.973) [-574.518] (-572.139) (-572.893) -- 0:00:28
384000 -- [-570.898] (-572.204) (-574.382) (-571.690) * (-571.497) (-572.612) [-574.169] (-570.914) -- 0:00:28
384500 -- [-571.655] (-572.838) (-572.536) (-578.550) * (-576.085) [-577.238] (-574.609) (-572.014) -- 0:00:28
385000 -- (-574.503) (-573.251) [-573.286] (-575.227) * (-574.419) (-573.760) (-573.720) [-571.478] -- 0:00:28
Average standard deviation of split frequencies: 0.022797
385500 -- (-572.786) (-578.535) (-574.520) [-574.896] * (-573.156) (-573.882) [-579.294] (-572.120) -- 0:00:28
386000 -- (-574.577) (-573.824) (-575.159) [-572.313] * (-570.869) [-573.928] (-572.521) (-571.540) -- 0:00:28
386500 -- [-575.109] (-572.382) (-573.194) (-574.913) * (-575.198) [-572.648] (-573.230) (-571.658) -- 0:00:28
387000 -- [-571.257] (-572.680) (-577.858) (-573.006) * (-576.945) [-572.302] (-572.787) (-575.326) -- 0:00:28
387500 -- (-571.889) (-577.795) (-574.274) [-575.039] * (-574.567) [-575.707] (-572.243) (-573.602) -- 0:00:28
388000 -- (-570.818) [-571.606] (-574.369) (-579.855) * (-575.978) (-572.229) [-573.605] (-573.303) -- 0:00:28
388500 -- (-570.796) (-573.393) [-573.053] (-574.554) * [-575.092] (-573.287) (-573.568) (-576.882) -- 0:00:28
389000 -- (-571.901) (-575.054) (-573.078) [-576.208] * (-577.293) (-573.032) (-571.028) [-571.089] -- 0:00:28
389500 -- (-576.566) [-574.000] (-575.821) (-577.989) * (-573.296) (-571.862) [-574.459] (-573.091) -- 0:00:28
390000 -- (-572.638) (-571.785) [-571.579] (-574.317) * (-574.593) (-573.581) [-573.768] (-577.543) -- 0:00:28
Average standard deviation of split frequencies: 0.024133
390500 -- (-576.161) [-572.459] (-573.245) (-573.742) * [-573.083] (-575.813) (-573.692) (-574.401) -- 0:00:28
391000 -- (-573.348) (-573.808) (-573.944) [-573.065] * [-576.236] (-573.845) (-571.596) (-575.665) -- 0:00:28
391500 -- (-572.987) (-573.767) (-575.153) [-572.393] * (-578.871) (-575.131) (-572.396) [-574.495] -- 0:00:27
392000 -- (-575.513) (-573.612) (-576.574) [-572.437] * (-577.457) (-571.544) (-571.650) [-571.078] -- 0:00:27
392500 -- (-574.608) (-575.586) [-576.660] (-572.396) * [-573.949] (-572.326) (-576.165) (-572.283) -- 0:00:27
393000 -- [-572.108] (-575.492) (-576.362) (-571.661) * [-573.536] (-573.563) (-579.399) (-570.851) -- 0:00:27
393500 -- (-571.330) (-572.056) (-574.813) [-573.845] * [-575.744] (-571.330) (-573.052) (-571.715) -- 0:00:27
394000 -- [-574.462] (-574.179) (-573.636) (-573.275) * (-571.910) (-575.312) [-575.336] (-572.248) -- 0:00:27
394500 -- (-574.947) (-578.922) (-571.233) [-582.083] * [-571.523] (-574.579) (-572.884) (-572.720) -- 0:00:27
395000 -- (-573.088) [-573.534] (-575.584) (-572.935) * (-572.295) [-571.906] (-574.630) (-572.756) -- 0:00:27
Average standard deviation of split frequencies: 0.023808
395500 -- [-573.730] (-572.737) (-572.407) (-574.944) * (-578.781) (-571.779) [-574.188] (-572.741) -- 0:00:27
396000 -- (-571.403) (-578.910) (-571.552) [-571.167] * [-572.129] (-573.279) (-572.020) (-573.561) -- 0:00:27
396500 -- (-571.476) (-576.324) (-573.672) [-573.003] * (-571.075) [-573.420] (-575.335) (-575.139) -- 0:00:27
397000 -- (-572.834) (-572.737) (-572.674) [-571.402] * (-573.318) (-572.774) (-572.845) [-571.387] -- 0:00:27
397500 -- (-574.479) (-573.612) (-575.135) [-571.644] * (-573.325) (-572.528) (-573.670) [-572.077] -- 0:00:27
398000 -- (-573.851) [-572.198] (-571.741) (-572.226) * [-578.020] (-578.475) (-575.434) (-572.146) -- 0:00:28
398500 -- (-573.859) (-571.649) [-575.910] (-572.224) * (-571.467) [-574.254] (-573.913) (-575.751) -- 0:00:28
399000 -- (-575.443) (-571.791) (-572.321) [-572.939] * (-572.221) [-572.116] (-574.999) (-571.320) -- 0:00:28
399500 -- [-572.795] (-571.470) (-571.952) (-572.386) * (-575.658) (-574.308) [-571.677] (-571.776) -- 0:00:28
400000 -- (-573.756) [-572.386] (-571.147) (-571.043) * (-576.651) [-571.396] (-574.267) (-571.369) -- 0:00:28
Average standard deviation of split frequencies: 0.025100
400500 -- [-571.054] (-572.422) (-572.691) (-572.703) * (-573.831) [-573.411] (-572.046) (-572.835) -- 0:00:28
401000 -- [-575.540] (-577.274) (-573.578) (-572.188) * (-574.662) (-571.825) (-573.310) [-574.183] -- 0:00:28
401500 -- (-573.877) (-574.064) (-572.744) [-573.392] * (-573.790) [-571.888] (-571.555) (-573.280) -- 0:00:28
402000 -- [-573.097] (-572.522) (-572.497) (-573.020) * [-571.248] (-575.589) (-575.909) (-574.281) -- 0:00:28
402500 -- [-572.643] (-574.191) (-572.968) (-572.053) * [-571.844] (-571.909) (-574.963) (-573.933) -- 0:00:28
403000 -- (-574.563) (-575.556) (-573.538) [-572.326] * (-570.930) (-572.900) [-573.672] (-575.210) -- 0:00:28
403500 -- (-575.197) [-572.362] (-571.455) (-576.993) * (-575.814) (-572.092) [-576.999] (-573.948) -- 0:00:28
404000 -- (-573.278) (-575.128) (-573.212) [-571.390] * [-573.336] (-573.486) (-571.398) (-576.089) -- 0:00:28
404500 -- (-574.757) [-574.725] (-572.539) (-571.846) * (-574.310) (-573.536) (-572.772) [-571.226] -- 0:00:27
405000 -- (-571.301) (-574.403) (-576.280) [-571.416] * (-573.706) (-575.088) (-575.274) [-571.812] -- 0:00:27
Average standard deviation of split frequencies: 0.027092
405500 -- (-573.194) (-571.889) (-573.955) [-579.552] * [-573.910] (-573.106) (-572.723) (-571.939) -- 0:00:27
406000 -- (-572.752) [-576.003] (-574.669) (-572.351) * (-572.963) (-573.395) (-573.735) [-571.510] -- 0:00:27
406500 -- (-574.266) [-571.001] (-572.167) (-571.841) * (-573.343) [-575.216] (-577.307) (-572.027) -- 0:00:27
407000 -- [-573.543] (-574.806) (-574.669) (-577.021) * (-573.647) [-575.094] (-572.145) (-572.200) -- 0:00:27
407500 -- (-573.512) (-576.658) (-573.487) [-572.300] * [-574.397] (-572.555) (-573.617) (-571.669) -- 0:00:27
408000 -- [-571.972] (-573.835) (-572.309) (-574.637) * (-573.473) [-572.990] (-571.046) (-571.122) -- 0:00:27
408500 -- [-574.734] (-574.518) (-576.782) (-573.812) * (-574.314) [-571.834] (-571.918) (-572.269) -- 0:00:27
409000 -- (-572.533) (-573.433) [-572.831] (-570.902) * [-575.279] (-573.646) (-574.887) (-575.772) -- 0:00:27
409500 -- (-571.653) (-572.811) [-574.221] (-572.551) * (-572.200) (-574.363) [-571.453] (-572.279) -- 0:00:27
410000 -- (-571.990) (-576.014) (-572.102) [-572.122] * (-572.078) (-574.202) (-571.698) [-571.331] -- 0:00:27
Average standard deviation of split frequencies: 0.026784
410500 -- (-574.164) [-571.279] (-572.100) (-573.334) * (-573.211) [-571.269] (-573.421) (-571.120) -- 0:00:27
411000 -- (-572.763) [-571.713] (-571.043) (-572.238) * (-573.653) (-572.326) (-571.828) [-572.035] -- 0:00:27
411500 -- [-572.984] (-573.599) (-574.107) (-576.800) * (-571.610) (-573.296) (-574.519) [-573.143] -- 0:00:27
412000 -- (-572.186) [-572.112] (-575.041) (-574.106) * (-573.859) (-572.519) (-575.839) [-574.793] -- 0:00:27
412500 -- [-572.771] (-575.640) (-572.540) (-573.166) * (-572.173) (-574.360) (-576.183) [-572.519] -- 0:00:27
413000 -- (-572.121) [-573.290] (-574.308) (-572.702) * (-573.038) [-572.165] (-573.783) (-574.111) -- 0:00:27
413500 -- (-572.494) [-574.346] (-571.279) (-573.321) * [-573.755] (-574.395) (-573.685) (-575.139) -- 0:00:26
414000 -- (-572.730) [-575.211] (-573.820) (-574.791) * [-573.860] (-571.722) (-577.454) (-574.828) -- 0:00:26
414500 -- (-572.793) [-573.501] (-575.886) (-572.450) * (-573.534) [-573.325] (-572.715) (-578.289) -- 0:00:26
415000 -- (-571.749) (-575.065) [-572.586] (-571.798) * (-574.122) (-573.286) (-575.090) [-573.251] -- 0:00:26
Average standard deviation of split frequencies: 0.028707
415500 -- (-571.109) (-577.110) [-572.883] (-573.188) * [-573.760] (-571.868) (-572.156) (-571.550) -- 0:00:26
416000 -- (-575.377) [-572.730] (-574.135) (-571.787) * [-573.190] (-572.209) (-573.402) (-572.073) -- 0:00:26
416500 -- (-572.205) [-573.032] (-571.526) (-572.256) * (-573.264) [-571.632] (-572.835) (-571.194) -- 0:00:26
417000 -- (-571.562) (-573.957) (-573.727) [-572.607] * (-574.151) [-571.475] (-571.104) (-573.628) -- 0:00:26
417500 -- (-574.392) [-574.601] (-572.009) (-573.022) * (-572.813) [-575.307] (-571.786) (-573.314) -- 0:00:26
418000 -- (-574.630) (-578.637) (-574.137) [-572.326] * (-572.388) [-571.741] (-573.027) (-573.716) -- 0:00:26
418500 -- (-572.582) (-574.459) [-572.653] (-575.602) * [-572.261] (-573.791) (-574.050) (-572.789) -- 0:00:26
419000 -- [-572.162] (-571.709) (-574.933) (-574.293) * (-574.949) [-572.623] (-574.386) (-572.845) -- 0:00:26
419500 -- (-572.290) [-571.639] (-575.686) (-572.048) * (-572.425) [-573.393] (-571.475) (-572.197) -- 0:00:26
420000 -- (-571.251) (-573.882) (-572.169) [-571.710] * (-577.783) (-574.019) (-573.804) [-572.594] -- 0:00:27
Average standard deviation of split frequencies: 0.029136
420500 -- [-575.373] (-573.079) (-572.515) (-576.902) * (-571.962) (-572.436) (-571.833) [-573.757] -- 0:00:27
421000 -- (-577.358) (-572.811) [-575.854] (-572.893) * (-574.064) [-572.468] (-572.224) (-572.243) -- 0:00:27
421500 -- [-572.014] (-572.438) (-573.676) (-574.606) * (-575.328) [-572.845] (-572.112) (-572.753) -- 0:00:27
422000 -- (-571.866) (-573.209) [-575.891] (-575.269) * [-575.888] (-573.435) (-572.936) (-576.241) -- 0:00:27
422500 -- (-575.877) (-573.879) [-577.265] (-572.249) * [-573.866] (-572.332) (-572.295) (-573.031) -- 0:00:27
423000 -- (-572.550) (-572.360) (-572.232) [-571.462] * (-571.290) (-575.363) (-571.156) [-573.412] -- 0:00:27
423500 -- (-572.768) (-574.080) [-572.317] (-575.226) * [-573.655] (-572.797) (-574.538) (-571.419) -- 0:00:27
424000 -- (-572.149) [-572.522] (-572.421) (-576.056) * (-571.405) [-573.308] (-572.836) (-579.432) -- 0:00:27
424500 -- (-574.230) [-572.320] (-573.839) (-571.967) * (-575.463) [-572.071] (-572.103) (-571.473) -- 0:00:27
425000 -- (-572.617) (-572.447) [-572.340] (-575.262) * (-573.611) (-573.915) (-573.181) [-575.973] -- 0:00:27
Average standard deviation of split frequencies: 0.025083
425500 -- [-572.042] (-574.851) (-578.458) (-572.811) * (-575.793) [-572.398] (-573.938) (-573.856) -- 0:00:27
426000 -- (-575.448) (-573.169) [-572.701] (-573.129) * (-571.776) (-580.959) (-573.099) [-571.746] -- 0:00:26
426500 -- (-571.247) [-571.711] (-572.171) (-574.153) * [-571.533] (-575.303) (-573.338) (-573.403) -- 0:00:26
427000 -- [-573.231] (-571.632) (-572.793) (-574.129) * [-574.500] (-573.240) (-575.139) (-572.675) -- 0:00:26
427500 -- [-572.238] (-572.176) (-574.060) (-571.215) * (-574.205) [-570.932] (-575.758) (-574.856) -- 0:00:26
428000 -- [-574.473] (-574.069) (-577.699) (-573.792) * (-574.373) (-574.487) [-573.086] (-572.243) -- 0:00:26
428500 -- (-572.859) [-574.358] (-579.243) (-573.827) * (-572.512) [-571.324] (-576.686) (-571.152) -- 0:00:26
429000 -- (-572.246) (-571.942) [-581.317] (-577.035) * [-574.862] (-574.508) (-573.142) (-571.692) -- 0:00:26
429500 -- (-572.988) [-572.347] (-576.596) (-575.496) * (-571.245) [-574.381] (-572.801) (-571.540) -- 0:00:26
430000 -- (-571.964) (-573.027) [-571.225] (-576.153) * [-572.077] (-573.816) (-573.924) (-571.588) -- 0:00:26
Average standard deviation of split frequencies: 0.027000
430500 -- (-574.529) [-575.396] (-572.089) (-573.729) * (-571.710) (-573.856) [-576.476] (-574.839) -- 0:00:26
431000 -- (-573.550) (-572.728) [-571.871] (-578.441) * [-571.216] (-571.728) (-574.162) (-574.546) -- 0:00:26
431500 -- (-574.448) (-576.242) (-571.539) [-572.439] * [-572.857] (-573.278) (-573.319) (-573.768) -- 0:00:26
432000 -- (-574.498) (-579.507) [-572.544] (-575.933) * (-573.867) (-572.615) [-572.272] (-574.867) -- 0:00:26
432500 -- (-571.941) (-572.795) [-572.221] (-575.016) * (-572.314) (-572.619) [-571.250] (-572.517) -- 0:00:26
433000 -- (-571.825) [-576.056] (-575.083) (-571.899) * [-573.426] (-572.744) (-572.525) (-573.795) -- 0:00:26
433500 -- (-572.345) [-574.127] (-575.296) (-571.533) * [-572.550] (-573.594) (-571.369) (-573.766) -- 0:00:26
434000 -- (-573.654) (-572.817) (-572.699) [-572.459] * (-572.168) (-578.003) (-574.114) [-571.761] -- 0:00:26
434500 -- (-575.609) (-573.138) [-572.054] (-575.278) * (-573.199) (-571.945) [-577.194] (-573.357) -- 0:00:26
435000 -- (-571.568) (-573.565) (-573.028) [-572.179] * [-573.628] (-571.494) (-575.741) (-572.133) -- 0:00:25
Average standard deviation of split frequencies: 0.024507
435500 -- (-571.948) [-571.835] (-572.271) (-572.134) * (-572.205) [-571.803] (-576.683) (-576.204) -- 0:00:25
436000 -- (-571.961) (-575.192) [-571.792] (-571.540) * (-573.495) [-571.629] (-573.902) (-571.366) -- 0:00:25
436500 -- (-572.353) (-571.458) (-572.171) [-573.704] * [-574.349] (-573.424) (-571.546) (-574.341) -- 0:00:25
437000 -- (-572.550) [-574.133] (-572.792) (-571.732) * (-575.909) [-572.755] (-570.892) (-573.547) -- 0:00:25
437500 -- (-572.519) (-581.822) [-571.537] (-576.790) * (-572.226) (-573.164) (-574.261) [-575.665] -- 0:00:25
438000 -- (-572.039) (-573.434) [-573.899] (-576.003) * (-574.924) (-575.445) (-572.712) [-572.129] -- 0:00:25
438500 -- (-572.069) [-572.652] (-575.900) (-570.915) * [-574.357] (-575.987) (-571.633) (-576.945) -- 0:00:25
439000 -- [-575.043] (-574.317) (-576.000) (-577.600) * (-573.165) (-576.391) [-572.934] (-578.108) -- 0:00:25
439500 -- (-573.698) (-573.853) (-574.807) [-574.843] * (-574.018) [-571.744] (-574.048) (-574.862) -- 0:00:25
440000 -- (-572.018) (-572.460) [-572.247] (-572.396) * [-572.412] (-572.615) (-573.035) (-571.685) -- 0:00:25
Average standard deviation of split frequencies: 0.023535
440500 -- [-571.823] (-572.633) (-572.026) (-575.987) * [-572.563] (-572.316) (-572.554) (-571.517) -- 0:00:25
441000 -- (-571.799) (-571.697) (-572.331) [-577.906] * [-571.545] (-574.039) (-574.048) (-574.416) -- 0:00:25
441500 -- (-575.039) [-572.035] (-573.276) (-576.085) * [-571.862] (-574.679) (-571.686) (-573.056) -- 0:00:25
442000 -- [-574.249] (-572.707) (-571.704) (-571.055) * [-571.667] (-571.491) (-572.027) (-576.173) -- 0:00:25
442500 -- (-572.810) (-572.958) [-572.293] (-574.389) * (-573.838) (-572.818) (-572.381) [-575.066] -- 0:00:26
443000 -- (-571.867) (-574.752) (-572.796) [-572.732] * (-571.041) (-572.835) [-573.115] (-573.192) -- 0:00:26
443500 -- [-573.239] (-574.086) (-576.076) (-573.823) * (-571.711) (-571.576) (-571.613) [-572.063] -- 0:00:26
444000 -- (-575.936) (-571.957) [-579.509] (-572.981) * (-573.882) (-571.907) (-574.124) [-574.005] -- 0:00:26
444500 -- (-577.940) [-571.818] (-583.012) (-575.800) * [-573.538] (-573.390) (-572.438) (-572.701) -- 0:00:26
445000 -- (-572.790) (-572.694) (-574.091) [-574.172] * (-575.687) (-572.051) (-573.499) [-571.890] -- 0:00:26
Average standard deviation of split frequencies: 0.023253
445500 -- (-573.061) (-575.161) (-574.117) [-573.185] * (-573.837) [-577.020] (-574.511) (-573.671) -- 0:00:26
446000 -- (-574.374) (-572.944) (-573.090) [-573.241] * (-571.272) [-572.637] (-579.218) (-572.588) -- 0:00:26
446500 -- [-573.596] (-574.966) (-574.160) (-572.414) * (-571.816) (-573.957) (-573.259) [-572.387] -- 0:00:26
447000 -- (-572.982) [-572.131] (-572.549) (-573.207) * (-571.062) (-574.214) (-571.884) [-571.783] -- 0:00:25
447500 -- (-573.629) [-571.790] (-572.922) (-571.459) * (-572.198) [-573.511] (-572.014) (-574.218) -- 0:00:25
448000 -- (-572.132) [-574.466] (-571.606) (-573.003) * (-574.268) (-574.120) [-571.737] (-577.152) -- 0:00:25
448500 -- [-574.009] (-573.337) (-577.579) (-572.426) * (-571.329) (-572.215) [-572.480] (-572.836) -- 0:00:25
449000 -- [-572.210] (-572.950) (-574.448) (-577.378) * [-575.838] (-573.170) (-572.459) (-573.578) -- 0:00:25
449500 -- [-572.744] (-573.469) (-574.023) (-571.485) * (-573.643) [-573.270] (-573.059) (-574.255) -- 0:00:25
450000 -- (-572.001) (-570.956) [-575.554] (-572.751) * (-573.237) [-571.963] (-577.006) (-571.656) -- 0:00:25
Average standard deviation of split frequencies: 0.022315
450500 -- (-579.576) (-572.009) (-573.324) [-572.124] * (-572.475) (-571.834) [-572.342] (-572.179) -- 0:00:25
451000 -- [-574.522] (-572.436) (-571.239) (-574.468) * [-573.459] (-579.934) (-572.786) (-571.306) -- 0:00:25
451500 -- [-575.688] (-576.820) (-573.695) (-573.189) * (-572.532) (-574.566) (-571.150) [-575.259] -- 0:00:25
452000 -- (-576.376) (-573.188) [-573.267] (-571.475) * (-576.007) [-574.410] (-573.361) (-572.806) -- 0:00:25
452500 -- (-573.349) (-577.668) (-577.094) [-571.237] * (-576.031) (-580.030) (-573.124) [-570.855] -- 0:00:25
453000 -- (-573.969) (-572.608) [-574.449] (-575.293) * [-573.868] (-572.687) (-571.960) (-572.753) -- 0:00:25
453500 -- (-573.480) (-572.676) [-572.811] (-572.826) * (-573.532) (-571.643) (-573.993) [-571.015] -- 0:00:25
454000 -- (-575.143) [-574.319] (-574.462) (-572.361) * (-571.151) [-572.920] (-571.441) (-574.107) -- 0:00:25
454500 -- (-574.731) [-575.250] (-575.015) (-577.314) * (-572.614) (-572.166) (-571.136) [-571.089] -- 0:00:25
455000 -- (-576.189) (-576.833) (-572.076) [-572.711] * (-570.961) (-572.168) (-571.736) [-572.209] -- 0:00:25
Average standard deviation of split frequencies: 0.021365
455500 -- [-573.104] (-575.232) (-573.931) (-574.266) * (-572.943) [-573.105] (-572.168) (-574.532) -- 0:00:25
456000 -- (-572.132) (-574.762) [-571.541] (-572.104) * (-574.901) [-573.055] (-572.226) (-572.695) -- 0:00:25
456500 -- (-573.374) [-570.827] (-572.114) (-571.648) * [-574.445] (-572.448) (-571.208) (-572.777) -- 0:00:25
457000 -- (-575.350) (-573.975) [-573.907] (-574.670) * (-576.935) [-570.802] (-571.680) (-579.260) -- 0:00:24
457500 -- (-572.813) (-572.769) [-571.014] (-576.417) * [-571.665] (-571.499) (-574.689) (-572.618) -- 0:00:24
458000 -- (-573.806) (-575.804) (-572.101) [-574.018] * [-572.309] (-573.331) (-572.357) (-572.187) -- 0:00:24
458500 -- (-572.206) (-573.438) (-572.757) [-572.708] * (-571.886) (-575.663) [-575.220] (-574.587) -- 0:00:24
459000 -- (-573.628) [-572.669] (-573.878) (-571.403) * (-571.949) (-572.330) (-575.459) [-573.160] -- 0:00:24
459500 -- (-576.575) (-572.783) [-577.729] (-573.778) * (-572.599) (-572.253) (-573.279) [-571.953] -- 0:00:24
460000 -- (-571.732) [-573.497] (-575.348) (-574.887) * (-575.431) (-573.416) [-571.925] (-572.637) -- 0:00:24
Average standard deviation of split frequencies: 0.019102
460500 -- [-572.478] (-574.932) (-572.784) (-573.617) * (-573.680) (-573.345) (-572.164) [-573.728] -- 0:00:24
461000 -- (-574.837) (-575.847) [-574.362] (-576.117) * (-573.731) [-572.284] (-571.940) (-573.223) -- 0:00:24
461500 -- (-571.414) [-572.246] (-571.534) (-572.633) * (-571.761) (-571.621) [-574.078] (-574.178) -- 0:00:24
462000 -- (-573.162) (-572.700) [-573.240] (-572.593) * (-571.165) (-573.941) [-571.838] (-573.538) -- 0:00:24
462500 -- (-574.062) [-572.025] (-574.737) (-572.190) * (-572.321) (-572.791) [-571.866] (-573.847) -- 0:00:24
463000 -- (-585.034) (-572.915) (-572.101) [-571.465] * [-571.911] (-573.477) (-572.746) (-571.148) -- 0:00:24
463500 -- [-573.835] (-572.558) (-572.190) (-577.157) * (-572.182) [-571.459] (-574.019) (-574.499) -- 0:00:24
464000 -- (-577.759) (-575.514) (-573.513) [-573.384] * (-571.191) (-572.686) [-571.792] (-571.941) -- 0:00:24
464500 -- [-572.290] (-574.198) (-574.431) (-574.152) * (-571.271) (-575.148) [-574.655] (-571.968) -- 0:00:25
465000 -- [-572.189] (-573.127) (-576.150) (-571.032) * (-571.610) [-573.558] (-572.125) (-573.039) -- 0:00:25
Average standard deviation of split frequencies: 0.015511
465500 -- [-574.524] (-579.567) (-575.808) (-575.566) * (-572.583) (-571.407) [-571.290] (-574.210) -- 0:00:25
466000 -- (-572.335) (-576.212) [-573.458] (-571.326) * (-579.143) (-574.917) [-574.173] (-573.095) -- 0:00:25
466500 -- (-573.652) (-573.255) (-577.893) [-573.256] * [-571.744] (-577.211) (-572.552) (-578.575) -- 0:00:25
467000 -- [-572.135] (-572.094) (-572.567) (-576.026) * (-572.021) (-571.430) [-571.442] (-573.803) -- 0:00:25
467500 -- (-570.859) (-572.841) (-576.357) [-574.046] * (-572.372) (-571.200) [-575.518] (-571.808) -- 0:00:25
468000 -- (-572.385) (-571.911) (-574.460) [-570.812] * (-572.223) [-571.026] (-572.310) (-572.427) -- 0:00:25
468500 -- (-573.224) (-573.145) (-572.010) [-573.171] * (-571.590) [-576.354] (-575.434) (-573.153) -- 0:00:24
469000 -- (-573.781) (-571.984) (-576.869) [-573.940] * (-573.116) [-574.178] (-575.922) (-572.442) -- 0:00:24
469500 -- (-580.960) (-572.259) [-571.130] (-570.885) * (-574.268) (-571.913) (-576.356) [-572.473] -- 0:00:24
470000 -- (-573.249) [-571.169] (-573.542) (-572.866) * (-571.873) (-574.072) (-573.511) [-572.879] -- 0:00:24
Average standard deviation of split frequencies: 0.016025
470500 -- (-571.173) [-573.135] (-576.033) (-571.681) * [-572.309] (-573.526) (-573.422) (-572.430) -- 0:00:24
471000 -- [-572.169] (-572.487) (-573.085) (-572.199) * (-575.656) (-572.847) (-571.460) [-573.732] -- 0:00:24
471500 -- (-574.211) (-574.319) (-574.524) [-571.833] * (-574.741) (-572.963) (-575.816) [-574.546] -- 0:00:24
472000 -- [-576.998] (-573.601) (-580.418) (-571.532) * [-572.981] (-574.827) (-571.383) (-576.747) -- 0:00:24
472500 -- (-574.245) [-576.833] (-574.441) (-571.982) * (-572.495) (-572.657) [-573.030] (-575.936) -- 0:00:24
473000 -- (-571.406) (-572.596) [-571.944] (-571.525) * (-581.016) [-572.933] (-575.034) (-574.312) -- 0:00:24
473500 -- (-572.083) (-574.691) (-572.514) [-572.998] * (-577.172) (-572.678) (-573.510) [-570.992] -- 0:00:24
474000 -- (-576.301) [-573.776] (-572.923) (-574.504) * (-579.093) [-571.828] (-575.106) (-576.661) -- 0:00:24
474500 -- (-572.736) (-577.140) [-572.068] (-573.082) * [-580.096] (-574.545) (-575.779) (-573.569) -- 0:00:24
475000 -- [-572.299] (-571.343) (-572.093) (-571.297) * (-579.533) [-573.062] (-573.854) (-572.967) -- 0:00:24
Average standard deviation of split frequencies: 0.016506
475500 -- [-576.699] (-574.069) (-578.294) (-573.902) * [-572.410] (-572.929) (-575.679) (-572.537) -- 0:00:24
476000 -- [-571.873] (-574.219) (-576.283) (-571.974) * (-573.005) (-571.624) [-574.478] (-575.588) -- 0:00:24
476500 -- (-576.167) (-572.883) [-573.817] (-574.238) * (-573.609) [-574.252] (-572.487) (-574.879) -- 0:00:24
477000 -- (-579.163) [-572.445] (-572.453) (-575.605) * (-573.792) (-574.164) (-572.844) [-573.898] -- 0:00:24
477500 -- (-575.138) [-572.696] (-573.503) (-574.445) * (-575.310) (-573.406) (-572.142) [-572.767] -- 0:00:24
478000 -- [-574.909] (-573.164) (-573.046) (-573.483) * [-573.842] (-574.488) (-572.602) (-572.309) -- 0:00:24
478500 -- (-574.812) (-574.383) [-572.209] (-572.177) * (-572.908) (-571.790) (-575.918) [-571.335] -- 0:00:23
479000 -- [-571.259] (-572.161) (-574.553) (-572.732) * [-574.650] (-571.869) (-574.320) (-573.790) -- 0:00:23
479500 -- (-574.884) (-571.867) (-574.327) [-573.569] * (-574.620) (-571.207) (-573.181) [-572.805] -- 0:00:23
480000 -- [-573.350] (-575.909) (-573.062) (-574.461) * [-575.536] (-572.211) (-574.888) (-574.552) -- 0:00:23
Average standard deviation of split frequencies: 0.015038
480500 -- (-574.453) (-574.031) (-572.536) [-573.409] * (-572.292) [-574.540] (-572.262) (-575.075) -- 0:00:23
481000 -- (-575.438) (-571.541) (-571.151) [-571.179] * (-574.029) [-575.142] (-574.209) (-575.097) -- 0:00:23
481500 -- [-572.468] (-573.471) (-575.889) (-572.342) * (-576.084) (-571.724) (-571.720) [-572.333] -- 0:00:23
482000 -- (-572.512) (-576.769) [-572.173] (-572.550) * [-572.525] (-572.309) (-573.504) (-579.093) -- 0:00:23
482500 -- (-572.589) [-572.968] (-572.495) (-574.266) * (-572.572) (-575.074) (-574.134) [-572.470] -- 0:00:23
483000 -- (-573.693) [-571.932] (-573.719) (-572.725) * [-572.175] (-573.080) (-572.296) (-572.556) -- 0:00:23
483500 -- (-573.929) (-574.282) (-574.883) [-573.709] * [-574.891] (-571.229) (-572.676) (-571.188) -- 0:00:23
484000 -- (-575.082) (-576.785) (-573.314) [-575.136] * (-572.166) (-575.071) [-572.603] (-572.325) -- 0:00:23
484500 -- (-572.998) [-572.873] (-572.559) (-575.827) * [-571.019] (-571.327) (-572.275) (-575.118) -- 0:00:23
485000 -- (-571.336) (-572.204) [-572.345] (-574.603) * [-571.748] (-571.419) (-572.554) (-573.261) -- 0:00:23
Average standard deviation of split frequencies: 0.016166
485500 -- (-571.743) [-573.838] (-574.303) (-575.847) * (-575.712) [-572.395] (-573.974) (-573.239) -- 0:00:23
486000 -- (-571.630) (-574.919) (-576.844) [-574.457] * (-570.914) [-574.209] (-573.441) (-576.745) -- 0:00:23
486500 -- (-571.741) (-572.371) (-575.136) [-571.287] * (-574.837) (-571.645) [-577.427] (-572.135) -- 0:00:24
487000 -- (-571.653) (-573.105) [-575.915] (-573.312) * (-571.778) (-578.600) (-572.673) [-572.079] -- 0:00:24
487500 -- [-572.665] (-580.460) (-573.266) (-576.934) * [-573.624] (-571.945) (-574.278) (-572.028) -- 0:00:24
488000 -- [-573.352] (-575.247) (-574.215) (-573.945) * (-573.210) (-573.953) [-571.662] (-572.652) -- 0:00:24
488500 -- (-571.122) [-577.330] (-577.949) (-571.930) * [-576.870] (-573.991) (-571.176) (-572.055) -- 0:00:24
489000 -- (-571.512) (-572.596) [-572.750] (-571.171) * (-572.147) [-572.546] (-571.410) (-573.363) -- 0:00:24
489500 -- (-575.965) [-571.936] (-571.880) (-578.176) * (-571.543) (-574.070) (-572.586) [-571.158] -- 0:00:23
490000 -- [-572.028] (-572.167) (-571.981) (-574.526) * (-574.585) (-572.342) [-572.810] (-577.270) -- 0:00:23
Average standard deviation of split frequencies: 0.015372
490500 -- (-578.798) [-570.972] (-573.289) (-575.564) * [-572.084] (-571.630) (-573.360) (-578.365) -- 0:00:23
491000 -- (-575.426) (-577.196) [-572.370] (-571.614) * (-573.573) [-576.277] (-574.211) (-571.248) -- 0:00:23
491500 -- [-571.526] (-578.998) (-573.173) (-571.994) * [-572.871] (-572.737) (-573.313) (-571.194) -- 0:00:23
492000 -- (-574.443) (-580.411) [-576.199] (-574.653) * [-574.472] (-572.083) (-572.667) (-571.787) -- 0:00:23
492500 -- (-573.849) (-578.247) (-573.008) [-571.160] * (-573.161) (-571.632) (-575.973) [-572.716] -- 0:00:23
493000 -- (-574.775) [-572.841] (-571.948) (-572.306) * [-573.424] (-572.849) (-575.741) (-571.287) -- 0:00:23
493500 -- [-574.468] (-570.947) (-572.824) (-572.630) * [-572.955] (-572.792) (-571.590) (-572.238) -- 0:00:23
494000 -- (-574.102) (-573.342) (-573.868) [-571.700] * (-573.409) [-577.068] (-574.535) (-571.216) -- 0:00:23
494500 -- (-576.872) (-573.998) (-570.899) [-571.611] * (-573.588) (-571.495) [-571.311] (-572.839) -- 0:00:23
495000 -- (-573.400) [-572.327] (-573.130) (-575.742) * (-572.233) (-573.583) (-574.054) [-572.004] -- 0:00:23
Average standard deviation of split frequencies: 0.017107
495500 -- (-571.881) [-573.248] (-577.578) (-572.714) * [-574.190] (-572.759) (-573.910) (-573.457) -- 0:00:23
496000 -- (-573.442) (-574.172) [-571.711] (-575.016) * (-574.960) [-573.315] (-573.141) (-573.618) -- 0:00:23
496500 -- (-571.035) (-572.487) (-573.169) [-573.772] * [-574.310] (-574.204) (-571.186) (-571.272) -- 0:00:23
497000 -- (-574.586) [-571.950] (-572.586) (-575.185) * [-571.550] (-575.692) (-574.015) (-579.716) -- 0:00:23
497500 -- [-570.979] (-572.088) (-574.718) (-574.281) * (-573.072) (-573.558) (-572.222) [-574.615] -- 0:00:23
498000 -- (-571.944) [-571.944] (-577.178) (-572.513) * (-577.834) [-571.888] (-572.938) (-573.144) -- 0:00:23
498500 -- (-575.382) [-571.060] (-574.879) (-572.181) * [-573.932] (-572.205) (-575.661) (-576.818) -- 0:00:23
499000 -- (-574.971) [-571.305] (-576.404) (-571.656) * (-573.068) [-574.647] (-575.083) (-577.719) -- 0:00:23
499500 -- (-572.605) (-571.334) [-571.451] (-574.845) * (-573.940) (-571.562) [-572.555] (-574.618) -- 0:00:23
500000 -- (-571.447) [-572.361] (-575.330) (-571.454) * (-573.123) (-573.805) (-577.396) [-572.720] -- 0:00:23
Average standard deviation of split frequencies: 0.016948
500500 -- [-571.541] (-576.678) (-574.386) (-573.443) * [-574.792] (-573.848) (-572.865) (-574.178) -- 0:00:22
501000 -- (-574.026) [-573.538] (-575.707) (-571.208) * [-572.504] (-573.564) (-575.246) (-571.703) -- 0:00:22
501500 -- [-573.573] (-574.383) (-573.930) (-572.108) * (-574.762) (-575.508) [-571.874] (-570.762) -- 0:00:22
502000 -- (-572.294) (-572.703) (-571.812) [-573.384] * (-573.336) (-573.077) (-572.954) [-572.609] -- 0:00:22
502500 -- (-573.818) (-571.188) [-572.665] (-572.741) * (-571.311) [-571.580] (-573.414) (-571.366) -- 0:00:22
503000 -- (-573.547) [-572.235] (-571.674) (-574.804) * (-571.862) [-572.332] (-578.243) (-574.554) -- 0:00:22
503500 -- [-571.297] (-576.832) (-573.488) (-572.181) * (-573.801) (-571.165) [-573.666] (-576.565) -- 0:00:22
504000 -- (-571.805) (-575.771) (-574.822) [-573.413] * (-576.022) (-572.169) (-572.522) [-573.045] -- 0:00:22
504500 -- (-571.189) (-579.614) (-571.047) [-572.263] * (-576.581) [-572.192] (-573.141) (-573.174) -- 0:00:22
505000 -- (-572.558) (-571.571) [-572.885] (-572.538) * (-573.562) [-573.478] (-575.723) (-571.354) -- 0:00:22
Average standard deviation of split frequencies: 0.015527
505500 -- (-571.250) (-575.103) (-573.047) [-571.301] * (-577.372) (-574.685) (-576.715) [-571.328] -- 0:00:22
506000 -- (-571.954) [-573.375] (-572.639) (-571.092) * (-571.424) (-577.571) (-571.612) [-571.753] -- 0:00:22
506500 -- (-573.670) (-576.668) [-572.155] (-574.192) * (-571.606) [-573.750] (-573.658) (-572.172) -- 0:00:22
507000 -- (-574.416) [-573.506] (-572.125) (-571.809) * (-575.204) (-572.873) (-571.995) [-572.169] -- 0:00:22
507500 -- [-573.310] (-571.720) (-573.138) (-571.615) * (-572.394) (-571.461) (-571.452) [-573.219] -- 0:00:22
508000 -- [-573.400] (-572.492) (-572.998) (-572.985) * (-573.494) (-574.134) (-572.799) [-573.553] -- 0:00:22
508500 -- (-575.810) [-571.853] (-573.662) (-573.469) * [-571.199] (-573.802) (-575.817) (-571.412) -- 0:00:22
509000 -- (-572.867) (-572.127) [-574.742] (-576.266) * (-578.249) (-571.418) [-572.535] (-575.946) -- 0:00:23
509500 -- (-574.238) (-574.048) (-573.865) [-573.662] * (-573.686) (-571.466) [-574.708] (-574.416) -- 0:00:23
510000 -- (-570.882) (-573.195) [-573.517] (-573.265) * (-573.924) (-571.769) (-573.665) [-575.036] -- 0:00:23
Average standard deviation of split frequencies: 0.016616
510500 -- (-572.080) (-578.209) (-572.963) [-573.139] * [-573.511] (-573.761) (-574.523) (-572.043) -- 0:00:23
511000 -- (-572.639) (-573.366) [-572.783] (-577.248) * (-574.647) (-572.489) (-574.216) [-572.970] -- 0:00:22
511500 -- [-585.148] (-572.492) (-572.504) (-571.113) * (-571.904) (-572.396) [-573.953] (-572.481) -- 0:00:22
512000 -- (-571.531) (-573.234) [-578.229] (-572.136) * (-573.396) (-572.943) (-577.527) [-571.296] -- 0:00:22
512500 -- (-577.807) (-573.924) [-572.906] (-573.003) * (-576.391) [-572.227] (-576.812) (-575.955) -- 0:00:22
513000 -- [-572.207] (-573.183) (-575.564) (-572.930) * (-572.236) (-571.893) (-574.398) [-572.725] -- 0:00:22
513500 -- (-573.773) (-573.016) [-574.306] (-574.731) * [-572.114] (-573.722) (-579.505) (-571.656) -- 0:00:22
514000 -- [-572.460] (-572.793) (-572.347) (-574.061) * (-572.347) (-576.901) (-574.185) [-572.910] -- 0:00:22
514500 -- (-575.706) (-574.713) (-573.043) [-572.113] * (-574.516) [-573.109] (-579.342) (-573.626) -- 0:00:22
515000 -- (-573.040) (-573.768) [-573.323] (-571.368) * [-572.994] (-572.667) (-575.344) (-571.884) -- 0:00:22
Average standard deviation of split frequencies: 0.017053
515500 -- (-573.848) (-572.713) [-572.536] (-571.117) * [-572.238] (-572.848) (-574.473) (-574.600) -- 0:00:22
516000 -- [-571.614] (-572.097) (-573.138) (-572.386) * [-572.356] (-574.597) (-573.428) (-577.122) -- 0:00:22
516500 -- (-571.903) [-573.015] (-577.079) (-574.085) * (-577.707) (-572.477) [-577.094] (-574.266) -- 0:00:22
517000 -- (-573.094) (-572.511) (-573.912) [-572.637] * (-579.116) [-573.226] (-574.048) (-572.011) -- 0:00:22
517500 -- (-575.259) (-573.995) (-572.358) [-575.012] * (-577.712) (-572.437) [-573.747] (-571.950) -- 0:00:22
518000 -- (-573.772) (-572.161) (-573.295) [-577.163] * (-574.489) (-573.006) (-574.168) [-572.458] -- 0:00:22
518500 -- (-572.436) [-572.465] (-574.081) (-576.957) * (-573.342) [-572.892] (-572.716) (-573.963) -- 0:00:22
519000 -- (-573.058) (-571.745) [-574.910] (-575.999) * (-571.743) (-575.004) [-574.644] (-572.286) -- 0:00:22
519500 -- (-571.331) (-572.644) [-572.956] (-572.280) * (-572.631) (-572.508) (-575.114) [-572.066] -- 0:00:22
520000 -- (-573.540) [-573.427] (-575.982) (-572.907) * [-573.402] (-571.576) (-577.821) (-573.240) -- 0:00:22
Average standard deviation of split frequencies: 0.016901
520500 -- (-575.019) [-573.651] (-574.412) (-576.944) * (-573.251) (-573.806) (-576.183) [-574.364] -- 0:00:22
521000 -- (-576.398) (-571.934) [-577.174] (-577.613) * (-573.030) (-573.173) (-574.960) [-571.965] -- 0:00:22
521500 -- [-573.363] (-572.758) (-577.769) (-573.120) * (-571.642) [-575.641] (-571.416) (-572.659) -- 0:00:22
522000 -- (-574.430) (-575.225) (-575.838) [-571.540] * (-573.499) (-574.218) [-572.472] (-577.699) -- 0:00:21
522500 -- [-571.586] (-572.989) (-570.918) (-572.940) * (-573.959) (-577.943) [-572.733] (-574.646) -- 0:00:21
523000 -- (-575.754) (-571.811) [-576.869] (-572.298) * [-572.027] (-573.779) (-573.865) (-571.044) -- 0:00:21
523500 -- (-572.247) (-571.956) (-573.909) [-573.059] * [-572.233] (-573.035) (-576.045) (-571.337) -- 0:00:21
524000 -- (-572.078) [-572.192] (-576.314) (-571.988) * (-571.356) [-572.951] (-574.742) (-574.825) -- 0:00:21
524500 -- (-573.510) [-572.913] (-578.841) (-572.635) * (-576.181) (-575.991) (-573.212) [-573.394] -- 0:00:21
525000 -- (-573.384) (-574.958) (-572.445) [-573.952] * (-574.962) (-574.543) [-578.437] (-573.640) -- 0:00:21
Average standard deviation of split frequencies: 0.016729
525500 -- (-576.748) (-571.614) [-575.819] (-571.030) * (-574.275) (-574.385) (-573.567) [-571.201] -- 0:00:21
526000 -- (-576.313) (-571.390) [-574.313] (-572.332) * (-573.265) [-572.506] (-573.469) (-571.552) -- 0:00:21
526500 -- [-571.984] (-572.939) (-574.939) (-572.313) * (-573.065) [-574.104] (-574.319) (-571.512) -- 0:00:21
527000 -- (-571.957) (-573.029) (-582.529) [-575.856] * (-572.262) (-573.279) [-573.514] (-573.592) -- 0:00:21
527500 -- (-573.960) (-571.160) (-573.142) [-573.503] * [-571.193] (-573.801) (-571.956) (-575.384) -- 0:00:21
528000 -- [-571.985] (-572.962) (-571.087) (-576.834) * (-573.809) (-572.231) [-572.580] (-574.682) -- 0:00:21
528500 -- (-571.807) (-576.011) [-571.617] (-571.218) * (-576.786) (-573.685) [-572.008] (-577.508) -- 0:00:21
529000 -- (-571.514) (-572.361) [-571.073] (-571.697) * (-575.193) (-573.778) (-572.312) [-573.086] -- 0:00:21
529500 -- (-572.015) (-576.342) (-571.868) [-572.767] * [-575.516] (-574.905) (-573.520) (-575.309) -- 0:00:21
530000 -- (-573.624) [-573.598] (-573.170) (-571.362) * (-575.001) [-572.074] (-574.477) (-571.891) -- 0:00:21
Average standard deviation of split frequencies: 0.016582
530500 -- (-572.313) [-571.897] (-573.560) (-571.830) * (-573.347) (-572.680) [-573.858] (-571.499) -- 0:00:21
531000 -- (-573.286) (-573.335) [-572.131] (-573.503) * (-573.294) [-572.326] (-573.394) (-573.467) -- 0:00:21
531500 -- (-574.162) (-573.587) (-572.590) [-571.610] * (-571.757) [-573.470] (-574.955) (-571.345) -- 0:00:22
532000 -- (-573.121) (-573.693) [-571.994] (-574.811) * (-571.765) [-572.390] (-572.078) (-571.522) -- 0:00:21
532500 -- (-573.073) [-573.191] (-575.152) (-574.554) * (-571.391) [-573.480] (-571.208) (-572.906) -- 0:00:21
533000 -- (-571.975) (-572.929) (-579.829) [-573.776] * (-571.563) [-571.340] (-571.485) (-576.808) -- 0:00:21
533500 -- (-572.370) [-571.567] (-573.699) (-574.144) * (-572.087) [-571.530] (-573.431) (-574.298) -- 0:00:21
534000 -- [-571.679] (-574.448) (-576.424) (-575.779) * [-572.908] (-574.015) (-574.102) (-572.189) -- 0:00:21
534500 -- (-571.713) (-574.337) [-573.128] (-573.040) * (-575.814) (-571.497) (-573.706) [-572.025] -- 0:00:21
535000 -- [-572.866] (-579.769) (-573.268) (-571.642) * (-575.732) [-571.015] (-576.144) (-571.730) -- 0:00:21
Average standard deviation of split frequencies: 0.015831
535500 -- (-572.338) [-574.630] (-571.440) (-573.405) * [-572.627] (-573.756) (-575.947) (-571.779) -- 0:00:21
536000 -- (-571.143) [-574.747] (-578.724) (-572.819) * (-571.782) (-577.237) (-572.175) [-574.973] -- 0:00:21
536500 -- (-572.978) (-573.107) [-572.442] (-571.825) * (-574.962) [-571.915] (-573.240) (-572.231) -- 0:00:21
537000 -- [-577.536] (-572.504) (-575.442) (-575.801) * (-574.958) [-571.943] (-571.397) (-575.310) -- 0:00:21
537500 -- (-575.849) [-572.266] (-574.830) (-574.725) * (-573.707) [-572.197] (-572.525) (-574.238) -- 0:00:21
538000 -- (-576.211) (-572.295) [-571.350] (-571.437) * (-572.654) (-573.029) [-574.527] (-572.693) -- 0:00:21
538500 -- [-572.813] (-575.368) (-574.241) (-571.710) * (-571.750) (-572.511) [-572.874] (-574.936) -- 0:00:21
539000 -- (-572.628) (-574.910) [-577.037] (-573.424) * (-575.592) (-575.357) [-571.998] (-572.094) -- 0:00:21
539500 -- [-573.888] (-572.245) (-574.716) (-574.677) * (-572.325) (-571.847) (-572.140) [-570.745] -- 0:00:21
540000 -- [-571.906] (-572.230) (-575.486) (-572.996) * (-573.231) (-574.635) [-573.888] (-572.345) -- 0:00:21
Average standard deviation of split frequencies: 0.016275
540500 -- (-571.745) (-576.802) (-574.143) [-573.832] * [-572.334] (-571.481) (-573.147) (-574.974) -- 0:00:21
541000 -- (-575.310) (-574.292) (-578.078) [-573.425] * [-572.910] (-572.499) (-571.859) (-572.648) -- 0:00:21
541500 -- [-572.903] (-573.222) (-576.187) (-578.148) * (-573.140) [-572.725] (-573.209) (-571.311) -- 0:00:21
542000 -- (-575.980) [-571.560] (-573.437) (-571.849) * [-571.507] (-573.473) (-571.155) (-575.164) -- 0:00:21
542500 -- (-572.748) [-573.037] (-572.884) (-573.194) * (-573.390) (-571.689) (-572.658) [-574.752] -- 0:00:21
543000 -- (-572.155) [-573.602] (-573.144) (-573.155) * (-572.247) (-571.925) [-573.914] (-573.110) -- 0:00:21
543500 -- (-574.824) (-571.980) (-577.329) [-570.964] * [-572.047] (-573.299) (-572.464) (-573.077) -- 0:00:20
544000 -- (-572.048) (-571.892) (-573.881) [-574.018] * [-573.464] (-572.623) (-571.689) (-571.961) -- 0:00:20
544500 -- (-575.051) [-572.661] (-572.085) (-574.345) * [-571.310] (-571.888) (-574.071) (-579.785) -- 0:00:20
545000 -- [-573.684] (-572.434) (-575.576) (-576.198) * (-571.292) (-572.183) (-573.874) [-572.289] -- 0:00:20
Average standard deviation of split frequencies: 0.015541
545500 -- (-572.429) [-571.259] (-578.245) (-571.710) * (-571.463) [-573.268] (-573.961) (-571.564) -- 0:00:20
546000 -- [-571.248] (-574.230) (-572.688) (-571.695) * (-571.898) [-572.387] (-571.643) (-574.351) -- 0:00:20
546500 -- (-571.037) (-573.305) [-573.624] (-573.729) * (-572.423) (-572.743) (-571.272) [-571.604] -- 0:00:20
547000 -- (-573.430) (-571.743) [-575.714] (-571.749) * (-571.749) (-572.252) (-571.570) [-574.701] -- 0:00:20
547500 -- [-574.363] (-574.273) (-572.951) (-572.083) * [-572.570] (-575.038) (-575.052) (-573.749) -- 0:00:20
548000 -- (-572.838) [-572.520] (-572.814) (-575.442) * (-575.814) (-574.612) (-571.638) [-571.759] -- 0:00:20
548500 -- (-576.735) (-572.157) [-571.266] (-571.213) * (-571.299) (-574.797) [-571.909] (-574.557) -- 0:00:20
549000 -- (-578.095) (-572.396) [-571.560] (-573.971) * (-572.045) (-571.601) (-573.081) [-574.232] -- 0:00:20
549500 -- [-573.804] (-572.670) (-574.428) (-572.203) * (-574.805) [-573.416] (-573.254) (-576.411) -- 0:00:20
550000 -- [-578.300] (-572.065) (-575.573) (-572.308) * (-572.614) (-575.295) [-575.031] (-577.478) -- 0:00:20
Average standard deviation of split frequencies: 0.015980
550500 -- (-573.053) [-572.647] (-576.689) (-572.340) * (-572.327) [-571.863] (-574.893) (-575.473) -- 0:00:20
551000 -- (-574.120) [-572.490] (-573.852) (-571.328) * (-571.393) (-573.494) (-571.970) [-571.772] -- 0:00:20
551500 -- (-576.096) (-573.980) [-573.576] (-574.603) * (-573.783) (-574.580) (-573.208) [-572.124] -- 0:00:20
552000 -- (-572.693) (-571.209) (-576.694) [-573.334] * (-572.359) (-572.019) [-571.947] (-572.454) -- 0:00:20
552500 -- [-572.369] (-571.516) (-573.332) (-575.400) * (-573.101) (-572.174) (-572.330) [-574.045] -- 0:00:20
553000 -- (-573.338) [-573.598] (-574.580) (-574.550) * (-572.196) [-573.027] (-572.081) (-574.911) -- 0:00:20
553500 -- (-577.075) [-572.846] (-572.971) (-572.708) * [-571.000] (-571.309) (-577.803) (-574.283) -- 0:00:20
554000 -- (-571.720) (-573.989) [-573.553] (-573.657) * (-572.742) [-571.795] (-571.366) (-571.895) -- 0:00:20
554500 -- [-571.765] (-572.709) (-575.109) (-574.955) * (-575.937) [-571.967] (-572.204) (-573.948) -- 0:00:20
555000 -- (-571.528) (-574.862) [-574.174] (-573.753) * (-574.407) (-578.596) [-571.939] (-573.251) -- 0:00:20
Average standard deviation of split frequencies: 0.014696
555500 -- (-571.619) (-575.866) (-574.153) [-572.461] * (-573.336) (-572.079) [-572.784] (-578.493) -- 0:00:20
556000 -- (-574.786) (-574.817) (-571.927) [-571.495] * (-573.354) [-573.831] (-572.215) (-570.873) -- 0:00:20
556500 -- (-573.004) [-572.072] (-577.533) (-570.902) * [-575.105] (-575.287) (-572.187) (-572.403) -- 0:00:20
557000 -- (-572.239) (-572.959) (-573.053) [-572.921] * (-581.833) [-572.875] (-578.142) (-577.392) -- 0:00:20
557500 -- (-572.816) (-576.243) (-574.281) [-572.284] * (-574.320) (-571.848) [-571.183] (-572.306) -- 0:00:20
558000 -- (-574.731) (-575.224) [-572.060] (-572.444) * (-572.569) [-574.468] (-574.664) (-573.099) -- 0:00:20
558500 -- (-576.310) (-571.696) [-572.598] (-576.028) * (-575.178) (-576.690) (-573.710) [-572.569] -- 0:00:20
559000 -- (-572.243) [-573.691] (-572.546) (-573.367) * (-571.862) (-577.160) (-573.081) [-573.501] -- 0:00:20
559500 -- (-573.512) [-573.602] (-572.626) (-571.818) * [-571.694] (-577.995) (-576.308) (-572.273) -- 0:00:20
560000 -- (-570.772) [-572.546] (-571.636) (-571.236) * (-572.642) (-572.084) [-573.407] (-574.201) -- 0:00:20
Average standard deviation of split frequencies: 0.016816
560500 -- (-572.928) (-572.281) (-572.580) [-571.675] * [-573.212] (-576.079) (-574.549) (-575.114) -- 0:00:20
561000 -- (-579.237) (-572.132) (-572.207) [-571.291] * (-576.416) [-574.130] (-573.086) (-573.587) -- 0:00:20
561500 -- (-578.261) [-573.090] (-571.988) (-573.309) * (-575.593) (-571.345) [-573.763] (-571.403) -- 0:00:20
562000 -- (-573.115) [-573.867] (-573.369) (-571.674) * (-572.404) (-573.653) (-578.337) [-573.219] -- 0:00:20
562500 -- (-573.236) (-571.617) [-572.873] (-579.248) * (-573.611) (-570.936) (-571.781) [-574.432] -- 0:00:20
563000 -- (-572.862) [-572.477] (-572.962) (-579.235) * (-578.654) (-573.524) (-572.415) [-572.648] -- 0:00:20
563500 -- (-572.949) [-572.738] (-575.490) (-575.560) * (-572.244) [-572.130] (-571.499) (-575.308) -- 0:00:20
564000 -- (-572.980) [-574.125] (-571.568) (-574.497) * [-571.602] (-572.040) (-574.815) (-572.342) -- 0:00:20
564500 -- [-577.054] (-571.236) (-571.332) (-575.189) * (-571.898) (-572.901) [-576.750] (-572.218) -- 0:00:20
565000 -- (-576.915) (-574.525) [-570.761] (-572.766) * [-571.916] (-572.508) (-573.999) (-574.729) -- 0:00:20
Average standard deviation of split frequencies: 0.014436
565500 -- (-574.156) (-578.387) [-574.902] (-573.335) * (-571.147) (-573.128) (-571.833) [-572.885] -- 0:00:19
566000 -- (-573.227) (-573.136) (-572.895) [-571.709] * (-574.664) (-572.815) [-572.541] (-572.176) -- 0:00:19
566500 -- (-574.003) (-575.237) [-574.413] (-574.389) * (-572.110) (-574.826) (-572.075) [-571.455] -- 0:00:19
567000 -- (-573.921) (-573.570) (-578.299) [-570.712] * (-575.456) (-576.127) [-571.246] (-572.028) -- 0:00:19
567500 -- (-571.278) (-578.101) [-573.433] (-570.874) * (-572.805) (-573.516) (-573.609) [-574.671] -- 0:00:19
568000 -- [-574.154] (-577.559) (-574.039) (-571.433) * [-576.036] (-575.919) (-576.079) (-572.667) -- 0:00:19
568500 -- (-572.782) (-572.823) [-572.451] (-573.232) * (-574.797) (-571.787) [-574.941] (-572.114) -- 0:00:19
569000 -- (-576.450) (-573.545) (-571.879) [-572.923] * (-576.609) [-576.213] (-580.682) (-574.127) -- 0:00:19
569500 -- (-571.853) [-571.846] (-571.150) (-575.042) * (-571.558) (-576.694) (-574.294) [-572.751] -- 0:00:19
570000 -- (-577.146) (-577.030) (-571.803) [-575.086] * (-572.181) (-573.264) [-572.087] (-572.476) -- 0:00:19
Average standard deviation of split frequencies: 0.014869
570500 -- [-572.264] (-571.536) (-572.158) (-574.129) * (-584.152) (-574.025) [-572.279] (-575.532) -- 0:00:19
571000 -- (-571.873) [-572.169] (-571.129) (-573.296) * (-572.786) [-576.164] (-571.558) (-571.577) -- 0:00:19
571500 -- [-571.498] (-572.099) (-573.416) (-575.271) * (-574.691) (-572.766) [-573.075] (-571.478) -- 0:00:19
572000 -- [-572.347] (-576.070) (-575.678) (-573.009) * [-573.361] (-572.939) (-571.475) (-578.245) -- 0:00:19
572500 -- [-572.116] (-572.480) (-573.290) (-573.243) * (-573.363) (-571.919) [-574.916] (-572.372) -- 0:00:19
573000 -- (-571.918) (-572.440) (-578.031) [-576.135] * (-572.376) (-571.781) (-573.494) [-572.298] -- 0:00:19
573500 -- (-572.055) [-574.880] (-579.881) (-572.514) * (-572.140) (-575.210) (-573.082) [-575.289] -- 0:00:19
574000 -- (-574.283) (-572.280) (-576.698) [-574.556] * (-571.655) [-575.192] (-571.171) (-573.514) -- 0:00:19
574500 -- (-574.276) (-572.940) [-573.710] (-573.671) * (-574.563) (-573.015) [-571.186] (-575.094) -- 0:00:19
575000 -- (-572.045) (-574.377) (-573.273) [-573.506] * (-572.208) [-571.292] (-574.079) (-572.529) -- 0:00:19
Average standard deviation of split frequencies: 0.018005
575500 -- [-573.116] (-572.005) (-576.141) (-572.577) * (-572.125) (-571.986) [-571.796] (-576.188) -- 0:00:19
576000 -- [-573.692] (-576.196) (-572.613) (-577.759) * [-574.078] (-574.599) (-572.233) (-571.491) -- 0:00:19
576500 -- (-573.415) [-573.218] (-573.982) (-571.667) * (-572.557) (-574.031) (-571.299) [-572.118] -- 0:00:19
577000 -- (-573.536) (-572.866) [-574.344] (-574.664) * (-572.503) [-575.098] (-571.964) (-573.085) -- 0:00:19
577500 -- (-572.381) (-573.788) [-576.476] (-577.329) * (-571.709) (-573.267) [-573.069] (-571.144) -- 0:00:19
578000 -- (-578.580) (-573.238) [-573.748] (-573.966) * (-571.918) (-571.630) [-571.943] (-572.639) -- 0:00:19
578500 -- [-572.320] (-571.811) (-572.615) (-575.677) * [-572.217] (-576.117) (-573.418) (-571.652) -- 0:00:19
579000 -- (-573.637) (-574.812) (-575.091) [-573.549] * (-572.190) (-571.987) (-574.251) [-571.829] -- 0:00:19
579500 -- (-573.305) (-571.754) (-571.875) [-571.235] * [-577.227] (-574.280) (-573.230) (-571.881) -- 0:00:19
580000 -- (-575.431) (-573.950) [-572.275] (-571.553) * (-575.037) (-576.894) (-576.177) [-574.183] -- 0:00:19
Average standard deviation of split frequencies: 0.018943
580500 -- [-574.479] (-575.489) (-571.894) (-571.566) * (-573.589) (-575.871) (-574.670) [-574.313] -- 0:00:19
581000 -- [-572.590] (-575.654) (-576.268) (-574.712) * (-575.528) [-573.363] (-574.959) (-573.458) -- 0:00:19
581500 -- (-572.719) [-573.696] (-571.052) (-576.391) * [-574.385] (-572.362) (-576.021) (-571.263) -- 0:00:19
582000 -- (-572.195) (-573.789) (-579.749) [-571.822] * [-572.487] (-574.570) (-573.251) (-576.889) -- 0:00:19
582500 -- [-571.714] (-574.269) (-580.157) (-572.350) * [-572.141] (-577.297) (-574.568) (-576.844) -- 0:00:19
583000 -- (-580.159) (-574.107) (-574.853) [-573.809] * (-576.047) [-575.146] (-571.936) (-574.885) -- 0:00:19
583500 -- (-572.878) (-573.750) [-572.299] (-572.629) * (-575.305) (-574.215) (-574.694) [-573.060] -- 0:00:19
584000 -- (-572.344) [-575.118] (-571.545) (-571.920) * (-571.844) (-573.624) (-572.373) [-572.212] -- 0:00:19
584500 -- (-578.209) (-573.419) [-572.139] (-575.837) * (-575.419) [-572.069] (-577.141) (-573.507) -- 0:00:19
585000 -- (-572.384) (-573.805) (-574.611) [-573.992] * (-572.066) (-574.326) (-576.756) [-573.400] -- 0:00:19
Average standard deviation of split frequencies: 0.018234
585500 -- (-572.555) (-571.946) (-575.597) [-572.028] * (-576.218) (-572.241) (-574.531) [-573.592] -- 0:00:19
586000 -- (-572.764) (-577.402) [-575.659] (-571.656) * [-576.204] (-571.913) (-574.847) (-572.305) -- 0:00:19
586500 -- (-573.183) [-572.304] (-579.175) (-571.450) * (-573.726) (-574.714) [-572.220] (-572.292) -- 0:00:19
587000 -- [-572.086] (-575.037) (-571.665) (-572.221) * (-574.178) (-573.550) [-578.771] (-573.598) -- 0:00:18
587500 -- (-572.133) (-572.856) (-574.364) [-572.497] * (-570.947) (-576.554) (-575.291) [-577.762] -- 0:00:18
588000 -- [-572.726] (-573.333) (-573.848) (-574.631) * (-572.820) (-578.113) (-575.531) [-571.825] -- 0:00:18
588500 -- (-579.576) (-572.203) (-576.586) [-571.411] * [-572.418] (-572.369) (-576.886) (-572.132) -- 0:00:18
589000 -- (-575.363) (-572.572) [-574.454] (-571.754) * (-573.547) [-571.929] (-574.208) (-573.447) -- 0:00:18
589500 -- (-573.898) [-575.231] (-570.872) (-571.860) * [-572.196] (-573.633) (-574.130) (-573.814) -- 0:00:18
590000 -- (-571.859) [-571.132] (-579.921) (-574.267) * (-574.102) [-572.095] (-575.372) (-573.970) -- 0:00:18
Average standard deviation of split frequencies: 0.018090
590500 -- (-571.229) (-573.964) (-577.286) [-572.437] * (-572.488) (-571.691) (-571.103) [-573.148] -- 0:00:18
591000 -- [-572.061] (-576.299) (-572.703) (-574.123) * (-574.126) (-574.030) [-571.655] (-572.978) -- 0:00:18
591500 -- (-572.632) [-575.833] (-575.718) (-572.750) * (-573.829) [-572.620] (-571.852) (-572.387) -- 0:00:18
592000 -- (-573.594) (-571.655) [-573.561] (-575.373) * (-573.473) [-575.656] (-573.481) (-576.173) -- 0:00:18
592500 -- (-574.645) (-574.309) [-571.672] (-573.996) * [-573.023] (-574.388) (-574.801) (-571.776) -- 0:00:18
593000 -- (-576.385) (-574.349) [-573.170] (-571.688) * (-575.637) [-571.983] (-574.685) (-572.373) -- 0:00:18
593500 -- (-574.275) [-574.174] (-570.756) (-571.813) * (-573.956) [-574.335] (-572.049) (-574.647) -- 0:00:18
594000 -- (-572.397) (-573.964) [-571.066] (-573.167) * (-572.382) (-572.276) (-575.895) [-572.308] -- 0:00:18
594500 -- (-572.240) (-573.465) (-571.747) [-571.212] * (-571.686) (-573.227) [-571.910] (-571.814) -- 0:00:18
595000 -- (-571.625) [-572.991] (-574.346) (-575.094) * (-577.069) (-571.013) [-573.191] (-573.590) -- 0:00:18
Average standard deviation of split frequencies: 0.018983
595500 -- (-572.042) (-572.453) [-572.647] (-577.495) * (-573.535) [-571.834] (-572.201) (-571.908) -- 0:00:19
596000 -- [-571.424] (-572.854) (-572.722) (-574.158) * (-573.520) [-575.803] (-573.995) (-576.022) -- 0:00:18
596500 -- (-573.457) [-573.831] (-571.110) (-571.908) * (-571.473) (-571.750) (-574.636) [-572.837] -- 0:00:18
597000 -- (-570.868) (-571.528) [-571.962] (-572.680) * (-571.545) (-571.369) (-572.717) [-571.811] -- 0:00:18
597500 -- (-572.272) (-572.498) [-571.478] (-573.497) * (-573.370) [-573.778] (-574.128) (-571.141) -- 0:00:18
598000 -- [-572.633] (-573.067) (-574.333) (-574.160) * [-572.736] (-573.525) (-572.962) (-572.396) -- 0:00:18
598500 -- (-571.303) (-573.847) (-571.926) [-571.706] * [-574.734] (-579.615) (-572.108) (-578.516) -- 0:00:18
599000 -- (-572.142) [-576.309] (-571.486) (-573.059) * (-572.768) (-573.316) [-571.821] (-573.904) -- 0:00:18
599500 -- (-571.483) (-574.079) (-571.720) [-577.861] * (-572.483) [-571.165] (-571.070) (-576.026) -- 0:00:18
600000 -- (-572.063) (-575.175) [-571.738] (-572.597) * (-573.545) [-571.101] (-572.773) (-571.229) -- 0:00:18
Average standard deviation of split frequencies: 0.017789
600500 -- [-571.088] (-573.997) (-571.898) (-571.596) * [-574.386] (-574.079) (-573.760) (-573.544) -- 0:00:18
601000 -- (-570.951) [-572.423] (-573.800) (-577.094) * (-572.799) (-572.257) [-574.904] (-572.206) -- 0:00:18
601500 -- (-571.285) (-573.845) (-574.240) [-571.494] * (-575.089) [-572.288] (-571.689) (-578.154) -- 0:00:18
602000 -- (-573.345) (-573.307) (-573.547) [-573.159] * (-573.593) (-572.290) (-574.489) [-574.881] -- 0:00:18
602500 -- (-576.400) [-574.303] (-571.966) (-571.851) * (-571.912) (-574.089) (-578.166) [-572.205] -- 0:00:18
603000 -- (-576.133) [-572.736] (-571.692) (-575.507) * (-573.616) (-578.357) [-573.647] (-572.717) -- 0:00:18
603500 -- (-575.319) [-574.467] (-572.197) (-573.817) * (-578.247) (-578.585) [-573.190] (-574.057) -- 0:00:18
604000 -- (-571.113) (-572.225) [-573.958] (-572.613) * (-572.633) (-573.104) (-577.853) [-572.039] -- 0:00:18
604500 -- [-571.270] (-572.463) (-573.180) (-576.374) * [-573.755] (-572.819) (-572.526) (-574.186) -- 0:00:18
605000 -- (-574.338) [-573.204] (-571.105) (-576.231) * [-575.395] (-571.367) (-571.955) (-571.818) -- 0:00:18
Average standard deviation of split frequencies: 0.019188
605500 -- (-571.379) [-571.265] (-572.380) (-572.941) * (-579.458) [-571.640] (-574.834) (-575.153) -- 0:00:18
606000 -- [-571.660] (-571.550) (-573.764) (-572.116) * (-573.483) (-576.023) (-574.004) [-572.027] -- 0:00:18
606500 -- [-572.861] (-579.219) (-572.463) (-571.338) * (-571.503) (-573.571) (-574.542) [-574.753] -- 0:00:18
607000 -- (-575.473) [-574.644] (-574.327) (-571.900) * [-571.971] (-572.034) (-572.903) (-572.628) -- 0:00:18
607500 -- (-571.430) [-574.531] (-572.966) (-571.533) * (-574.596) (-571.278) [-577.270] (-575.492) -- 0:00:18
608000 -- (-573.440) (-573.254) [-572.962] (-572.662) * [-574.970] (-571.500) (-572.909) (-572.809) -- 0:00:18
608500 -- (-571.916) (-575.552) (-577.169) [-572.814] * (-571.906) [-572.222] (-572.665) (-572.555) -- 0:00:18
609000 -- (-572.138) (-573.699) (-571.443) [-574.287] * (-571.086) (-573.620) (-573.035) [-576.402] -- 0:00:17
609500 -- (-575.331) (-574.437) [-572.843] (-574.916) * (-573.496) (-578.022) (-575.133) [-576.558] -- 0:00:17
610000 -- [-572.105] (-571.415) (-572.090) (-572.930) * (-572.359) [-573.204] (-572.394) (-571.922) -- 0:00:17
Average standard deviation of split frequencies: 0.016983
610500 -- (-573.604) (-572.332) (-573.556) [-573.522] * (-571.882) (-575.658) (-575.260) [-571.828] -- 0:00:17
611000 -- [-574.157] (-572.940) (-572.515) (-572.009) * (-573.206) [-572.111] (-574.069) (-573.649) -- 0:00:17
611500 -- [-572.142] (-572.757) (-572.543) (-573.392) * (-575.820) (-574.422) (-574.542) [-571.851] -- 0:00:17
612000 -- (-571.369) (-572.928) (-578.184) [-572.433] * (-572.170) [-570.879] (-574.973) (-573.378) -- 0:00:17
612500 -- [-571.908] (-571.889) (-574.957) (-572.510) * (-571.234) (-572.690) (-574.474) [-575.305] -- 0:00:17
613000 -- [-570.881] (-571.957) (-577.442) (-571.619) * (-571.633) [-571.315] (-576.229) (-575.226) -- 0:00:17
613500 -- (-578.472) (-576.138) (-578.173) [-571.446] * [-572.145] (-571.918) (-572.589) (-574.359) -- 0:00:17
614000 -- (-572.570) (-575.822) (-572.902) [-572.623] * (-574.772) (-576.940) (-574.229) [-573.607] -- 0:00:17
614500 -- [-571.919] (-575.897) (-571.931) (-571.337) * (-575.727) (-573.344) [-574.497] (-572.374) -- 0:00:17
615000 -- [-573.819] (-575.384) (-572.581) (-573.099) * (-576.961) [-571.573] (-572.403) (-571.389) -- 0:00:17
Average standard deviation of split frequencies: 0.016836
615500 -- (-575.441) [-571.736] (-573.332) (-572.641) * [-574.502] (-571.742) (-572.904) (-571.963) -- 0:00:17
616000 -- (-573.024) [-571.940] (-571.470) (-572.267) * (-579.162) [-571.196] (-571.758) (-572.299) -- 0:00:18
616500 -- (-572.413) [-572.079] (-574.848) (-577.635) * (-574.415) (-573.969) [-571.876] (-573.441) -- 0:00:18
617000 -- (-572.702) (-573.581) [-573.882] (-574.754) * (-574.275) (-574.262) [-571.797] (-573.171) -- 0:00:18
617500 -- (-573.054) (-574.832) (-575.809) [-575.234] * (-578.302) (-574.321) [-571.384] (-573.066) -- 0:00:17
618000 -- [-573.187] (-575.214) (-574.315) (-575.301) * (-575.007) (-573.484) (-571.333) [-574.184] -- 0:00:17
618500 -- (-572.818) [-574.100] (-573.711) (-572.403) * [-574.230] (-572.796) (-573.144) (-571.889) -- 0:00:17
619000 -- (-572.609) [-574.431] (-574.081) (-572.990) * (-572.954) [-572.829] (-571.522) (-572.907) -- 0:00:17
619500 -- (-575.194) [-572.863] (-572.054) (-572.693) * (-574.459) (-572.837) (-571.912) [-574.435] -- 0:00:17
620000 -- (-574.420) [-571.454] (-572.453) (-573.184) * (-571.297) [-573.690] (-572.715) (-574.679) -- 0:00:17
Average standard deviation of split frequencies: 0.017722
620500 -- (-578.098) (-575.348) [-575.189] (-574.203) * [-574.036] (-572.329) (-574.617) (-572.431) -- 0:00:17
621000 -- (-576.404) [-573.072] (-572.548) (-578.296) * (-571.288) (-573.784) (-575.027) [-573.299] -- 0:00:17
621500 -- (-572.669) [-572.675] (-571.755) (-573.915) * (-571.971) (-578.630) (-576.245) [-577.862] -- 0:00:17
622000 -- (-572.455) (-572.852) [-571.182] (-576.002) * (-571.276) [-572.617] (-573.187) (-575.733) -- 0:00:17
622500 -- (-574.724) (-576.046) [-571.543] (-571.831) * (-574.538) [-571.450] (-571.127) (-573.028) -- 0:00:17
623000 -- (-572.357) (-575.302) (-572.614) [-572.702] * (-574.802) (-571.432) (-574.010) [-573.005] -- 0:00:17
623500 -- (-571.210) (-572.806) [-576.574] (-574.276) * (-576.406) (-573.663) [-571.202] (-571.772) -- 0:00:17
624000 -- (-571.003) [-571.452] (-572.369) (-571.226) * (-572.678) (-571.253) [-573.107] (-571.591) -- 0:00:17
624500 -- (-574.768) (-572.028) (-571.899) [-573.012] * (-580.463) [-572.013] (-572.465) (-573.728) -- 0:00:17
625000 -- (-574.460) [-571.656] (-573.504) (-571.256) * (-575.285) (-572.561) (-573.400) [-572.355] -- 0:00:17
Average standard deviation of split frequencies: 0.019077
625500 -- (-573.882) (-573.984) (-572.463) [-571.385] * [-572.194] (-572.387) (-574.185) (-571.401) -- 0:00:17
626000 -- (-572.311) (-575.513) [-571.906] (-572.459) * (-572.395) [-576.517] (-573.628) (-571.188) -- 0:00:17
626500 -- (-572.318) (-572.423) [-574.594] (-572.079) * (-572.497) [-570.988] (-572.672) (-571.616) -- 0:00:17
627000 -- (-578.398) (-574.844) (-573.994) [-571.330] * (-573.392) (-573.450) [-575.002] (-573.045) -- 0:00:17
627500 -- [-573.218] (-573.136) (-575.025) (-573.257) * (-572.795) (-572.569) [-572.342] (-576.063) -- 0:00:17
628000 -- (-574.321) (-571.236) [-573.220] (-571.356) * (-580.162) [-572.166] (-572.332) (-576.498) -- 0:00:17
628500 -- [-572.497] (-571.733) (-576.695) (-577.435) * [-574.047] (-572.859) (-572.117) (-575.556) -- 0:00:17
629000 -- [-572.818] (-573.136) (-572.532) (-571.610) * [-573.995] (-571.662) (-572.320) (-572.254) -- 0:00:17
629500 -- (-573.026) (-574.788) [-572.554] (-578.145) * [-578.502] (-572.701) (-572.789) (-572.260) -- 0:00:17
630000 -- (-571.322) (-576.884) [-572.221] (-573.627) * (-574.651) [-571.686] (-572.067) (-576.838) -- 0:00:17
Average standard deviation of split frequencies: 0.019933
630500 -- (-575.017) (-571.161) (-574.119) [-572.403] * (-574.076) (-576.932) (-572.051) [-577.590] -- 0:00:16
631000 -- (-572.216) (-573.924) [-574.891] (-574.306) * (-572.886) [-572.846] (-573.421) (-574.577) -- 0:00:16
631500 -- (-574.232) (-573.768) (-575.810) [-574.699] * (-573.552) (-573.574) (-573.612) [-572.508] -- 0:00:16
632000 -- [-576.930] (-573.463) (-572.624) (-575.393) * (-576.956) (-575.181) [-572.238] (-573.893) -- 0:00:16
632500 -- (-572.141) (-574.029) (-574.005) [-574.126] * [-572.444] (-573.074) (-576.569) (-575.820) -- 0:00:16
633000 -- [-574.895] (-574.295) (-573.920) (-576.321) * (-573.907) (-574.734) (-574.273) [-572.387] -- 0:00:16
633500 -- [-574.001] (-576.344) (-572.652) (-572.219) * (-573.794) (-575.037) [-573.619] (-576.667) -- 0:00:16
634000 -- (-574.702) (-576.740) (-572.751) [-571.916] * [-571.668] (-576.633) (-572.721) (-572.811) -- 0:00:16
634500 -- (-574.732) (-579.326) [-571.032] (-573.646) * [-572.927] (-571.742) (-572.621) (-573.146) -- 0:00:16
635000 -- [-572.411] (-572.293) (-572.509) (-573.249) * (-572.515) [-572.173] (-572.947) (-572.917) -- 0:00:16
Average standard deviation of split frequencies: 0.018777
635500 -- [-577.457] (-575.506) (-572.623) (-575.035) * (-570.893) (-572.134) [-572.097] (-572.757) -- 0:00:17
636000 -- [-574.461] (-574.989) (-571.583) (-570.969) * (-575.530) [-571.981] (-575.421) (-572.152) -- 0:00:17
636500 -- (-574.913) [-574.324] (-575.047) (-573.219) * (-571.991) [-574.068] (-576.880) (-573.316) -- 0:00:17
637000 -- (-572.237) (-573.839) [-574.872] (-571.709) * [-573.943] (-579.567) (-572.955) (-574.307) -- 0:00:17
637500 -- [-574.670] (-574.608) (-573.985) (-572.372) * (-571.380) (-573.269) (-573.419) [-572.699] -- 0:00:17
638000 -- (-573.135) [-574.136] (-572.523) (-574.585) * (-574.173) [-573.322] (-576.878) (-574.629) -- 0:00:17
638500 -- (-574.258) (-575.989) [-574.454] (-572.072) * (-574.518) (-571.481) (-575.409) [-574.048] -- 0:00:16
639000 -- (-572.063) [-574.014] (-574.908) (-573.897) * (-572.245) (-570.838) [-571.361] (-575.476) -- 0:00:16
639500 -- (-575.356) (-573.178) [-573.179] (-573.138) * (-572.351) (-572.778) (-574.062) [-573.587] -- 0:00:16
640000 -- (-575.682) (-573.006) (-571.473) [-571.561] * (-578.599) (-572.651) [-574.109] (-573.655) -- 0:00:16
Average standard deviation of split frequencies: 0.018150
640500 -- (-572.193) [-572.168] (-574.736) (-572.731) * (-574.607) [-573.437] (-572.094) (-573.112) -- 0:00:16
641000 -- (-572.982) [-570.943] (-575.241) (-573.815) * [-573.840] (-572.806) (-571.916) (-575.044) -- 0:00:16
641500 -- (-574.270) (-574.664) (-579.993) [-571.586] * (-572.096) (-574.538) [-574.566] (-573.616) -- 0:00:16
642000 -- [-573.246] (-577.564) (-572.662) (-573.950) * [-571.428] (-572.667) (-577.741) (-571.704) -- 0:00:16
642500 -- (-572.779) (-571.551) (-576.249) [-573.009] * [-572.626] (-572.297) (-571.835) (-576.353) -- 0:00:16
643000 -- [-571.869] (-572.937) (-573.900) (-572.842) * (-573.222) [-571.190] (-573.174) (-575.739) -- 0:00:16
643500 -- (-577.458) (-572.463) [-573.014] (-574.514) * (-574.795) (-572.219) (-573.336) [-573.687] -- 0:00:16
644000 -- [-572.100] (-571.239) (-572.856) (-575.080) * (-572.515) [-572.080] (-573.529) (-572.695) -- 0:00:16
644500 -- (-573.894) (-571.404) (-574.541) [-577.279] * (-571.391) (-573.012) [-571.949] (-572.124) -- 0:00:16
645000 -- (-573.981) [-572.647] (-572.268) (-572.459) * (-571.790) (-578.560) [-571.383] (-574.031) -- 0:00:16
Average standard deviation of split frequencies: 0.018486
645500 -- (-572.426) [-573.035] (-574.648) (-572.308) * (-574.663) (-574.058) (-574.538) [-574.922] -- 0:00:16
646000 -- (-574.880) (-573.914) [-571.148] (-572.208) * (-573.897) [-575.344] (-573.610) (-573.102) -- 0:00:16
646500 -- [-572.995] (-575.799) (-572.869) (-572.683) * (-573.139) [-571.434] (-572.628) (-572.823) -- 0:00:16
647000 -- [-573.346] (-578.081) (-573.314) (-574.559) * (-573.854) (-571.367) (-572.477) [-572.314] -- 0:00:16
647500 -- (-573.043) (-573.365) [-572.542] (-573.327) * (-575.901) (-573.536) (-571.649) [-575.135] -- 0:00:16
648000 -- (-573.516) (-574.367) [-575.964] (-572.842) * (-572.022) (-572.907) [-573.874] (-572.907) -- 0:00:16
648500 -- (-574.482) [-570.991] (-572.758) (-573.115) * (-574.831) (-574.783) (-574.095) [-573.166] -- 0:00:16
649000 -- (-572.342) (-571.382) (-574.747) [-571.359] * (-572.589) (-571.017) (-572.732) [-573.023] -- 0:00:16
649500 -- (-572.243) (-574.258) (-573.768) [-571.353] * [-572.442] (-572.100) (-572.465) (-573.375) -- 0:00:16
650000 -- (-576.991) [-574.486] (-572.544) (-575.905) * (-571.988) (-571.839) (-572.683) [-574.664] -- 0:00:16
Average standard deviation of split frequencies: 0.019320
650500 -- [-573.834] (-575.463) (-573.584) (-578.559) * (-572.237) [-574.264] (-571.872) (-571.484) -- 0:00:16
651000 -- (-573.039) [-574.590] (-572.291) (-574.152) * (-573.488) [-574.820] (-572.044) (-574.127) -- 0:00:16
651500 -- [-576.380] (-574.031) (-573.148) (-572.002) * [-573.691] (-574.744) (-573.178) (-572.537) -- 0:00:16
652000 -- (-572.742) (-572.757) (-576.539) [-573.567] * [-572.367] (-574.442) (-572.643) (-573.007) -- 0:00:16
652500 -- (-573.418) (-573.627) (-572.227) [-572.473] * (-572.357) (-573.985) (-572.037) [-571.172] -- 0:00:15
653000 -- (-572.513) (-577.144) (-571.194) [-577.179] * (-575.027) (-573.665) [-573.964] (-572.539) -- 0:00:15
653500 -- (-574.072) (-572.719) [-573.359] (-574.375) * [-576.941] (-573.666) (-575.506) (-573.197) -- 0:00:15
654000 -- (-574.260) [-577.985] (-571.300) (-572.949) * [-571.350] (-574.713) (-576.117) (-573.782) -- 0:00:15
654500 -- (-573.673) [-574.820] (-579.749) (-571.927) * (-575.123) [-572.849] (-571.955) (-576.461) -- 0:00:15
655000 -- [-573.471] (-574.458) (-572.667) (-574.709) * [-573.474] (-572.832) (-573.794) (-574.731) -- 0:00:15
Average standard deviation of split frequencies: 0.016767
655500 -- [-574.859] (-573.070) (-576.331) (-572.011) * (-572.682) (-571.843) [-571.976] (-573.618) -- 0:00:15
656000 -- (-572.023) [-571.564] (-575.326) (-574.220) * (-571.760) [-575.876] (-573.989) (-574.174) -- 0:00:15
656500 -- [-571.919] (-572.572) (-575.404) (-571.766) * [-574.086] (-572.498) (-572.953) (-572.810) -- 0:00:15
657000 -- [-572.713] (-572.446) (-577.706) (-572.804) * [-571.368] (-571.984) (-574.569) (-573.093) -- 0:00:15
657500 -- (-571.835) [-573.388] (-574.927) (-572.969) * (-573.911) (-573.714) [-572.701] (-575.352) -- 0:00:15
658000 -- [-572.600] (-572.337) (-573.001) (-572.153) * (-573.240) (-573.004) [-572.281] (-575.038) -- 0:00:15
658500 -- (-579.986) (-574.835) [-572.866] (-571.310) * (-574.998) (-573.118) [-572.419] (-576.090) -- 0:00:16
659000 -- (-574.568) [-573.396] (-574.459) (-575.947) * (-572.777) (-572.872) [-572.025] (-574.769) -- 0:00:16
659500 -- (-572.037) (-575.330) (-572.672) [-572.420] * [-573.221] (-571.928) (-573.045) (-573.143) -- 0:00:16
660000 -- [-573.565] (-572.837) (-574.629) (-573.508) * (-571.130) [-571.880] (-572.678) (-571.266) -- 0:00:15
Average standard deviation of split frequencies: 0.019027
660500 -- [-575.463] (-572.006) (-574.157) (-571.440) * (-572.380) (-572.369) (-574.882) [-571.856] -- 0:00:15
661000 -- (-573.450) (-572.252) [-572.298] (-572.379) * (-572.807) (-572.777) (-572.660) [-574.067] -- 0:00:15
661500 -- (-575.378) (-571.946) [-573.342] (-573.416) * (-575.517) (-573.515) [-572.489] (-573.914) -- 0:00:15
662000 -- (-572.914) (-571.788) (-571.650) [-574.267] * (-571.801) (-572.616) [-571.701] (-578.550) -- 0:00:15
662500 -- (-572.484) (-572.288) (-573.716) [-572.500] * [-574.406] (-573.045) (-571.315) (-576.475) -- 0:00:15
663000 -- [-573.663] (-572.233) (-572.639) (-571.180) * (-575.980) (-574.064) [-574.802] (-577.511) -- 0:00:15
663500 -- (-576.862) [-572.602] (-573.722) (-572.399) * (-572.565) (-572.078) (-571.984) [-573.549] -- 0:00:15
664000 -- (-572.674) (-572.168) (-572.223) [-572.189] * (-572.152) (-572.166) (-573.111) [-572.569] -- 0:00:15
664500 -- (-571.996) (-576.870) [-571.768] (-574.283) * [-572.747] (-572.488) (-578.778) (-571.274) -- 0:00:15
665000 -- [-571.184] (-578.573) (-573.663) (-572.787) * (-575.775) (-573.230) (-575.748) [-571.851] -- 0:00:15
Average standard deviation of split frequencies: 0.018403
665500 -- (-571.901) (-576.032) (-572.562) [-573.754] * [-574.261] (-573.053) (-574.062) (-580.639) -- 0:00:15
666000 -- (-572.192) (-574.105) [-572.493] (-574.799) * (-573.228) (-570.893) [-572.942] (-574.249) -- 0:00:15
666500 -- (-577.040) (-572.888) [-572.347] (-573.258) * (-571.214) [-576.031] (-573.313) (-576.758) -- 0:00:15
667000 -- (-571.672) (-578.134) [-572.090] (-577.070) * (-571.717) (-574.797) (-573.599) [-575.605] -- 0:00:15
667500 -- (-575.976) (-573.711) (-572.482) [-571.970] * (-573.581) (-577.141) (-571.432) [-572.182] -- 0:00:15
668000 -- (-572.291) (-574.403) (-572.950) [-571.877] * [-572.240] (-572.572) (-576.037) (-572.090) -- 0:00:15
668500 -- (-576.299) (-571.904) (-572.792) [-571.825] * (-573.947) (-576.123) (-570.871) [-575.230] -- 0:00:15
669000 -- (-572.850) (-571.599) (-576.057) [-573.462] * (-575.196) (-576.127) (-574.695) [-576.931] -- 0:00:15
669500 -- (-573.137) [-572.959] (-572.999) (-574.063) * [-572.376] (-577.239) (-574.927) (-573.544) -- 0:00:15
670000 -- (-574.130) (-573.817) (-571.245) [-571.372] * (-573.080) [-572.583] (-574.712) (-575.514) -- 0:00:15
Average standard deviation of split frequencies: 0.017807
670500 -- (-571.671) (-576.150) (-571.431) [-572.312] * (-573.997) [-571.297] (-574.135) (-572.494) -- 0:00:15
671000 -- (-572.821) (-573.796) [-571.469] (-573.316) * (-573.520) [-571.797] (-571.646) (-573.157) -- 0:00:15
671500 -- (-574.225) (-571.282) [-571.855] (-574.918) * (-572.949) (-572.885) (-573.724) [-578.123] -- 0:00:15
672000 -- (-573.002) [-577.644] (-571.362) (-572.335) * [-571.737] (-572.005) (-571.934) (-575.146) -- 0:00:15
672500 -- (-571.446) (-575.136) (-572.415) [-571.512] * [-572.740] (-571.770) (-573.671) (-573.876) -- 0:00:15
673000 -- (-573.663) (-574.803) (-573.349) [-572.911] * (-570.938) (-572.829) (-572.730) [-574.776] -- 0:00:15
673500 -- (-572.003) (-572.545) (-573.421) [-572.103] * [-572.051] (-571.164) (-573.063) (-580.421) -- 0:00:15
674000 -- (-573.020) [-573.735] (-574.536) (-573.112) * (-574.236) [-572.762] (-573.489) (-576.267) -- 0:00:14
674500 -- (-573.439) (-571.697) [-574.362] (-575.676) * (-572.920) (-572.967) [-571.958] (-575.735) -- 0:00:14
675000 -- [-572.692] (-573.368) (-573.842) (-577.877) * [-573.359] (-573.942) (-574.367) (-573.592) -- 0:00:14
Average standard deviation of split frequencies: 0.018131
675500 -- [-577.236] (-574.092) (-575.060) (-572.963) * (-573.723) (-576.223) (-572.702) [-573.248] -- 0:00:14
676000 -- (-572.567) [-571.900] (-572.810) (-571.958) * (-571.476) (-576.944) (-572.325) [-572.324] -- 0:00:14
676500 -- (-574.414) (-573.562) [-571.352] (-574.384) * [-571.538] (-574.143) (-571.374) (-572.617) -- 0:00:14
677000 -- (-572.870) [-571.964] (-572.981) (-571.873) * [-571.528] (-576.131) (-571.550) (-573.106) -- 0:00:14
677500 -- (-574.106) [-572.886] (-573.215) (-573.587) * (-572.488) (-574.739) (-573.847) [-572.065] -- 0:00:14
678000 -- (-573.473) (-575.520) (-571.797) [-573.778] * (-571.684) [-571.296] (-575.204) (-573.800) -- 0:00:14
678500 -- (-575.181) (-573.467) (-571.502) [-571.804] * (-575.154) [-572.197] (-572.018) (-576.822) -- 0:00:14
679000 -- (-575.433) (-571.221) [-573.026] (-572.820) * [-579.368] (-577.357) (-573.108) (-573.577) -- 0:00:14
679500 -- (-572.620) [-575.189] (-572.935) (-571.462) * (-574.754) (-573.425) (-573.552) [-574.067] -- 0:00:14
680000 -- (-574.582) [-572.637] (-573.700) (-572.766) * (-574.032) (-573.170) [-571.994] (-573.819) -- 0:00:14
Average standard deviation of split frequencies: 0.018007
680500 -- (-572.396) (-574.027) (-571.956) [-573.112] * (-572.492) (-573.798) [-571.834] (-573.404) -- 0:00:15
681000 -- (-574.878) (-574.401) (-578.854) [-572.438] * [-571.979] (-574.723) (-576.304) (-580.259) -- 0:00:14
681500 -- (-572.443) (-572.990) [-575.015] (-575.756) * (-571.177) [-575.221] (-571.962) (-579.528) -- 0:00:14
682000 -- (-575.266) (-573.700) [-572.665] (-573.561) * (-571.156) (-571.336) (-571.111) [-574.904] -- 0:00:14
682500 -- [-573.372] (-574.821) (-574.363) (-573.125) * (-573.829) (-571.142) [-573.769] (-575.501) -- 0:00:14
683000 -- (-571.711) [-572.557] (-572.595) (-572.297) * (-572.239) (-571.437) [-572.115] (-575.574) -- 0:00:14
683500 -- [-572.265] (-572.272) (-572.426) (-572.608) * [-574.655] (-574.198) (-577.440) (-572.087) -- 0:00:14
684000 -- [-572.022] (-573.228) (-571.677) (-575.025) * (-574.490) [-575.612] (-572.031) (-572.084) -- 0:00:14
684500 -- (-571.901) (-572.493) (-571.984) [-574.030] * (-574.694) (-571.604) (-576.554) [-572.151] -- 0:00:14
685000 -- (-573.427) [-573.883] (-572.623) (-571.535) * (-572.494) (-572.692) (-573.550) [-571.948] -- 0:00:14
Average standard deviation of split frequencies: 0.019241
685500 -- (-571.618) [-572.930] (-575.022) (-572.757) * (-571.862) [-574.196] (-571.201) (-575.209) -- 0:00:14
686000 -- (-574.072) (-573.857) [-573.549] (-572.098) * [-574.333] (-572.105) (-573.535) (-575.593) -- 0:00:14
686500 -- (-574.773) (-574.057) (-574.360) [-577.118] * (-572.089) [-572.071] (-576.785) (-570.865) -- 0:00:14
687000 -- (-573.011) (-574.344) [-572.439] (-573.470) * (-575.665) (-572.510) (-576.548) [-571.987] -- 0:00:14
687500 -- (-573.341) (-572.851) [-573.341] (-576.339) * (-573.588) (-573.146) [-571.439] (-573.287) -- 0:00:14
688000 -- (-574.883) [-572.914] (-575.028) (-579.162) * (-573.305) (-571.504) [-574.188] (-574.476) -- 0:00:14
688500 -- (-572.119) (-572.937) (-572.093) [-572.867] * (-574.657) [-572.779] (-574.471) (-571.845) -- 0:00:14
689000 -- [-571.839] (-572.388) (-577.530) (-574.524) * (-574.067) [-573.104] (-574.983) (-573.161) -- 0:00:14
689500 -- [-571.931] (-574.753) (-572.762) (-573.289) * [-572.065] (-572.558) (-575.917) (-572.777) -- 0:00:14
690000 -- [-572.113] (-572.852) (-577.020) (-576.146) * [-571.652] (-572.879) (-574.834) (-572.255) -- 0:00:14
Average standard deviation of split frequencies: 0.021386
690500 -- (-572.039) (-572.522) (-573.369) [-572.869] * (-573.406) (-571.968) [-573.026] (-571.624) -- 0:00:14
691000 -- (-574.979) [-573.245] (-573.377) (-572.182) * [-573.672] (-572.964) (-572.068) (-573.827) -- 0:00:14
691500 -- [-573.035] (-575.853) (-574.504) (-571.607) * (-575.397) (-578.319) [-572.577] (-573.883) -- 0:00:14
692000 -- (-574.646) (-575.168) [-573.257] (-572.236) * (-574.717) (-572.382) [-573.539] (-572.276) -- 0:00:14
692500 -- (-572.723) [-573.421] (-572.891) (-571.107) * (-574.254) [-573.767] (-575.788) (-572.242) -- 0:00:14
693000 -- (-573.798) [-576.836] (-572.331) (-571.838) * (-572.975) [-571.047] (-572.492) (-576.511) -- 0:00:14
693500 -- (-572.450) (-571.402) (-571.838) [-576.662] * (-573.499) (-573.480) (-571.625) [-571.605] -- 0:00:14
694000 -- (-571.254) (-572.291) (-572.110) [-572.239] * (-574.264) (-571.593) (-573.307) [-571.264] -- 0:00:14
694500 -- [-571.112] (-572.315) (-571.272) (-571.885) * (-572.634) [-571.706] (-572.885) (-573.991) -- 0:00:14
695000 -- [-572.598] (-574.836) (-573.707) (-574.228) * (-572.398) [-574.889] (-573.400) (-576.720) -- 0:00:14
Average standard deviation of split frequencies: 0.021222
695500 -- (-574.542) [-574.379] (-577.577) (-572.831) * (-571.451) (-571.597) (-574.255) [-572.207] -- 0:00:14
696000 -- (-573.531) (-575.221) [-573.186] (-573.047) * (-574.720) (-571.406) [-571.272] (-572.767) -- 0:00:13
696500 -- (-573.606) [-573.533] (-574.814) (-574.721) * (-575.315) (-572.951) (-572.526) [-574.837] -- 0:00:13
697000 -- [-572.604] (-577.170) (-575.872) (-573.132) * (-572.811) [-573.473] (-571.983) (-571.939) -- 0:00:13
697500 -- (-572.016) (-573.549) [-571.293] (-573.666) * [-575.286] (-575.440) (-573.476) (-572.416) -- 0:00:13
698000 -- (-575.222) (-571.429) (-575.338) [-572.274] * (-575.371) (-572.134) [-573.269] (-573.560) -- 0:00:13
698500 -- (-571.804) (-572.127) [-576.188] (-577.493) * (-573.104) (-572.387) [-571.064] (-572.172) -- 0:00:13
699000 -- [-573.699] (-572.970) (-572.661) (-573.438) * (-576.274) (-574.060) (-576.813) [-572.948] -- 0:00:13
699500 -- (-572.096) (-572.660) (-571.964) [-572.816] * (-574.077) [-574.090] (-574.765) (-574.789) -- 0:00:13
700000 -- (-573.472) (-573.793) [-571.543] (-571.436) * [-575.641] (-573.950) (-571.870) (-573.868) -- 0:00:13
Average standard deviation of split frequencies: 0.020632
700500 -- (-576.379) (-575.668) (-571.554) [-571.839] * (-571.746) [-572.128] (-576.595) (-575.463) -- 0:00:13
701000 -- (-573.223) (-571.395) (-570.998) [-572.914] * (-572.218) [-571.896] (-572.623) (-574.716) -- 0:00:14
701500 -- (-574.874) (-572.200) (-571.004) [-574.594] * [-574.693] (-577.939) (-573.785) (-571.551) -- 0:00:14
702000 -- (-572.857) (-571.291) [-570.949] (-574.795) * [-571.747] (-576.247) (-574.146) (-574.054) -- 0:00:14
702500 -- (-572.938) (-572.588) (-573.613) [-572.949] * [-574.517] (-576.603) (-571.611) (-572.928) -- 0:00:13
703000 -- (-577.345) (-572.883) (-574.426) [-571.464] * (-574.634) [-581.231] (-576.733) (-572.583) -- 0:00:13
703500 -- (-575.654) [-571.910] (-573.698) (-575.197) * [-572.603] (-572.974) (-571.877) (-573.220) -- 0:00:13
704000 -- (-576.695) (-576.949) [-574.074] (-572.618) * (-574.505) (-571.952) (-571.913) [-571.178] -- 0:00:13
704500 -- (-574.334) (-577.845) [-571.540] (-573.504) * (-573.143) (-574.930) [-572.326] (-571.997) -- 0:00:13
705000 -- [-573.014] (-571.378) (-573.384) (-572.436) * [-572.042] (-576.098) (-571.893) (-576.172) -- 0:00:13
Average standard deviation of split frequencies: 0.020922
705500 -- (-572.806) (-573.520) (-572.562) [-574.421] * (-574.680) [-573.743] (-575.011) (-571.580) -- 0:00:13
706000 -- (-573.913) (-574.492) [-574.052] (-571.402) * [-575.987] (-571.296) (-577.954) (-573.031) -- 0:00:13
706500 -- [-573.109] (-578.083) (-571.846) (-574.454) * (-572.424) (-575.548) [-573.377] (-573.422) -- 0:00:13
707000 -- (-572.391) [-581.543] (-573.002) (-572.411) * (-572.473) [-574.209] (-574.042) (-573.727) -- 0:00:13
707500 -- [-575.328] (-583.156) (-574.253) (-572.168) * (-572.257) [-571.968] (-574.418) (-572.558) -- 0:00:13
708000 -- (-574.644) (-573.774) [-574.640] (-571.728) * [-575.189] (-572.706) (-572.785) (-575.638) -- 0:00:13
708500 -- (-573.459) [-573.796] (-572.311) (-572.601) * (-572.621) (-574.118) (-573.263) [-572.770] -- 0:00:13
709000 -- (-575.664) (-571.145) (-575.406) [-572.951] * [-572.088] (-573.922) (-572.036) (-573.919) -- 0:00:13
709500 -- (-574.684) (-571.841) [-572.672] (-573.334) * (-572.142) (-572.883) (-579.683) [-572.076] -- 0:00:13
710000 -- [-571.527] (-571.884) (-574.747) (-574.645) * (-572.326) (-573.028) (-573.996) [-572.094] -- 0:00:13
Average standard deviation of split frequencies: 0.019458
710500 -- (-572.698) (-572.848) [-575.013] (-574.877) * (-572.115) [-573.179] (-572.400) (-572.692) -- 0:00:13
711000 -- (-571.341) [-571.124] (-571.740) (-575.533) * (-574.081) [-574.598] (-575.496) (-575.459) -- 0:00:13
711500 -- (-573.038) (-572.071) (-575.224) [-573.504] * (-575.493) (-574.751) (-573.401) [-574.116] -- 0:00:13
712000 -- (-576.540) (-572.194) (-571.153) [-572.600] * (-572.892) [-577.793] (-572.123) (-571.545) -- 0:00:13
712500 -- (-576.188) [-571.669] (-572.353) (-575.597) * [-573.721] (-571.991) (-573.319) (-576.477) -- 0:00:13
713000 -- [-572.961] (-571.509) (-578.893) (-572.230) * [-572.387] (-573.046) (-574.393) (-573.007) -- 0:00:13
713500 -- (-572.729) [-574.779] (-572.819) (-574.564) * (-574.873) (-571.587) [-574.367] (-574.620) -- 0:00:13
714000 -- (-571.745) (-572.119) (-574.346) [-574.288] * (-571.592) (-574.845) (-575.231) [-575.629] -- 0:00:13
714500 -- (-572.945) (-572.466) (-573.995) [-572.355] * (-573.721) (-572.536) (-572.228) [-573.093] -- 0:00:13
715000 -- (-574.351) (-571.650) [-571.232] (-571.060) * (-571.847) [-572.887] (-571.586) (-574.395) -- 0:00:13
Average standard deviation of split frequencies: 0.019752
715500 -- (-580.069) (-572.086) [-572.092] (-574.589) * (-571.759) [-571.344] (-574.426) (-572.624) -- 0:00:13
716000 -- (-574.097) (-571.678) [-571.617] (-575.692) * [-572.172] (-572.636) (-574.577) (-571.477) -- 0:00:13
716500 -- (-572.774) (-577.461) [-572.072] (-573.857) * (-571.597) (-572.591) [-574.699] (-571.875) -- 0:00:13
717000 -- (-575.682) [-572.757] (-575.745) (-574.735) * [-572.913] (-571.172) (-575.857) (-573.006) -- 0:00:13
717500 -- (-572.613) (-573.431) (-572.128) [-571.941] * (-575.138) (-571.953) [-571.271] (-572.458) -- 0:00:12
718000 -- [-572.548] (-576.428) (-571.862) (-572.098) * (-571.430) (-575.162) (-571.405) [-572.422] -- 0:00:12
718500 -- (-573.317) (-573.968) [-574.221] (-578.897) * (-574.744) (-572.334) [-570.778] (-573.126) -- 0:00:12
719000 -- (-574.402) (-573.209) (-573.175) [-574.819] * [-571.596] (-571.432) (-573.520) (-571.700) -- 0:00:12
719500 -- (-572.407) (-571.229) [-571.748] (-571.434) * (-574.264) (-575.534) (-572.539) [-572.857] -- 0:00:12
720000 -- (-571.396) [-572.301] (-573.027) (-576.673) * (-576.782) [-572.264] (-576.351) (-574.763) -- 0:00:12
Average standard deviation of split frequencies: 0.020060
720500 -- (-572.252) (-572.262) (-574.515) [-573.341] * (-571.924) (-572.933) (-573.010) [-572.096] -- 0:00:12
721000 -- (-574.399) (-573.754) [-573.758] (-573.671) * (-579.865) (-572.850) (-573.764) [-572.002] -- 0:00:12
721500 -- (-574.634) [-575.149] (-571.913) (-575.358) * [-573.941] (-574.859) (-577.923) (-571.087) -- 0:00:12
722000 -- [-573.967] (-572.563) (-573.977) (-572.692) * [-572.673] (-573.938) (-573.183) (-575.828) -- 0:00:12
722500 -- (-574.140) (-573.406) [-574.260] (-571.262) * (-575.873) [-573.527] (-577.508) (-572.878) -- 0:00:12
723000 -- (-573.229) [-573.989] (-577.075) (-573.680) * (-574.814) [-571.745] (-572.791) (-571.071) -- 0:00:13
723500 -- [-572.813] (-574.468) (-578.621) (-572.001) * (-575.741) (-574.416) [-575.701] (-573.429) -- 0:00:12
724000 -- (-572.434) [-571.638] (-573.339) (-571.937) * (-576.335) (-573.770) (-574.292) [-577.256] -- 0:00:12
724500 -- (-574.195) (-572.942) (-577.753) [-572.864] * (-573.107) [-572.312] (-575.886) (-574.616) -- 0:00:12
725000 -- (-573.342) (-574.198) (-579.007) [-572.631] * (-576.019) [-571.679] (-574.160) (-571.996) -- 0:00:12
Average standard deviation of split frequencies: 0.020778
725500 -- [-574.527] (-571.886) (-571.749) (-575.131) * [-572.750] (-571.695) (-573.032) (-570.740) -- 0:00:12
726000 -- (-572.275) (-574.364) (-575.850) [-572.295] * [-573.158] (-575.641) (-572.965) (-571.096) -- 0:00:12
726500 -- (-575.600) (-571.463) (-573.421) [-573.552] * (-572.770) (-578.342) (-572.695) [-574.663] -- 0:00:12
727000 -- (-572.245) (-573.891) [-573.712] (-572.991) * (-576.055) (-576.231) (-575.599) [-572.832] -- 0:00:12
727500 -- (-576.488) (-572.593) (-574.025) [-575.387] * [-571.434] (-573.441) (-576.489) (-575.200) -- 0:00:12
728000 -- (-571.260) (-573.550) [-572.408] (-574.236) * (-573.410) [-572.267] (-573.060) (-575.197) -- 0:00:12
728500 -- [-573.630] (-571.965) (-572.076) (-574.177) * (-572.170) (-573.910) [-572.210] (-574.326) -- 0:00:12
729000 -- (-575.355) (-575.150) [-572.844] (-575.423) * (-573.757) (-573.437) (-573.109) [-575.651] -- 0:00:12
729500 -- (-574.454) (-571.579) [-577.375] (-572.388) * (-571.197) (-575.665) [-573.794] (-572.283) -- 0:00:12
730000 -- (-573.027) (-574.240) [-573.083] (-573.400) * [-574.292] (-573.776) (-573.233) (-573.140) -- 0:00:12
Average standard deviation of split frequencies: 0.020215
730500 -- [-571.473] (-572.106) (-572.512) (-572.398) * [-572.602] (-573.770) (-574.251) (-574.118) -- 0:00:12
731000 -- (-572.099) (-576.823) (-571.494) [-573.586] * (-576.717) [-572.956] (-571.388) (-573.399) -- 0:00:12
731500 -- [-572.905] (-580.526) (-573.075) (-575.066) * (-575.127) [-571.976] (-574.231) (-571.382) -- 0:00:12
732000 -- (-573.376) (-573.172) (-572.686) [-571.495] * (-572.531) (-576.334) (-575.583) [-572.472] -- 0:00:12
732500 -- (-572.976) (-571.551) (-572.224) [-572.442] * (-573.053) (-572.631) [-573.631] (-573.246) -- 0:00:12
733000 -- [-573.323] (-571.536) (-573.488) (-574.362) * (-572.930) (-578.555) (-572.598) [-571.322] -- 0:00:12
733500 -- (-574.952) [-571.691] (-573.914) (-572.062) * [-572.909] (-575.123) (-572.234) (-573.866) -- 0:00:12
734000 -- (-576.534) (-571.975) [-571.831] (-573.205) * [-572.082] (-577.785) (-574.306) (-574.499) -- 0:00:12
734500 -- (-576.777) (-575.119) (-572.510) [-574.490] * (-571.363) [-574.074] (-572.875) (-577.190) -- 0:00:12
735000 -- (-577.324) (-573.114) [-573.599] (-571.653) * (-572.133) (-575.264) [-577.189] (-576.174) -- 0:00:12
Average standard deviation of split frequencies: 0.020069
735500 -- (-576.684) [-574.043] (-572.757) (-573.670) * [-574.413] (-571.757) (-572.852) (-572.027) -- 0:00:12
736000 -- [-571.361] (-572.727) (-573.679) (-573.555) * (-571.585) (-572.732) [-572.767] (-576.072) -- 0:00:12
736500 -- (-577.731) (-573.512) (-574.357) [-571.131] * [-573.114] (-576.936) (-572.553) (-573.299) -- 0:00:12
737000 -- (-576.354) (-576.184) (-572.298) [-575.324] * [-571.824] (-575.623) (-572.529) (-574.984) -- 0:00:12
737500 -- [-572.246] (-574.878) (-573.518) (-572.147) * (-573.485) (-572.815) (-573.431) [-574.720] -- 0:00:12
738000 -- (-574.098) (-572.836) (-572.063) [-570.850] * [-570.993] (-572.296) (-574.004) (-571.105) -- 0:00:12
738500 -- [-574.763] (-573.339) (-574.039) (-571.646) * (-572.146) [-574.107] (-575.748) (-570.643) -- 0:00:12
739000 -- (-571.293) [-574.799] (-575.194) (-572.193) * (-571.472) (-572.169) [-572.139] (-573.915) -- 0:00:12
739500 -- (-572.122) (-572.892) [-573.917] (-573.220) * (-573.168) [-573.079] (-571.294) (-572.230) -- 0:00:11
740000 -- (-574.460) [-571.703] (-582.279) (-573.482) * (-573.921) (-571.819) [-571.430] (-573.592) -- 0:00:11
Average standard deviation of split frequencies: 0.019518
740500 -- (-573.616) [-573.584] (-570.689) (-580.353) * [-574.280] (-572.834) (-572.028) (-574.609) -- 0:00:11
741000 -- (-575.354) (-572.294) [-571.108] (-575.806) * (-577.183) [-572.684] (-573.207) (-571.378) -- 0:00:11
741500 -- (-574.674) (-573.607) (-572.267) [-573.435] * (-573.180) (-571.639) [-573.189] (-572.774) -- 0:00:11
742000 -- (-577.563) [-571.956] (-574.604) (-572.954) * (-574.250) (-572.185) [-577.254] (-573.884) -- 0:00:11
742500 -- [-572.250] (-575.857) (-575.207) (-572.783) * (-575.595) [-570.978] (-572.307) (-571.428) -- 0:00:11
743000 -- (-574.341) (-572.514) (-572.145) [-574.086] * (-574.661) (-571.495) (-574.301) [-572.909] -- 0:00:11
743500 -- (-572.283) (-575.853) [-572.378] (-576.457) * [-571.521] (-573.583) (-573.914) (-572.238) -- 0:00:11
744000 -- (-574.369) [-571.985] (-572.514) (-576.632) * [-574.280] (-575.977) (-574.318) (-571.820) -- 0:00:11
744500 -- [-572.821] (-574.211) (-571.127) (-574.110) * (-570.827) (-573.576) (-572.616) [-571.154] -- 0:00:11
745000 -- (-573.529) (-572.003) (-573.658) [-573.350] * [-572.001] (-575.414) (-577.584) (-576.318) -- 0:00:11
Average standard deviation of split frequencies: 0.018957
745500 -- (-576.902) (-571.198) [-572.434] (-573.568) * [-576.721] (-578.143) (-576.954) (-573.778) -- 0:00:11
746000 -- (-575.286) (-572.143) [-572.763] (-572.237) * (-571.985) [-575.047] (-573.050) (-578.972) -- 0:00:11
746500 -- [-573.444] (-577.197) (-572.190) (-572.681) * (-571.987) [-574.212] (-572.647) (-572.419) -- 0:00:11
747000 -- [-572.784] (-572.171) (-573.510) (-572.156) * (-573.357) [-574.358] (-573.802) (-571.894) -- 0:00:11
747500 -- (-574.046) [-576.816] (-573.452) (-579.806) * [-572.680] (-571.876) (-574.757) (-574.687) -- 0:00:11
748000 -- (-579.062) (-576.047) (-578.181) [-572.676] * (-572.178) (-572.516) (-571.544) [-573.269] -- 0:00:11
748500 -- [-574.249] (-572.666) (-571.113) (-571.858) * [-573.111] (-573.762) (-571.541) (-576.918) -- 0:00:11
749000 -- (-574.165) (-577.309) [-572.328] (-572.967) * (-572.980) [-573.696] (-572.999) (-573.929) -- 0:00:11
749500 -- (-572.450) (-572.746) [-573.773] (-572.756) * (-572.862) (-570.844) (-571.811) [-575.003] -- 0:00:11
750000 -- [-575.236] (-571.932) (-575.951) (-576.634) * (-571.603) (-571.119) [-572.897] (-573.141) -- 0:00:11
Average standard deviation of split frequencies: 0.017583
750500 -- (-574.486) [-571.725] (-571.764) (-572.981) * (-572.985) (-572.326) [-573.121] (-571.943) -- 0:00:11
751000 -- (-571.749) [-573.201] (-577.988) (-572.391) * [-572.526] (-572.218) (-575.689) (-572.062) -- 0:00:11
751500 -- (-572.716) (-572.106) (-574.381) [-573.037] * (-571.217) (-576.173) [-571.295] (-571.878) -- 0:00:11
752000 -- (-571.904) [-571.342] (-575.917) (-574.147) * (-571.543) [-572.972] (-572.653) (-575.864) -- 0:00:11
752500 -- (-573.431) (-572.556) [-573.684] (-574.312) * (-578.181) (-572.239) (-580.496) [-572.702] -- 0:00:11
753000 -- (-572.002) (-571.584) [-571.735] (-573.525) * (-572.851) [-571.576] (-572.491) (-571.842) -- 0:00:11
753500 -- (-572.287) (-573.484) (-571.249) [-573.091] * (-572.377) (-571.068) [-574.179] (-572.142) -- 0:00:11
754000 -- (-571.495) (-570.815) [-572.799] (-571.928) * (-577.499) [-571.530] (-572.734) (-575.424) -- 0:00:11
754500 -- (-573.241) (-573.326) (-573.597) [-571.255] * (-573.090) (-572.795) [-572.828] (-574.634) -- 0:00:11
755000 -- (-577.539) (-573.818) (-573.527) [-574.619] * (-571.709) (-575.256) (-573.697) [-577.772] -- 0:00:11
Average standard deviation of split frequencies: 0.018291
755500 -- (-572.479) (-572.024) (-572.578) [-573.690] * (-572.309) (-573.983) [-571.631] (-572.902) -- 0:00:11
756000 -- [-572.880] (-573.052) (-575.321) (-570.942) * (-575.265) (-574.888) (-573.410) [-573.853] -- 0:00:11
756500 -- (-574.761) [-572.210] (-574.154) (-572.786) * (-571.637) (-573.744) (-574.248) [-572.614] -- 0:00:11
757000 -- (-573.599) (-572.837) (-575.254) [-570.970] * (-573.257) [-573.483] (-573.386) (-573.340) -- 0:00:11
757500 -- (-571.570) (-577.052) [-573.052] (-575.286) * (-572.638) (-573.121) (-571.660) [-573.932] -- 0:00:11
758000 -- [-572.743] (-573.350) (-571.969) (-572.312) * [-571.308] (-573.337) (-571.416) (-576.696) -- 0:00:11
758500 -- (-575.861) [-572.446] (-574.490) (-575.441) * [-574.644] (-573.043) (-572.547) (-583.598) -- 0:00:11
759000 -- (-573.287) (-571.783) [-574.028] (-572.310) * (-572.742) [-573.105] (-575.318) (-571.748) -- 0:00:11
759500 -- (-575.081) [-571.698] (-575.284) (-571.721) * (-578.147) [-575.779] (-574.232) (-574.485) -- 0:00:11
760000 -- (-573.646) (-571.647) [-573.819] (-572.825) * [-578.269] (-573.303) (-573.479) (-571.882) -- 0:00:11
Average standard deviation of split frequencies: 0.021484
760500 -- [-574.168] (-574.134) (-571.887) (-572.186) * (-571.793) (-572.959) (-571.425) [-574.846] -- 0:00:11
761000 -- [-573.041] (-572.004) (-574.399) (-573.502) * (-572.904) (-575.129) (-571.135) [-572.421] -- 0:00:10
761500 -- [-574.455] (-571.508) (-577.382) (-571.721) * (-572.796) [-571.658] (-570.869) (-575.745) -- 0:00:10
762000 -- (-572.359) [-571.978] (-576.708) (-574.066) * (-573.056) (-572.958) [-571.680] (-574.748) -- 0:00:10
762500 -- [-570.973] (-573.055) (-572.563) (-571.111) * (-572.989) (-571.817) [-572.734] (-576.317) -- 0:00:10
763000 -- [-571.893] (-572.846) (-571.581) (-572.404) * (-574.795) (-575.075) (-571.879) [-572.619] -- 0:00:10
763500 -- (-571.719) [-574.383] (-572.538) (-572.543) * (-572.051) (-576.254) [-572.782] (-571.188) -- 0:00:10
764000 -- (-572.498) (-571.371) [-573.969] (-574.098) * (-572.638) (-571.862) [-572.706] (-572.661) -- 0:00:10
764500 -- (-572.541) (-574.083) [-571.306] (-572.678) * (-571.536) (-571.936) (-572.854) [-571.947] -- 0:00:10
765000 -- (-571.564) (-572.678) [-573.183] (-573.206) * (-572.379) (-573.138) (-571.968) [-572.754] -- 0:00:10
Average standard deviation of split frequencies: 0.021745
765500 -- (-572.322) (-571.312) [-570.891] (-577.656) * [-571.709] (-574.476) (-574.451) (-571.377) -- 0:00:10
766000 -- (-573.248) [-577.591] (-573.114) (-573.464) * (-573.694) (-571.683) (-573.862) [-572.566] -- 0:00:10
766500 -- (-572.610) (-577.377) (-571.596) [-577.005] * [-574.031] (-576.103) (-571.656) (-572.674) -- 0:00:10
767000 -- (-573.476) (-571.161) [-573.761] (-573.038) * (-574.470) (-572.319) [-570.951] (-571.574) -- 0:00:10
767500 -- (-572.655) (-571.015) (-572.085) [-577.116] * (-573.326) (-571.638) [-571.822] (-574.642) -- 0:00:10
768000 -- (-572.920) (-575.515) (-573.019) [-574.044] * [-583.200] (-575.217) (-573.373) (-571.754) -- 0:00:10
768500 -- (-571.585) (-575.262) [-571.853] (-577.087) * [-575.291] (-575.157) (-572.874) (-572.193) -- 0:00:10
769000 -- [-573.748] (-575.011) (-570.998) (-575.036) * (-573.990) (-574.166) [-571.455] (-572.647) -- 0:00:10
769500 -- [-572.615] (-574.261) (-571.560) (-575.753) * (-571.294) [-571.485] (-574.128) (-572.675) -- 0:00:10
770000 -- (-572.429) [-573.089] (-573.566) (-573.844) * [-571.693] (-572.204) (-571.428) (-576.224) -- 0:00:10
Average standard deviation of split frequencies: 0.021205
770500 -- (-571.923) (-574.667) (-575.121) [-571.561] * [-573.354] (-571.821) (-575.644) (-575.245) -- 0:00:10
771000 -- (-573.294) [-572.550] (-572.910) (-572.195) * (-574.561) (-572.068) (-572.509) [-573.490] -- 0:00:10
771500 -- (-571.590) (-572.903) [-576.004] (-572.756) * (-573.520) [-573.203] (-573.923) (-571.459) -- 0:00:10
772000 -- [-575.460] (-572.417) (-572.690) (-572.661) * (-573.393) (-573.259) (-575.344) [-571.300] -- 0:00:10
772500 -- (-575.537) [-572.992] (-571.199) (-574.995) * (-571.730) (-573.324) [-573.194] (-573.798) -- 0:00:10
773000 -- (-578.194) (-576.417) (-573.244) [-575.376] * (-575.088) [-573.714] (-574.279) (-575.441) -- 0:00:10
773500 -- (-573.280) [-573.543] (-575.456) (-574.900) * [-575.317] (-575.784) (-573.864) (-573.608) -- 0:00:10
774000 -- (-573.830) (-579.946) (-572.685) [-571.276] * (-573.063) (-572.335) (-572.863) [-573.417] -- 0:00:10
774500 -- (-577.717) (-573.661) (-571.694) [-573.483] * (-570.934) (-573.121) (-573.257) [-572.755] -- 0:00:10
775000 -- (-579.952) (-572.357) [-573.621] (-574.349) * (-573.243) (-571.493) (-572.651) [-572.305] -- 0:00:10
Average standard deviation of split frequencies: 0.020654
775500 -- (-571.144) (-576.516) (-577.948) [-574.503] * (-572.515) (-573.104) (-576.033) [-572.179] -- 0:00:10
776000 -- [-571.062] (-573.384) (-575.688) (-572.392) * (-574.617) (-571.780) (-572.508) [-575.418] -- 0:00:10
776500 -- [-571.098] (-573.364) (-571.358) (-573.703) * (-572.377) (-572.249) [-572.917] (-571.883) -- 0:00:10
777000 -- (-575.966) (-572.151) (-573.063) [-574.425] * (-571.243) [-571.202] (-571.641) (-574.858) -- 0:00:10
777500 -- (-574.228) (-571.929) [-572.549] (-572.845) * [-571.572] (-575.109) (-575.310) (-571.357) -- 0:00:10
778000 -- [-579.026] (-574.229) (-572.096) (-572.424) * (-572.348) [-572.999] (-572.793) (-571.178) -- 0:00:10
778500 -- (-575.834) (-575.489) [-574.121] (-571.506) * (-573.797) (-572.338) (-572.096) [-572.551] -- 0:00:10
779000 -- (-572.054) (-571.597) [-575.346] (-572.551) * [-572.519] (-573.229) (-570.656) (-572.891) -- 0:00:10
779500 -- (-575.587) (-571.328) [-574.491] (-573.119) * (-575.637) (-576.702) (-571.185) [-571.564] -- 0:00:10
780000 -- [-575.830] (-572.259) (-575.375) (-571.305) * (-573.327) [-572.356] (-573.191) (-572.714) -- 0:00:10
Average standard deviation of split frequencies: 0.020128
780500 -- (-575.232) (-573.622) (-573.545) [-571.810] * (-573.140) (-577.185) (-574.058) [-572.083] -- 0:00:10
781000 -- (-570.997) (-572.921) [-573.590] (-571.904) * (-572.912) [-571.329] (-573.785) (-573.800) -- 0:00:10
781500 -- (-573.890) (-573.686) (-572.963) [-574.881] * (-576.244) (-573.591) (-571.728) [-572.204] -- 0:00:10
782000 -- (-580.744) (-577.142) [-572.266] (-572.557) * [-572.833] (-573.089) (-573.035) (-574.521) -- 0:00:10
782500 -- (-574.520) (-575.520) (-571.289) [-575.701] * (-573.148) (-574.404) (-572.929) [-573.011] -- 0:00:10
783000 -- (-576.249) (-572.280) (-573.469) [-573.100] * (-574.273) (-574.557) (-572.878) [-573.075] -- 0:00:09
783500 -- (-575.817) (-573.061) [-572.647] (-574.185) * (-571.567) (-573.138) (-573.969) [-572.853] -- 0:00:09
784000 -- (-575.440) [-572.777] (-572.272) (-574.683) * (-571.585) (-572.467) [-576.579] (-572.292) -- 0:00:09
784500 -- (-576.863) (-573.096) [-572.806] (-576.779) * (-580.626) (-573.101) [-572.710] (-572.079) -- 0:00:09
785000 -- (-576.753) (-574.733) (-571.424) [-574.989] * (-573.361) [-571.845] (-574.665) (-575.007) -- 0:00:09
Average standard deviation of split frequencies: 0.019592
785500 -- (-573.162) (-573.903) (-572.176) [-574.236] * [-573.450] (-574.453) (-572.403) (-575.448) -- 0:00:09
786000 -- (-572.910) (-572.195) [-578.499] (-579.369) * (-573.882) [-573.610] (-574.087) (-573.128) -- 0:00:09
786500 -- (-574.998) (-573.228) (-577.168) [-571.909] * (-572.758) (-571.475) (-577.296) [-572.831] -- 0:00:09
787000 -- [-578.765] (-574.039) (-573.290) (-577.843) * (-571.295) (-572.226) (-572.968) [-573.242] -- 0:00:09
787500 -- (-572.692) (-571.456) (-574.583) [-576.559] * [-572.795] (-574.120) (-574.038) (-572.629) -- 0:00:09
788000 -- (-573.377) (-572.011) (-572.448) [-572.787] * (-571.315) [-572.703] (-572.376) (-576.890) -- 0:00:09
788500 -- (-573.457) (-572.724) [-573.161] (-572.110) * (-573.429) (-574.249) [-573.984] (-575.986) -- 0:00:09
789000 -- (-576.364) [-571.542] (-575.520) (-573.305) * [-572.956] (-573.536) (-578.102) (-574.246) -- 0:00:09
789500 -- (-574.768) [-571.477] (-578.478) (-573.494) * [-572.382] (-574.341) (-571.918) (-573.205) -- 0:00:09
790000 -- (-574.620) (-574.030) [-571.429] (-573.119) * (-571.904) [-572.243] (-571.588) (-571.199) -- 0:00:09
Average standard deviation of split frequencies: 0.018284
790500 -- (-572.800) (-573.579) (-577.073) [-570.957] * (-571.964) (-572.323) [-574.985] (-572.013) -- 0:00:09
791000 -- [-575.682] (-571.160) (-578.660) (-573.444) * (-573.271) (-572.033) (-578.524) [-573.732] -- 0:00:09
791500 -- [-572.730] (-573.079) (-573.820) (-571.240) * (-571.689) (-574.501) (-573.768) [-574.764] -- 0:00:09
792000 -- (-573.831) (-572.545) (-571.975) [-573.596] * (-573.104) (-574.304) [-571.562] (-572.305) -- 0:00:09
792500 -- (-571.882) (-574.623) (-572.382) [-573.669] * (-572.948) (-573.477) [-572.921] (-571.503) -- 0:00:09
793000 -- [-573.271] (-572.432) (-575.261) (-573.916) * (-574.862) (-571.352) (-573.449) [-571.153] -- 0:00:09
793500 -- (-574.260) [-571.877] (-574.139) (-572.756) * (-572.218) [-571.080] (-574.163) (-573.445) -- 0:00:09
794000 -- (-572.935) (-571.065) [-574.788] (-573.776) * [-572.880] (-570.881) (-571.938) (-575.641) -- 0:00:09
794500 -- (-572.302) [-571.569] (-571.954) (-571.897) * (-575.232) [-574.532] (-573.132) (-575.312) -- 0:00:09
795000 -- [-571.384] (-571.607) (-573.431) (-577.561) * [-571.453] (-572.868) (-574.405) (-573.110) -- 0:00:09
Average standard deviation of split frequencies: 0.017767
795500 -- (-570.894) (-572.236) (-572.564) [-576.865] * (-572.484) (-572.551) (-575.822) [-571.208] -- 0:00:09
796000 -- (-573.041) (-573.157) (-573.685) [-573.960] * [-571.758] (-574.851) (-575.140) (-571.759) -- 0:00:09
796500 -- (-577.215) [-573.658] (-572.235) (-574.282) * [-572.664] (-572.385) (-576.417) (-572.542) -- 0:00:09
797000 -- [-572.525] (-572.351) (-573.743) (-574.238) * (-580.672) (-574.896) (-572.598) [-572.445] -- 0:00:09
797500 -- [-573.508] (-576.762) (-571.568) (-574.517) * [-572.017] (-571.341) (-575.780) (-571.925) -- 0:00:09
798000 -- (-574.240) [-575.412] (-574.911) (-574.867) * (-577.488) (-571.189) (-572.567) [-572.783] -- 0:00:09
798500 -- (-574.735) (-574.028) [-573.184] (-574.999) * (-574.909) (-573.492) [-576.754] (-574.542) -- 0:00:09
799000 -- (-574.129) (-571.363) (-575.012) [-571.426] * (-572.035) [-571.337] (-580.145) (-573.117) -- 0:00:09
799500 -- (-574.374) (-571.330) [-572.933] (-572.134) * (-572.702) [-573.869] (-577.135) (-578.471) -- 0:00:09
800000 -- [-572.431] (-572.774) (-577.007) (-572.969) * [-571.715] (-576.327) (-573.122) (-573.120) -- 0:00:09
Average standard deviation of split frequencies: 0.018840
800500 -- (-573.368) (-575.551) [-571.209] (-574.076) * (-571.720) [-574.323] (-575.600) (-572.209) -- 0:00:09
801000 -- [-571.508] (-574.035) (-573.144) (-571.764) * (-572.415) (-572.990) (-576.121) [-575.592] -- 0:00:09
801500 -- (-572.549) (-572.001) [-573.865] (-572.131) * [-573.496] (-576.597) (-578.316) (-571.668) -- 0:00:09
802000 -- (-573.152) [-575.248] (-575.380) (-575.563) * (-572.418) (-575.644) (-572.210) [-573.365] -- 0:00:09
802500 -- (-573.043) (-574.650) [-573.031] (-576.962) * (-574.205) (-574.161) [-575.657] (-574.998) -- 0:00:09
803000 -- [-572.372] (-573.090) (-572.148) (-571.540) * (-574.394) (-578.022) [-571.343] (-572.581) -- 0:00:09
803500 -- (-571.581) (-576.149) [-571.601] (-571.184) * [-573.743] (-573.224) (-572.383) (-572.168) -- 0:00:09
804000 -- (-571.126) [-576.082] (-570.955) (-574.444) * (-577.491) (-571.686) [-576.054] (-573.626) -- 0:00:09
804500 -- (-574.498) (-575.140) (-575.654) [-575.347] * (-574.450) (-574.599) [-572.136] (-576.608) -- 0:00:08
805000 -- (-578.279) [-572.973] (-578.385) (-574.521) * (-572.844) [-574.526] (-572.172) (-572.525) -- 0:00:08
Average standard deviation of split frequencies: 0.018716
805500 -- (-572.017) (-574.719) [-572.838] (-572.843) * [-574.462] (-572.370) (-573.433) (-572.931) -- 0:00:08
806000 -- [-572.190] (-574.410) (-577.186) (-571.679) * (-575.309) (-571.823) [-572.722] (-572.675) -- 0:00:08
806500 -- [-572.164] (-576.509) (-573.754) (-572.804) * [-575.284] (-572.880) (-571.677) (-574.288) -- 0:00:08
807000 -- (-571.941) (-576.448) (-573.223) [-574.317] * (-576.192) (-571.679) [-572.749] (-574.521) -- 0:00:08
807500 -- (-571.714) (-572.619) [-574.293] (-576.625) * (-574.441) [-574.165] (-576.957) (-577.026) -- 0:00:08
808000 -- (-573.130) (-571.438) (-570.928) [-572.911] * (-572.147) (-573.330) [-573.399] (-572.976) -- 0:00:08
808500 -- (-573.990) [-571.626] (-571.836) (-574.343) * (-572.290) (-571.219) (-574.705) [-571.725] -- 0:00:08
809000 -- (-575.801) (-572.301) (-573.864) [-573.038] * (-572.754) (-573.532) (-574.676) [-573.015] -- 0:00:08
809500 -- (-574.131) (-578.748) (-575.137) [-574.329] * [-571.294] (-572.904) (-573.561) (-571.259) -- 0:00:08
810000 -- (-573.973) [-570.976] (-572.548) (-578.497) * [-574.054] (-579.031) (-572.066) (-575.575) -- 0:00:08
Average standard deviation of split frequencies: 0.018608
810500 -- [-573.162] (-574.497) (-572.592) (-582.504) * (-574.732) (-572.651) [-578.030] (-578.368) -- 0:00:08
811000 -- [-572.014] (-571.079) (-573.336) (-574.901) * (-573.396) (-571.522) (-572.664) [-573.253] -- 0:00:08
811500 -- [-570.846] (-570.667) (-575.150) (-573.900) * (-572.512) (-572.021) [-572.769] (-575.374) -- 0:00:08
812000 -- [-573.444] (-571.441) (-571.574) (-572.303) * (-572.885) [-572.518] (-572.346) (-574.510) -- 0:00:08
812500 -- (-572.274) (-572.688) [-571.810] (-571.802) * (-572.422) [-573.439] (-575.964) (-572.751) -- 0:00:08
813000 -- (-572.213) [-575.916] (-571.181) (-573.281) * (-571.325) (-571.948) (-574.493) [-572.422] -- 0:00:08
813500 -- (-574.095) [-572.352] (-572.179) (-572.635) * (-574.695) (-571.547) (-574.059) [-574.628] -- 0:00:08
814000 -- (-572.074) (-572.593) (-577.744) [-573.404] * (-572.606) (-573.768) [-571.820] (-572.964) -- 0:00:08
814500 -- (-571.313) (-571.845) [-579.067] (-571.271) * (-572.609) [-571.487] (-573.099) (-572.456) -- 0:00:08
815000 -- (-572.145) [-571.056] (-573.113) (-571.433) * (-572.652) (-572.448) (-572.786) [-573.397] -- 0:00:08
Average standard deviation of split frequencies: 0.018486
815500 -- (-575.166) [-572.427] (-572.432) (-576.672) * [-571.670] (-571.372) (-574.344) (-572.344) -- 0:00:08
816000 -- [-572.064] (-572.971) (-572.673) (-579.954) * [-571.985] (-572.445) (-575.209) (-574.771) -- 0:00:08
816500 -- [-572.406] (-570.843) (-574.206) (-574.431) * (-576.449) (-571.614) (-578.473) [-574.408] -- 0:00:08
817000 -- (-572.017) (-572.466) [-571.107] (-576.266) * (-573.336) (-572.713) (-577.757) [-573.368] -- 0:00:08
817500 -- (-572.195) (-572.344) [-574.028] (-572.306) * (-576.815) (-574.917) [-573.258] (-571.987) -- 0:00:08
818000 -- (-574.143) (-572.935) (-572.553) [-571.406] * [-575.264] (-574.525) (-571.628) (-572.091) -- 0:00:08
818500 -- (-571.816) (-574.370) [-574.957] (-572.531) * (-572.772) (-572.659) (-575.472) [-572.019] -- 0:00:08
819000 -- [-573.115] (-571.880) (-573.261) (-571.509) * [-571.391] (-573.051) (-578.372) (-572.894) -- 0:00:08
819500 -- (-573.417) (-572.578) (-571.348) [-572.748] * [-572.764] (-572.696) (-577.462) (-574.598) -- 0:00:08
820000 -- (-575.551) [-571.710] (-571.555) (-572.907) * (-571.654) (-573.612) [-573.444] (-572.710) -- 0:00:08
Average standard deviation of split frequencies: 0.018764
820500 -- (-572.733) [-572.131] (-573.281) (-571.248) * [-571.201] (-572.493) (-575.047) (-572.850) -- 0:00:08
821000 -- (-571.114) [-573.983] (-572.173) (-572.819) * [-571.513] (-571.753) (-575.073) (-573.382) -- 0:00:08
821500 -- (-573.170) (-573.508) (-573.289) [-573.659] * (-573.784) [-573.821] (-575.640) (-572.184) -- 0:00:08
822000 -- (-571.707) [-572.865] (-574.841) (-572.728) * (-573.532) (-575.844) (-573.088) [-573.063] -- 0:00:08
822500 -- (-571.309) (-571.552) (-576.340) [-572.445] * (-576.731) [-572.319] (-572.900) (-574.465) -- 0:00:08
823000 -- [-571.429] (-571.422) (-578.175) (-573.271) * (-573.388) (-573.644) [-571.664] (-574.176) -- 0:00:08
823500 -- (-572.777) (-572.174) (-572.651) [-573.743] * (-573.397) [-573.515] (-573.267) (-573.787) -- 0:00:08
824000 -- (-572.321) (-573.087) (-574.323) [-572.171] * (-572.412) [-571.564] (-577.684) (-572.178) -- 0:00:08
824500 -- [-573.299] (-571.257) (-575.613) (-570.871) * [-571.804] (-573.815) (-573.987) (-571.307) -- 0:00:08
825000 -- (-572.031) (-573.808) (-574.400) [-570.925] * (-576.236) (-571.367) [-571.856] (-571.715) -- 0:00:08
Average standard deviation of split frequencies: 0.020165
825500 -- (-572.881) (-579.128) [-578.333] (-574.712) * (-572.329) (-571.524) [-572.196] (-571.695) -- 0:00:08
826000 -- [-573.580] (-571.676) (-571.596) (-573.298) * (-572.108) (-572.711) [-571.093] (-574.589) -- 0:00:08
826500 -- [-571.295] (-573.850) (-573.294) (-571.137) * (-573.174) [-573.250] (-577.021) (-574.965) -- 0:00:07
827000 -- (-574.178) (-577.283) (-572.186) [-571.543] * (-575.589) (-572.454) [-575.269] (-574.808) -- 0:00:07
827500 -- (-574.185) (-573.994) [-571.115] (-571.122) * [-575.504] (-572.070) (-576.760) (-571.019) -- 0:00:07
828000 -- (-573.252) (-574.996) [-571.653] (-576.776) * (-575.023) [-573.241] (-576.732) (-572.578) -- 0:00:07
828500 -- (-576.970) (-572.005) (-571.803) [-571.852] * [-572.207] (-572.643) (-577.303) (-571.664) -- 0:00:07
829000 -- (-571.874) (-572.884) (-573.085) [-572.317] * (-572.392) [-571.417] (-571.636) (-574.531) -- 0:00:07
829500 -- [-572.349] (-573.398) (-574.247) (-574.669) * (-571.416) [-572.275] (-572.234) (-573.335) -- 0:00:07
830000 -- (-572.025) (-575.415) [-572.360] (-574.554) * (-573.650) (-572.298) (-571.429) [-573.955] -- 0:00:07
Average standard deviation of split frequencies: 0.019673
830500 -- (-573.631) (-579.283) (-573.041) [-571.668] * (-571.371) [-574.349] (-572.971) (-574.539) -- 0:00:07
831000 -- [-574.318] (-572.056) (-574.642) (-572.349) * (-572.165) [-573.182] (-573.389) (-574.104) -- 0:00:07
831500 -- (-572.560) (-571.284) [-574.786] (-577.781) * (-572.417) (-574.577) (-573.127) [-574.828] -- 0:00:07
832000 -- (-576.783) [-572.268] (-573.125) (-576.486) * (-574.201) (-572.552) (-573.513) [-574.088] -- 0:00:07
832500 -- (-575.769) (-570.992) [-571.291] (-575.354) * (-573.782) (-571.921) (-574.196) [-573.039] -- 0:00:07
833000 -- [-571.599] (-575.622) (-570.856) (-575.172) * [-575.049] (-573.301) (-572.019) (-573.746) -- 0:00:07
833500 -- (-571.314) [-571.836] (-576.859) (-572.435) * (-575.540) (-573.561) [-572.619] (-574.248) -- 0:00:07
834000 -- (-571.807) [-571.058] (-573.707) (-574.176) * [-573.932] (-572.678) (-573.321) (-574.063) -- 0:00:07
834500 -- [-572.387] (-572.930) (-572.170) (-571.551) * [-573.440] (-572.964) (-573.522) (-572.523) -- 0:00:07
835000 -- (-574.724) (-574.085) [-575.698] (-571.732) * (-572.258) (-573.147) (-571.595) [-573.794] -- 0:00:07
Average standard deviation of split frequencies: 0.018420
835500 -- [-571.144] (-572.229) (-576.886) (-573.510) * (-571.977) (-581.106) [-572.452] (-571.489) -- 0:00:07
836000 -- [-572.954] (-576.096) (-573.340) (-572.259) * (-573.228) (-574.247) [-571.737] (-571.147) -- 0:00:07
836500 -- (-575.370) [-574.592] (-571.373) (-571.758) * (-574.107) (-573.296) (-571.374) [-575.702] -- 0:00:07
837000 -- (-571.745) (-572.938) [-571.153] (-573.830) * (-574.658) (-572.059) (-571.979) [-572.178] -- 0:00:07
837500 -- (-572.825) (-577.078) [-572.800] (-574.466) * [-571.645] (-573.505) (-572.794) (-572.737) -- 0:00:07
838000 -- (-572.761) [-573.138] (-573.081) (-572.200) * (-572.099) (-572.708) (-571.822) [-571.925] -- 0:00:07
838500 -- (-573.672) (-574.896) [-572.766] (-571.393) * (-573.557) (-573.648) [-573.778] (-573.066) -- 0:00:07
839000 -- (-572.137) [-572.172] (-571.720) (-573.283) * (-572.416) (-572.164) (-573.934) [-574.467] -- 0:00:07
839500 -- (-573.022) (-574.357) (-571.693) [-570.826] * (-573.765) (-574.348) (-574.270) [-574.436] -- 0:00:07
840000 -- [-577.539] (-577.288) (-572.021) (-574.099) * (-573.112) (-572.949) [-574.936] (-572.856) -- 0:00:07
Average standard deviation of split frequencies: 0.017570
840500 -- (-578.467) (-573.617) (-571.022) [-576.678] * (-573.678) [-572.623] (-571.624) (-571.768) -- 0:00:07
841000 -- (-572.117) [-573.773] (-573.842) (-572.077) * [-573.477] (-571.456) (-579.888) (-574.494) -- 0:00:07
841500 -- (-571.015) (-572.763) [-573.568] (-570.754) * (-572.031) (-574.086) (-573.400) [-577.083] -- 0:00:07
842000 -- (-577.416) [-575.509] (-573.725) (-572.972) * [-573.030] (-576.845) (-571.467) (-577.396) -- 0:00:07
842500 -- (-573.790) [-573.256] (-573.711) (-572.306) * (-571.712) (-571.098) (-571.743) [-574.962] -- 0:00:07
843000 -- (-580.543) [-572.901] (-572.924) (-575.100) * (-576.569) (-572.286) (-575.237) [-571.875] -- 0:00:07
843500 -- [-573.247] (-571.947) (-571.285) (-573.157) * (-573.686) [-572.170] (-572.691) (-573.191) -- 0:00:07
844000 -- (-571.070) (-574.093) (-572.597) [-571.542] * (-577.064) (-571.542) (-572.386) [-575.357] -- 0:00:07
844500 -- (-571.006) (-575.968) [-571.619] (-571.315) * (-574.637) (-574.387) (-572.675) [-572.641] -- 0:00:07
845000 -- (-574.153) (-572.253) [-574.766] (-573.234) * (-572.858) [-575.803] (-573.502) (-573.267) -- 0:00:07
Average standard deviation of split frequencies: 0.017831
845500 -- (-574.340) (-571.732) [-571.279] (-572.882) * (-575.076) (-574.614) [-571.987] (-573.571) -- 0:00:07
846000 -- (-572.890) [-577.414] (-571.905) (-573.660) * (-574.522) (-575.222) [-572.365] (-573.249) -- 0:00:07
846500 -- (-572.880) (-572.969) (-574.714) [-572.290] * (-575.191) (-577.943) (-572.944) [-573.194] -- 0:00:07
847000 -- [-571.140] (-572.169) (-571.980) (-575.074) * (-571.688) (-575.344) (-572.564) [-573.435] -- 0:00:07
847500 -- (-573.322) (-573.127) (-573.630) [-574.715] * (-573.543) (-573.666) [-580.452] (-574.191) -- 0:00:07
848000 -- (-572.503) [-571.415] (-579.921) (-574.700) * [-571.959] (-574.810) (-573.622) (-571.159) -- 0:00:06
848500 -- [-573.218] (-571.120) (-571.731) (-572.304) * [-573.840] (-572.599) (-576.952) (-573.838) -- 0:00:06
849000 -- [-572.215] (-572.662) (-573.951) (-572.230) * (-574.345) [-575.277] (-574.860) (-571.122) -- 0:00:06
849500 -- (-574.102) (-573.034) [-572.106] (-574.775) * (-573.000) (-572.523) [-575.128] (-571.724) -- 0:00:06
850000 -- (-573.860) (-571.413) [-572.821] (-573.090) * (-574.447) (-575.153) [-574.347] (-573.004) -- 0:00:06
Average standard deviation of split frequencies: 0.016994
850500 -- (-572.902) (-575.028) (-571.304) [-574.013] * (-571.944) (-573.257) (-573.497) [-573.330] -- 0:00:06
851000 -- [-572.260] (-572.667) (-570.986) (-574.262) * (-572.622) (-571.400) (-572.838) [-573.342] -- 0:00:06
851500 -- (-572.666) (-573.429) [-572.929] (-571.564) * [-573.216] (-571.937) (-573.097) (-573.126) -- 0:00:06
852000 -- [-571.765] (-571.815) (-571.964) (-572.484) * (-576.285) [-572.187] (-573.724) (-574.993) -- 0:00:06
852500 -- [-572.611] (-571.386) (-571.246) (-573.014) * (-574.486) (-579.760) [-571.770] (-577.287) -- 0:00:06
853000 -- (-576.858) [-572.707] (-571.022) (-574.254) * (-573.368) (-576.649) [-573.592] (-573.381) -- 0:00:06
853500 -- (-574.776) [-571.685] (-574.358) (-573.529) * (-573.900) (-574.833) (-573.293) [-572.888] -- 0:00:06
854000 -- [-573.987] (-572.124) (-572.375) (-572.010) * (-572.135) (-574.645) (-573.513) [-571.337] -- 0:00:06
854500 -- (-572.671) [-571.053] (-573.396) (-571.066) * [-573.354] (-571.823) (-574.664) (-572.574) -- 0:00:06
855000 -- [-570.733] (-571.343) (-573.273) (-571.179) * (-575.576) (-571.640) [-575.012] (-571.621) -- 0:00:06
Average standard deviation of split frequencies: 0.016888
855500 -- [-571.251] (-573.466) (-571.896) (-571.514) * (-573.209) [-572.401] (-575.865) (-571.168) -- 0:00:06
856000 -- [-571.014] (-576.369) (-573.782) (-572.442) * (-573.394) [-572.057] (-573.304) (-577.589) -- 0:00:06
856500 -- (-573.124) (-573.019) (-573.588) [-573.857] * (-573.938) (-571.476) [-572.624] (-576.712) -- 0:00:06
857000 -- (-572.087) [-575.076] (-578.864) (-574.333) * (-574.260) (-574.288) [-571.479] (-574.617) -- 0:00:06
857500 -- (-572.315) [-571.363] (-575.543) (-579.133) * (-571.689) (-573.065) [-574.211] (-572.192) -- 0:00:06
858000 -- (-575.298) (-576.152) (-572.978) [-571.769] * (-573.701) (-577.619) (-574.720) [-572.538] -- 0:00:06
858500 -- (-576.644) (-571.750) (-574.122) [-572.974] * [-573.529] (-571.782) (-573.476) (-576.221) -- 0:00:06
859000 -- (-575.192) (-575.147) [-574.338] (-571.637) * [-572.057] (-572.850) (-571.842) (-575.431) -- 0:00:06
859500 -- (-573.954) [-576.110] (-573.641) (-573.026) * (-571.307) [-571.745] (-571.645) (-581.698) -- 0:00:06
860000 -- [-572.871] (-571.816) (-571.302) (-573.065) * [-571.022] (-573.738) (-576.446) (-574.828) -- 0:00:06
Average standard deviation of split frequencies: 0.018622
860500 -- (-572.885) (-571.839) (-577.300) [-572.768] * (-573.578) (-581.338) [-571.775] (-572.452) -- 0:00:06
861000 -- [-572.087] (-571.686) (-574.933) (-572.801) * (-576.101) [-572.556] (-572.198) (-571.746) -- 0:00:06
861500 -- (-574.070) (-572.915) [-573.166] (-572.866) * (-575.053) (-572.555) (-571.944) [-572.018] -- 0:00:06
862000 -- (-572.548) (-572.593) (-571.041) [-571.473] * (-571.303) (-574.389) (-573.978) [-570.973] -- 0:00:06
862500 -- (-572.009) [-572.730] (-575.564) (-573.342) * (-570.789) [-572.016] (-574.291) (-571.900) -- 0:00:06
863000 -- [-573.858] (-573.560) (-575.691) (-572.400) * [-570.941] (-571.022) (-572.805) (-574.354) -- 0:00:06
863500 -- [-573.803] (-572.039) (-570.982) (-573.962) * (-574.523) (-572.192) (-571.503) [-575.718] -- 0:00:06
864000 -- (-572.519) (-571.506) [-571.956] (-572.428) * [-573.790] (-574.555) (-573.170) (-574.699) -- 0:00:06
864500 -- (-572.433) (-572.080) (-573.047) [-573.069] * (-572.662) [-572.637] (-571.545) (-573.122) -- 0:00:06
865000 -- (-575.803) (-572.432) (-573.802) [-574.838] * [-571.483] (-572.537) (-572.024) (-571.267) -- 0:00:06
Average standard deviation of split frequencies: 0.018508
865500 -- (-572.198) (-572.565) (-571.418) [-574.167] * (-571.711) (-571.316) (-573.155) [-574.578] -- 0:00:06
866000 -- (-575.289) (-577.143) (-571.229) [-574.074] * (-573.561) (-573.773) [-572.755] (-576.373) -- 0:00:06
866500 -- (-577.782) (-572.357) (-571.210) [-576.650] * (-573.457) (-575.827) (-571.201) [-578.613] -- 0:00:06
867000 -- (-574.655) (-574.283) (-574.549) [-574.463] * [-571.824] (-571.770) (-572.611) (-575.011) -- 0:00:06
867500 -- (-574.230) [-574.274] (-571.051) (-576.051) * (-573.271) (-577.794) (-571.727) [-572.818] -- 0:00:06
868000 -- (-572.320) (-572.648) (-572.637) [-571.662] * [-575.006] (-571.586) (-570.830) (-572.033) -- 0:00:06
868500 -- [-572.823] (-573.363) (-574.228) (-574.718) * (-571.371) [-572.960] (-574.280) (-575.750) -- 0:00:06
869000 -- (-575.932) [-572.963] (-572.807) (-572.003) * [-573.632] (-572.425) (-575.648) (-572.512) -- 0:00:06
869500 -- (-574.298) [-572.324] (-571.535) (-573.907) * [-574.961] (-572.644) (-574.444) (-574.682) -- 0:00:06
870000 -- (-575.691) (-572.797) [-573.467] (-572.947) * (-579.709) [-572.413] (-571.960) (-571.836) -- 0:00:05
Average standard deviation of split frequencies: 0.018409
870500 -- (-573.395) [-572.108] (-576.077) (-573.476) * [-572.070] (-583.768) (-572.657) (-571.902) -- 0:00:05
871000 -- [-571.441] (-574.791) (-572.590) (-572.973) * (-578.167) (-572.869) (-571.790) [-573.298] -- 0:00:05
871500 -- [-576.179] (-572.950) (-572.839) (-573.090) * (-579.617) [-570.766] (-573.769) (-573.291) -- 0:00:05
872000 -- (-572.369) (-571.004) [-572.381] (-574.764) * [-576.269] (-571.414) (-572.907) (-572.090) -- 0:00:05
872500 -- [-572.120] (-573.827) (-573.227) (-573.169) * (-574.263) [-574.575] (-572.919) (-573.031) -- 0:00:05
873000 -- (-574.862) [-571.913] (-571.702) (-574.053) * [-571.946] (-575.699) (-575.284) (-573.460) -- 0:00:05
873500 -- (-572.086) (-571.225) (-572.878) [-573.048] * (-571.902) (-574.462) (-573.101) [-573.359] -- 0:00:05
874000 -- (-574.003) [-572.903] (-572.275) (-572.934) * (-571.754) (-577.586) [-573.966] (-571.163) -- 0:00:05
874500 -- (-573.918) (-572.534) [-572.820] (-572.189) * (-574.008) (-573.173) [-573.585] (-572.632) -- 0:00:05
875000 -- [-577.679] (-574.611) (-572.449) (-573.843) * (-571.038) [-574.901] (-572.060) (-572.394) -- 0:00:05
Average standard deviation of split frequencies: 0.017220
875500 -- (-575.972) (-571.317) (-571.786) [-572.236] * (-571.977) (-574.522) [-574.098] (-572.030) -- 0:00:05
876000 -- (-573.008) (-572.205) [-571.521] (-574.679) * (-575.427) (-576.067) (-571.298) [-571.762] -- 0:00:05
876500 -- [-572.932] (-575.540) (-577.985) (-572.709) * [-573.187] (-571.450) (-575.186) (-573.612) -- 0:00:05
877000 -- (-572.746) (-574.181) (-572.577) [-572.182] * (-574.194) (-572.753) [-570.901] (-573.377) -- 0:00:05
877500 -- (-575.068) [-575.099] (-575.559) (-573.813) * (-571.549) (-574.643) [-571.233] (-572.657) -- 0:00:05
878000 -- (-574.563) (-573.955) [-575.687] (-574.933) * [-572.085] (-575.636) (-571.414) (-572.884) -- 0:00:05
878500 -- [-571.945] (-572.221) (-574.222) (-572.783) * [-572.247] (-573.454) (-571.073) (-572.802) -- 0:00:05
879000 -- (-571.682) (-573.102) [-572.556] (-572.338) * (-572.136) (-573.443) [-572.743] (-573.029) -- 0:00:05
879500 -- [-573.414] (-577.547) (-573.029) (-572.000) * [-572.637] (-572.314) (-574.992) (-572.085) -- 0:00:05
880000 -- (-571.218) (-571.698) [-573.739] (-574.422) * [-572.966] (-571.290) (-573.785) (-572.690) -- 0:00:05
Average standard deviation of split frequencies: 0.017843
880500 -- (-572.595) [-571.209] (-574.343) (-572.106) * (-572.948) (-572.353) [-572.036] (-573.380) -- 0:00:05
881000 -- (-572.262) (-576.487) [-573.355] (-572.316) * (-571.649) (-575.544) [-571.963] (-572.780) -- 0:00:05
881500 -- (-573.138) [-576.425] (-572.029) (-571.709) * (-572.625) [-571.176] (-571.147) (-577.577) -- 0:00:05
882000 -- (-575.557) (-573.615) (-571.203) [-572.580] * (-576.312) [-571.328] (-574.712) (-571.821) -- 0:00:05
882500 -- [-571.703] (-572.689) (-572.449) (-572.316) * (-573.540) [-572.050] (-573.464) (-575.794) -- 0:00:05
883000 -- (-572.545) (-571.571) (-573.698) [-571.628] * (-573.608) (-574.047) [-573.302] (-575.688) -- 0:00:05
883500 -- (-571.999) (-573.549) [-578.110] (-571.321) * (-573.398) (-571.647) [-572.470] (-574.714) -- 0:00:05
884000 -- (-572.532) (-574.064) [-571.848] (-574.719) * (-572.997) (-573.221) (-574.864) [-572.424] -- 0:00:05
884500 -- (-577.022) [-572.355] (-574.009) (-574.721) * [-575.233] (-573.528) (-572.256) (-579.611) -- 0:00:05
885000 -- (-573.434) (-573.888) [-573.064] (-574.001) * (-575.948) (-572.182) (-575.066) [-573.119] -- 0:00:05
Average standard deviation of split frequencies: 0.018445
885500 -- (-571.954) (-575.140) [-573.321] (-573.418) * (-573.252) [-571.782] (-573.141) (-573.279) -- 0:00:05
886000 -- (-574.389) (-573.198) [-573.652] (-572.352) * (-572.299) (-573.444) [-574.362] (-571.198) -- 0:00:05
886500 -- (-571.278) (-573.990) (-574.076) [-574.598] * (-570.924) (-573.303) [-573.405] (-575.373) -- 0:00:05
887000 -- [-571.471] (-573.238) (-574.921) (-583.555) * (-577.985) (-573.235) [-572.293] (-574.175) -- 0:00:05
887500 -- (-574.015) (-574.458) [-572.892] (-575.048) * (-574.344) (-573.370) (-573.821) [-573.163] -- 0:00:05
888000 -- (-571.757) (-572.226) [-573.214] (-572.150) * (-574.488) (-572.315) (-574.553) [-574.096] -- 0:00:05
888500 -- [-577.909] (-574.265) (-573.171) (-571.512) * (-576.348) (-572.115) [-573.512] (-571.886) -- 0:00:05
889000 -- [-575.445] (-574.307) (-573.004) (-574.623) * (-573.650) (-575.668) [-571.986] (-572.614) -- 0:00:05
889500 -- [-575.154] (-577.700) (-572.254) (-571.676) * (-577.270) (-574.017) [-572.739] (-576.422) -- 0:00:05
890000 -- (-572.942) (-575.158) [-571.648] (-575.837) * (-571.284) [-572.695] (-574.557) (-571.696) -- 0:00:05
Average standard deviation of split frequencies: 0.019054
890500 -- [-571.706] (-572.987) (-571.425) (-573.433) * [-572.675] (-572.212) (-574.223) (-571.775) -- 0:00:05
891000 -- (-572.910) (-573.950) (-573.614) [-576.667] * (-576.098) (-577.102) (-571.680) [-573.007] -- 0:00:05
891500 -- [-572.736] (-575.616) (-571.802) (-571.875) * (-572.083) [-576.139] (-575.632) (-571.818) -- 0:00:04
892000 -- (-571.509) [-572.579] (-573.837) (-572.043) * [-573.109] (-574.383) (-576.089) (-572.123) -- 0:00:04
892500 -- [-572.685] (-572.272) (-573.819) (-581.011) * (-572.500) (-573.788) [-572.955] (-573.497) -- 0:00:04
893000 -- (-575.242) [-571.982] (-574.748) (-573.765) * (-574.528) (-573.370) (-572.714) [-575.437] -- 0:00:04
893500 -- (-571.843) (-572.736) [-573.215] (-580.175) * (-576.678) (-573.915) [-571.374] (-574.129) -- 0:00:04
894000 -- (-573.286) (-571.504) (-572.812) [-571.915] * [-574.730] (-571.834) (-574.793) (-571.765) -- 0:00:04
894500 -- [-573.107] (-578.564) (-576.687) (-572.253) * (-572.075) (-574.313) [-573.625] (-571.737) -- 0:00:04
895000 -- (-572.155) (-572.372) (-573.811) [-571.239] * (-573.889) (-573.026) [-572.504] (-571.428) -- 0:00:04
Average standard deviation of split frequencies: 0.018940
895500 -- (-572.351) (-575.125) (-573.318) [-574.271] * (-576.868) [-571.500] (-579.004) (-572.391) -- 0:00:04
896000 -- (-572.620) (-573.116) (-573.805) [-572.694] * (-573.318) [-573.815] (-572.403) (-575.272) -- 0:00:04
896500 -- (-573.873) (-573.213) [-571.257] (-572.048) * (-572.217) (-571.063) [-571.612] (-575.007) -- 0:00:04
897000 -- [-573.477] (-575.442) (-573.918) (-572.494) * (-571.535) (-575.401) [-571.398] (-575.815) -- 0:00:04
897500 -- (-574.149) (-573.073) [-571.657] (-575.525) * [-573.831] (-572.420) (-572.732) (-573.551) -- 0:00:04
898000 -- [-571.641] (-572.944) (-571.081) (-572.629) * (-573.438) (-572.272) (-574.701) [-572.133] -- 0:00:04
898500 -- [-571.085] (-572.408) (-573.491) (-574.959) * [-572.562] (-575.521) (-572.533) (-572.235) -- 0:00:04
899000 -- (-572.826) (-571.969) [-574.149] (-573.845) * (-572.302) (-572.046) [-572.572] (-574.122) -- 0:00:04
899500 -- (-573.377) (-572.304) [-572.608] (-573.813) * [-571.518] (-572.485) (-580.539) (-574.058) -- 0:00:04
900000 -- (-574.196) (-572.644) (-573.489) [-572.446] * (-571.500) (-574.132) [-573.587] (-575.371) -- 0:00:04
Average standard deviation of split frequencies: 0.018493
900500 -- (-572.203) (-573.068) [-573.421] (-572.500) * (-571.459) (-574.012) (-575.997) [-573.874] -- 0:00:04
901000 -- (-575.352) [-575.003] (-573.485) (-572.937) * (-576.217) (-571.964) (-573.451) [-573.212] -- 0:00:04
901500 -- (-572.146) [-575.930] (-575.764) (-572.945) * (-576.324) (-571.263) [-573.298] (-575.697) -- 0:00:04
902000 -- (-571.445) [-573.423] (-574.561) (-575.684) * (-574.794) (-571.266) [-571.938] (-573.016) -- 0:00:04
902500 -- (-573.211) (-572.308) (-573.637) [-571.879] * [-578.744] (-572.262) (-574.495) (-572.788) -- 0:00:04
903000 -- (-571.831) [-571.169] (-574.735) (-576.763) * (-573.951) (-572.160) (-573.611) [-572.181] -- 0:00:04
903500 -- [-571.075] (-572.403) (-574.481) (-573.948) * (-571.938) (-575.310) (-572.715) [-574.450] -- 0:00:04
904000 -- [-572.076] (-573.058) (-572.494) (-573.375) * (-577.346) [-572.529] (-570.731) (-572.264) -- 0:00:04
904500 -- (-572.237) [-578.399] (-571.572) (-576.724) * (-572.028) (-572.607) [-573.620] (-571.866) -- 0:00:04
905000 -- (-572.460) (-574.472) [-574.918] (-571.953) * (-577.079) [-570.830] (-573.585) (-576.512) -- 0:00:04
Average standard deviation of split frequencies: 0.018038
905500 -- (-574.674) (-577.008) [-575.196] (-572.327) * (-571.513) [-571.510] (-572.728) (-572.932) -- 0:00:04
906000 -- (-575.377) (-571.671) [-573.335] (-572.097) * (-572.346) (-573.986) [-573.439] (-573.055) -- 0:00:04
906500 -- (-574.219) (-571.166) (-571.945) [-574.300] * [-572.818] (-575.213) (-573.025) (-572.412) -- 0:00:04
907000 -- [-576.578] (-573.265) (-572.542) (-573.138) * (-572.380) (-571.111) (-572.520) [-573.799] -- 0:00:04
907500 -- (-576.177) (-573.951) [-573.120] (-573.456) * (-573.821) (-572.006) [-574.116] (-574.158) -- 0:00:04
908000 -- (-571.750) (-579.893) [-571.847] (-577.332) * (-574.682) (-572.072) [-574.689] (-574.117) -- 0:00:04
908500 -- (-572.854) (-576.727) [-572.459] (-571.686) * [-571.317] (-572.603) (-572.227) (-573.631) -- 0:00:04
909000 -- (-572.291) [-571.072] (-571.148) (-571.106) * (-571.127) (-577.341) (-571.451) [-571.566] -- 0:00:04
909500 -- (-572.381) [-573.664] (-571.126) (-574.822) * (-573.026) [-575.517] (-577.352) (-573.839) -- 0:00:04
910000 -- (-578.651) [-573.011] (-571.044) (-570.882) * (-574.395) (-572.059) [-572.954] (-571.770) -- 0:00:04
Average standard deviation of split frequencies: 0.016910
910500 -- (-573.801) (-571.940) [-574.806] (-575.490) * (-575.527) (-574.277) (-573.260) [-573.668] -- 0:00:04
911000 -- [-572.377] (-572.910) (-577.103) (-575.557) * (-576.117) [-575.373] (-575.000) (-573.370) -- 0:00:04
911500 -- [-574.238] (-573.707) (-572.639) (-573.998) * (-571.012) (-575.491) [-574.161] (-571.668) -- 0:00:04
912000 -- [-571.699] (-571.837) (-573.404) (-574.836) * (-572.448) [-573.190] (-572.422) (-571.218) -- 0:00:04
912500 -- (-572.926) (-572.231) (-571.774) [-573.586] * [-575.074] (-572.316) (-573.449) (-571.850) -- 0:00:04
913000 -- (-572.732) (-572.173) [-571.440] (-579.880) * (-571.103) (-576.326) (-573.262) [-572.421] -- 0:00:04
913500 -- (-572.447) (-572.227) [-574.357] (-575.148) * (-571.016) [-575.680] (-575.415) (-578.396) -- 0:00:03
914000 -- (-573.404) (-572.823) (-572.559) [-575.729] * (-571.601) (-570.999) (-573.144) [-580.889] -- 0:00:03
914500 -- (-574.211) [-572.446] (-575.108) (-574.478) * (-573.829) (-572.976) [-574.031] (-576.362) -- 0:00:03
915000 -- (-572.757) (-571.601) (-573.510) [-576.513] * (-577.308) (-574.649) [-574.922] (-572.818) -- 0:00:03
Average standard deviation of split frequencies: 0.016125
915500 -- (-573.035) (-572.813) [-575.310] (-582.643) * (-571.702) [-572.456] (-573.051) (-572.338) -- 0:00:03
916000 -- [-575.598] (-573.936) (-574.437) (-572.748) * [-572.156] (-572.188) (-573.883) (-571.092) -- 0:00:03
916500 -- (-572.310) (-578.022) (-573.349) [-575.624] * (-573.451) (-572.380) (-572.131) [-572.926] -- 0:00:03
917000 -- (-573.971) (-572.760) (-572.273) [-574.134] * (-571.218) (-572.602) [-572.138] (-580.346) -- 0:00:03
917500 -- (-571.608) (-571.593) (-574.754) [-573.271] * (-572.175) [-572.299] (-574.797) (-576.663) -- 0:00:03
918000 -- (-572.716) (-570.765) [-573.505] (-574.952) * (-574.504) (-573.223) (-572.533) [-575.623] -- 0:00:03
918500 -- (-573.258) [-573.535] (-574.760) (-575.416) * (-573.372) (-574.741) [-574.031] (-576.355) -- 0:00:03
919000 -- [-572.217] (-572.170) (-572.719) (-575.095) * (-571.859) (-574.033) [-574.571] (-577.987) -- 0:00:03
919500 -- (-572.069) (-572.243) (-572.670) [-575.044] * (-572.008) [-571.538] (-581.646) (-573.556) -- 0:00:03
920000 -- [-574.246] (-572.231) (-578.517) (-570.935) * (-571.762) (-572.334) (-573.919) [-575.109] -- 0:00:03
Average standard deviation of split frequencies: 0.016385
920500 -- (-579.196) [-576.128] (-572.040) (-572.944) * [-573.335] (-575.721) (-573.700) (-573.178) -- 0:00:03
921000 -- (-574.050) [-578.780] (-573.096) (-572.119) * (-572.838) (-575.307) (-573.267) [-571.980] -- 0:00:03
921500 -- (-579.755) [-578.041] (-572.332) (-575.548) * (-574.049) (-576.633) [-574.626] (-574.656) -- 0:00:03
922000 -- [-573.577] (-574.300) (-577.020) (-572.526) * (-571.410) [-572.083] (-573.693) (-575.334) -- 0:00:03
922500 -- (-577.695) [-571.631] (-573.382) (-574.754) * [-571.484] (-571.874) (-576.851) (-571.989) -- 0:00:03
923000 -- (-572.676) [-572.789] (-571.928) (-576.167) * [-572.257] (-573.611) (-570.952) (-571.603) -- 0:00:03
923500 -- (-573.829) [-572.228] (-572.398) (-574.544) * (-573.594) (-572.634) (-571.708) [-573.863] -- 0:00:03
924000 -- (-573.662) (-574.151) (-576.432) [-573.689] * [-574.041] (-572.037) (-571.935) (-573.853) -- 0:00:03
924500 -- (-575.489) (-575.485) [-573.372] (-577.545) * (-576.612) (-574.803) (-571.783) [-571.466] -- 0:00:03
925000 -- (-573.411) [-572.976] (-574.648) (-574.012) * (-571.272) (-573.120) [-574.371] (-572.442) -- 0:00:03
Average standard deviation of split frequencies: 0.014933
925500 -- (-571.924) (-574.913) (-574.221) [-571.615] * (-574.461) (-573.681) [-575.303] (-572.759) -- 0:00:03
926000 -- (-571.857) (-577.203) [-574.207] (-573.475) * (-572.128) (-572.301) [-575.182] (-575.511) -- 0:00:03
926500 -- [-573.391] (-575.907) (-576.854) (-572.188) * (-571.809) [-571.922] (-574.602) (-574.434) -- 0:00:03
927000 -- (-572.781) (-571.475) [-572.236] (-571.526) * [-572.270] (-571.462) (-574.027) (-574.140) -- 0:00:03
927500 -- (-573.080) [-571.499] (-574.095) (-571.460) * (-573.784) (-572.337) [-571.732] (-572.501) -- 0:00:03
928000 -- (-574.563) [-575.076] (-571.246) (-571.455) * [-576.015] (-574.386) (-573.434) (-575.994) -- 0:00:03
928500 -- (-573.874) [-573.863] (-573.500) (-572.905) * (-575.713) (-573.752) [-573.765] (-574.381) -- 0:00:03
929000 -- (-571.933) (-573.935) [-571.325] (-573.625) * (-576.666) (-574.370) (-571.388) [-572.067] -- 0:00:03
929500 -- (-573.637) [-573.684] (-572.992) (-575.412) * (-571.723) (-571.104) (-571.381) [-571.348] -- 0:00:03
930000 -- (-571.582) (-572.948) [-571.587] (-573.646) * (-571.574) [-571.379] (-572.774) (-572.452) -- 0:00:03
Average standard deviation of split frequencies: 0.014183
930500 -- [-571.212] (-576.270) (-573.426) (-574.687) * [-578.671] (-575.145) (-575.650) (-572.378) -- 0:00:03
931000 -- (-574.125) (-574.853) (-573.285) [-571.881] * (-575.195) (-572.103) [-572.428] (-571.991) -- 0:00:03
931500 -- (-571.733) (-572.347) [-574.403] (-572.416) * (-585.305) (-571.444) (-574.537) [-572.033] -- 0:00:03
932000 -- (-573.734) [-573.961] (-573.076) (-572.989) * (-575.498) (-572.145) (-575.336) [-575.253] -- 0:00:03
932500 -- (-572.893) (-572.338) (-572.202) [-571.814] * (-572.681) (-571.373) [-572.688] (-573.245) -- 0:00:03
933000 -- (-574.134) [-572.076] (-573.327) (-571.918) * (-572.595) (-576.990) (-572.110) [-575.104] -- 0:00:03
933500 -- (-574.870) (-571.695) [-572.453] (-574.088) * (-574.723) (-572.420) [-577.992] (-579.371) -- 0:00:03
934000 -- (-572.281) (-572.951) [-571.638] (-574.153) * [-574.360] (-571.660) (-578.016) (-572.340) -- 0:00:03
934500 -- (-578.492) (-575.348) (-572.067) [-573.563] * (-574.389) (-571.215) (-573.183) [-572.310] -- 0:00:03
935000 -- (-578.281) [-573.544] (-573.314) (-573.524) * (-574.328) [-571.275] (-575.453) (-571.957) -- 0:00:02
Average standard deviation of split frequencies: 0.013766
935500 -- (-579.031) [-571.291] (-572.610) (-574.249) * (-572.507) [-574.411] (-575.126) (-572.436) -- 0:00:02
936000 -- [-572.261] (-571.522) (-571.418) (-578.139) * [-572.367] (-573.118) (-575.023) (-571.930) -- 0:00:02
936500 -- (-577.950) [-573.380] (-572.529) (-571.809) * (-571.240) (-574.223) [-572.424] (-571.549) -- 0:00:02
937000 -- [-571.761] (-574.248) (-574.627) (-575.959) * [-575.600] (-576.132) (-571.992) (-574.288) -- 0:00:02
937500 -- (-572.730) (-571.789) [-573.306] (-572.678) * [-577.177] (-572.274) (-571.760) (-571.841) -- 0:00:02
938000 -- (-571.209) (-573.882) (-573.014) [-574.190] * (-574.123) (-572.810) (-573.547) [-571.276] -- 0:00:02
938500 -- (-576.630) (-572.294) [-571.669] (-573.868) * (-575.516) (-574.594) [-572.458] (-572.388) -- 0:00:02
939000 -- (-574.427) (-573.067) (-575.175) [-573.250] * (-573.706) (-572.151) [-577.700] (-572.850) -- 0:00:02
939500 -- (-573.459) (-577.620) [-574.351] (-572.393) * [-576.539] (-571.380) (-571.832) (-574.548) -- 0:00:02
940000 -- (-574.072) [-574.811] (-574.447) (-572.397) * (-577.504) [-573.242] (-571.497) (-573.308) -- 0:00:02
Average standard deviation of split frequencies: 0.014032
940500 -- (-573.311) [-572.234] (-572.664) (-575.090) * (-573.418) (-571.158) (-573.374) [-572.127] -- 0:00:02
941000 -- (-573.434) [-573.098] (-571.065) (-575.635) * (-579.456) (-575.643) (-573.362) [-575.814] -- 0:00:02
941500 -- (-571.935) (-571.975) [-571.596] (-575.278) * [-572.469] (-574.508) (-572.597) (-575.214) -- 0:00:02
942000 -- (-573.751) (-574.202) (-573.791) [-574.246] * (-573.635) (-573.083) [-574.227] (-574.520) -- 0:00:02
942500 -- (-572.105) (-571.379) (-572.600) [-572.401] * (-576.139) [-577.590] (-571.986) (-573.489) -- 0:00:02
943000 -- (-572.212) (-572.695) [-572.426] (-571.532) * (-573.520) (-575.226) (-572.963) [-574.839] -- 0:00:02
943500 -- (-573.929) [-574.459] (-572.142) (-575.296) * (-573.171) [-572.724] (-571.197) (-572.764) -- 0:00:02
944000 -- [-571.170] (-571.465) (-576.337) (-572.507) * (-573.589) (-575.116) (-573.677) [-571.055] -- 0:00:02
944500 -- (-571.925) (-571.057) (-574.276) [-571.322] * (-574.842) (-574.146) [-572.677] (-571.963) -- 0:00:02
945000 -- (-575.972) [-574.809] (-574.267) (-573.564) * (-572.524) (-573.741) [-571.962] (-572.728) -- 0:00:02
Average standard deviation of split frequencies: 0.014285
945500 -- [-573.168] (-574.253) (-575.634) (-572.512) * [-571.848] (-573.993) (-573.296) (-572.426) -- 0:00:02
946000 -- [-571.750] (-574.305) (-574.747) (-574.312) * (-572.829) (-572.598) (-574.047) [-571.910] -- 0:00:02
946500 -- (-574.139) (-573.857) [-573.912] (-572.595) * (-573.734) (-572.429) [-571.809] (-573.277) -- 0:00:02
947000 -- (-572.096) (-572.701) (-574.315) [-574.105] * (-573.044) (-583.879) (-571.043) [-574.675] -- 0:00:02
947500 -- (-572.741) [-572.629] (-572.372) (-575.292) * [-574.041] (-578.699) (-571.100) (-574.794) -- 0:00:02
948000 -- (-571.846) (-575.938) (-572.893) [-573.287] * (-574.301) (-571.562) (-575.035) [-571.769] -- 0:00:02
948500 -- [-572.028] (-572.513) (-572.739) (-571.599) * (-575.655) (-576.215) [-573.736] (-571.937) -- 0:00:02
949000 -- (-573.162) (-572.744) (-572.372) [-573.662] * (-573.496) (-571.857) [-572.338] (-575.051) -- 0:00:02
949500 -- (-573.478) [-572.598] (-573.944) (-577.459) * (-574.089) (-572.921) [-572.925] (-574.059) -- 0:00:02
950000 -- [-573.325] (-571.225) (-573.998) (-577.068) * [-573.062] (-572.336) (-573.294) (-572.363) -- 0:00:02
Average standard deviation of split frequencies: 0.013223
950500 -- (-572.761) (-572.631) [-573.598] (-575.082) * (-573.567) (-573.211) [-572.653] (-574.444) -- 0:00:02
951000 -- [-572.943] (-575.972) (-571.100) (-573.518) * (-572.749) [-574.131] (-573.371) (-575.781) -- 0:00:02
951500 -- (-572.452) (-577.109) (-572.771) [-572.694] * (-574.849) [-571.107] (-573.798) (-575.038) -- 0:00:02
952000 -- (-572.258) [-572.897] (-572.832) (-574.097) * (-573.330) [-571.167] (-573.939) (-574.901) -- 0:00:02
952500 -- (-572.116) (-573.522) (-574.253) [-571.860] * (-573.742) (-572.242) (-572.419) [-576.740] -- 0:00:02
953000 -- (-572.111) [-571.748] (-573.542) (-572.608) * (-576.689) (-576.535) [-573.008] (-572.447) -- 0:00:02
953500 -- (-572.227) [-571.462] (-574.494) (-572.868) * [-571.770] (-573.431) (-573.198) (-579.477) -- 0:00:02
954000 -- (-575.156) (-571.930) [-571.562] (-576.705) * (-573.725) (-572.003) [-572.131] (-572.200) -- 0:00:02
954500 -- (-577.305) (-575.480) [-572.982] (-576.118) * (-574.801) (-572.745) (-572.995) [-571.735] -- 0:00:02
955000 -- (-575.501) (-574.964) [-572.240] (-573.871) * (-571.629) [-572.118] (-571.714) (-571.695) -- 0:00:02
Average standard deviation of split frequencies: 0.012821
955500 -- (-575.812) (-576.573) (-573.433) [-572.816] * (-571.685) (-576.161) [-572.076] (-571.038) -- 0:00:02
956000 -- [-576.929] (-571.739) (-574.869) (-573.462) * [-572.389] (-572.279) (-573.912) (-571.612) -- 0:00:02
956500 -- (-572.228) (-572.840) [-572.083] (-572.558) * (-573.449) (-571.207) (-571.994) [-572.156] -- 0:00:02
957000 -- (-576.093) (-571.221) [-573.032] (-572.220) * [-572.374] (-573.758) (-572.150) (-574.679) -- 0:00:01
957500 -- (-571.498) (-572.156) (-574.891) [-571.479] * [-572.963] (-572.048) (-576.837) (-573.396) -- 0:00:01
958000 -- (-572.357) [-571.667] (-577.024) (-571.097) * (-571.658) (-572.154) [-572.792] (-572.241) -- 0:00:01
958500 -- (-571.421) (-574.173) [-577.871] (-573.383) * [-571.975] (-574.569) (-571.832) (-573.411) -- 0:00:01
959000 -- [-571.929] (-571.872) (-574.201) (-572.100) * (-574.995) (-574.862) (-574.399) [-572.720] -- 0:00:01
959500 -- (-572.070) (-572.355) (-572.979) [-573.660] * (-571.877) [-571.737] (-577.594) (-577.367) -- 0:00:01
960000 -- (-571.391) (-576.858) (-575.079) [-571.896] * (-571.248) [-570.943] (-572.732) (-572.765) -- 0:00:01
Average standard deviation of split frequencies: 0.012431
960500 -- (-572.615) [-578.457] (-574.692) (-573.021) * [-571.830] (-574.154) (-574.021) (-572.275) -- 0:00:01
961000 -- (-572.301) [-572.889] (-573.803) (-576.509) * (-573.520) (-574.766) [-571.012] (-571.758) -- 0:00:01
961500 -- (-571.367) (-573.675) [-572.809] (-574.933) * (-573.965) (-575.503) [-571.304] (-573.321) -- 0:00:01
962000 -- (-572.113) (-574.179) (-575.957) [-572.400] * (-573.657) (-572.954) [-571.691] (-573.909) -- 0:00:01
962500 -- (-573.317) [-571.351] (-573.787) (-574.312) * (-573.123) (-573.396) (-571.452) [-575.025] -- 0:00:01
963000 -- (-572.663) (-574.651) [-572.628] (-571.973) * (-574.859) (-574.966) (-571.374) [-575.874] -- 0:00:01
963500 -- (-575.829) (-573.668) [-572.903] (-573.863) * (-570.957) [-572.179] (-572.406) (-573.124) -- 0:00:01
964000 -- (-573.358) [-573.220] (-576.554) (-574.928) * (-571.341) (-570.841) [-577.809] (-573.222) -- 0:00:01
964500 -- (-571.714) (-574.072) (-574.867) [-574.732] * (-572.143) (-574.278) (-577.226) [-576.698] -- 0:00:01
965000 -- [-573.903] (-577.486) (-575.119) (-576.450) * (-572.301) [-573.715] (-573.984) (-572.509) -- 0:00:01
Average standard deviation of split frequencies: 0.013339
965500 -- [-572.234] (-571.879) (-573.908) (-573.817) * (-573.378) (-574.821) (-576.303) [-576.019] -- 0:00:01
966000 -- (-571.574) (-573.520) [-572.186] (-576.242) * [-571.318] (-577.709) (-573.586) (-571.911) -- 0:00:01
966500 -- (-573.767) [-571.373] (-571.668) (-572.310) * (-573.656) (-573.348) [-573.434] (-575.144) -- 0:00:01
967000 -- (-575.717) (-574.980) (-572.255) [-572.182] * (-573.647) (-571.959) (-571.819) [-574.688] -- 0:00:01
967500 -- [-572.535] (-572.677) (-573.051) (-573.556) * (-574.834) [-571.954] (-573.902) (-571.615) -- 0:00:01
968000 -- (-576.656) [-572.241] (-575.343) (-574.251) * [-572.105] (-576.373) (-573.630) (-573.355) -- 0:00:01
968500 -- (-571.944) (-573.740) [-572.455] (-576.494) * [-571.804] (-574.157) (-573.216) (-579.086) -- 0:00:01
969000 -- (-572.270) [-570.907] (-572.842) (-576.052) * (-572.628) [-574.962] (-570.960) (-577.285) -- 0:00:01
969500 -- (-571.772) [-573.532] (-574.681) (-576.191) * [-574.074] (-571.633) (-571.448) (-572.648) -- 0:00:01
970000 -- [-571.250] (-573.533) (-575.995) (-579.144) * (-571.477) [-573.324] (-572.875) (-571.859) -- 0:00:01
Average standard deviation of split frequencies: 0.012951
970500 -- (-572.774) [-571.570] (-571.952) (-573.430) * [-573.908] (-574.101) (-571.503) (-579.838) -- 0:00:01
971000 -- (-573.322) (-577.549) (-576.031) [-573.162] * (-573.456) (-575.070) (-577.694) [-573.196] -- 0:00:01
971500 -- (-574.038) [-570.994] (-572.820) (-575.098) * (-576.643) (-572.103) [-571.362] (-572.487) -- 0:00:01
972000 -- (-573.393) [-571.498] (-574.128) (-572.578) * (-575.914) (-573.147) [-572.835] (-571.927) -- 0:00:01
972500 -- (-576.634) [-571.856] (-572.956) (-573.036) * [-572.388] (-572.753) (-576.151) (-574.399) -- 0:00:01
973000 -- (-573.142) [-572.234] (-573.599) (-578.369) * (-572.629) (-573.270) (-572.741) [-571.812] -- 0:00:01
973500 -- (-575.823) (-571.611) [-573.341] (-571.366) * (-574.536) (-571.633) (-571.032) [-574.126] -- 0:00:01
974000 -- (-580.644) (-575.762) [-571.807] (-571.361) * (-577.599) [-571.482] (-577.580) (-573.813) -- 0:00:01
974500 -- (-572.638) (-574.083) [-572.689] (-573.738) * (-574.950) (-572.549) (-574.480) [-571.474] -- 0:00:01
975000 -- (-572.377) [-571.909] (-573.636) (-573.827) * [-573.625] (-572.083) (-572.831) (-572.084) -- 0:00:01
Average standard deviation of split frequencies: 0.013202
975500 -- (-581.111) (-574.551) (-572.987) [-573.968] * [-570.993] (-580.436) (-571.544) (-572.160) -- 0:00:01
976000 -- (-575.370) [-573.191] (-573.726) (-573.323) * [-571.015] (-582.475) (-572.116) (-573.953) -- 0:00:01
976500 -- (-574.464) (-571.573) [-574.213] (-573.106) * (-571.140) (-576.750) (-570.970) [-574.030] -- 0:00:01
977000 -- [-573.147] (-572.938) (-572.040) (-578.414) * [-572.304] (-571.891) (-573.212) (-573.772) -- 0:00:01
977500 -- (-573.020) (-571.124) [-571.147] (-574.071) * (-571.563) (-575.540) [-571.808] (-574.320) -- 0:00:01
978000 -- (-573.836) (-571.634) [-571.103] (-576.043) * (-573.072) (-574.479) (-573.484) [-572.692] -- 0:00:01
978500 -- (-574.125) (-572.789) [-572.710] (-575.246) * (-572.265) [-573.705] (-571.521) (-573.816) -- 0:00:00
979000 -- [-572.640] (-573.954) (-575.650) (-573.083) * (-571.577) (-574.925) [-578.189] (-572.130) -- 0:00:00
979500 -- (-572.816) (-578.405) (-572.772) [-571.718] * [-572.685] (-571.603) (-574.611) (-572.229) -- 0:00:00
980000 -- (-576.527) (-574.597) [-572.008] (-572.851) * (-573.418) (-572.381) (-576.667) [-574.329] -- 0:00:00
Average standard deviation of split frequencies: 0.013780
980500 -- [-571.099] (-574.799) (-571.666) (-577.607) * (-574.153) (-571.669) [-575.616] (-572.540) -- 0:00:00
981000 -- [-574.897] (-573.067) (-572.479) (-571.579) * [-572.911] (-573.063) (-574.134) (-575.414) -- 0:00:00
981500 -- (-572.585) (-572.311) [-575.094] (-573.319) * (-573.221) [-574.344] (-573.244) (-575.325) -- 0:00:00
982000 -- (-572.499) [-572.300] (-573.801) (-572.829) * (-574.377) [-573.457] (-574.313) (-573.888) -- 0:00:00
982500 -- [-571.284] (-572.216) (-572.128) (-574.610) * [-574.171] (-573.740) (-573.780) (-572.433) -- 0:00:00
983000 -- (-573.351) [-572.197] (-576.129) (-575.206) * (-575.462) (-575.117) [-572.399] (-572.791) -- 0:00:00
983500 -- (-573.099) [-571.654] (-574.332) (-571.416) * (-573.440) (-578.338) [-572.962] (-572.262) -- 0:00:00
984000 -- (-572.278) (-571.253) (-577.173) [-573.525] * [-572.619] (-573.912) (-573.074) (-573.016) -- 0:00:00
984500 -- (-572.149) (-573.169) [-574.797] (-575.730) * [-571.613] (-573.731) (-571.886) (-574.678) -- 0:00:00
985000 -- (-572.205) (-571.917) [-572.833] (-575.259) * (-571.894) (-574.929) [-571.463] (-572.599) -- 0:00:00
Average standard deviation of split frequencies: 0.013387
985500 -- [-574.602] (-575.584) (-573.418) (-572.992) * (-572.662) (-572.457) [-575.370] (-576.924) -- 0:00:00
986000 -- (-574.293) (-576.310) [-572.250] (-576.194) * (-574.843) (-574.640) (-571.748) [-573.552] -- 0:00:00
986500 -- [-577.706] (-571.664) (-573.995) (-571.363) * (-573.848) (-571.682) [-574.271] (-571.974) -- 0:00:00
987000 -- [-573.670] (-572.634) (-572.881) (-572.797) * (-572.529) (-576.867) (-573.530) [-572.574] -- 0:00:00
987500 -- (-571.274) (-572.553) [-572.045] (-574.319) * (-572.182) (-573.533) [-573.388] (-572.980) -- 0:00:00
988000 -- [-572.147] (-575.397) (-573.218) (-574.199) * [-572.038] (-575.181) (-574.036) (-572.681) -- 0:00:00
988500 -- [-573.205] (-578.716) (-571.484) (-574.952) * (-571.623) [-571.931] (-575.584) (-572.311) -- 0:00:00
989000 -- (-572.298) (-573.298) (-571.570) [-572.923] * (-572.202) (-571.976) (-572.654) [-575.287] -- 0:00:00
989500 -- [-572.766] (-576.489) (-571.429) (-571.049) * (-572.370) (-572.166) [-572.132] (-575.033) -- 0:00:00
990000 -- (-572.314) (-574.123) (-573.259) [-572.490] * (-571.837) (-571.900) [-571.222] (-572.279) -- 0:00:00
Average standard deviation of split frequencies: 0.014910
990500 -- (-574.270) (-571.958) (-572.766) [-573.236] * [-571.779] (-571.094) (-571.472) (-571.744) -- 0:00:00
991000 -- (-573.989) (-572.417) [-572.086] (-573.467) * (-573.308) (-575.169) [-575.973] (-573.605) -- 0:00:00
991500 -- (-573.667) (-572.146) [-572.223] (-572.347) * (-573.365) (-576.973) (-576.626) [-571.553] -- 0:00:00
992000 -- (-573.976) [-572.716] (-573.223) (-574.888) * (-573.334) (-574.029) (-577.056) [-574.062] -- 0:00:00
992500 -- (-578.045) (-574.611) [-573.134] (-571.443) * (-573.558) (-574.607) (-572.932) [-573.927] -- 0:00:00
993000 -- (-578.615) (-573.964) (-576.464) [-572.520] * (-571.831) (-578.610) (-573.094) [-574.054] -- 0:00:00
993500 -- (-575.862) (-571.664) (-574.287) [-573.493] * (-571.414) (-575.076) (-576.343) [-571.466] -- 0:00:00
994000 -- (-574.593) [-570.986] (-575.487) (-573.601) * (-573.678) (-577.489) [-571.857] (-572.850) -- 0:00:00
994500 -- [-572.929] (-573.144) (-573.160) (-573.445) * (-573.474) [-574.717] (-573.786) (-572.738) -- 0:00:00
995000 -- [-573.016] (-574.526) (-575.168) (-571.556) * [-571.643] (-575.270) (-573.303) (-577.602) -- 0:00:00
Average standard deviation of split frequencies: 0.013568
995500 -- (-577.971) [-571.446] (-574.005) (-572.977) * (-573.545) (-573.802) [-571.413] (-572.464) -- 0:00:00
996000 -- (-576.227) (-573.245) (-573.248) [-571.891] * (-572.363) (-573.894) (-571.876) [-574.876] -- 0:00:00
996500 -- (-571.808) (-573.910) [-572.139] (-574.939) * (-574.290) [-573.398] (-572.845) (-573.692) -- 0:00:00
997000 -- [-571.781] (-572.039) (-571.607) (-571.609) * [-573.945] (-572.087) (-573.306) (-572.596) -- 0:00:00
997500 -- (-576.999) (-574.845) (-573.678) [-573.702] * (-575.615) (-577.888) (-575.057) [-571.504] -- 0:00:00
998000 -- (-573.890) (-576.405) [-572.241] (-574.889) * (-574.900) (-574.848) (-573.956) [-572.999] -- 0:00:00
998500 -- [-573.221] (-573.386) (-576.288) (-572.827) * (-572.865) (-572.675) (-577.658) [-574.371] -- 0:00:00
999000 -- [-571.245] (-577.469) (-572.092) (-572.452) * (-572.550) (-573.507) (-573.296) [-573.109] -- 0:00:00
999500 -- [-571.778] (-573.765) (-576.579) (-574.473) * (-571.614) (-573.465) [-572.359] (-575.249) -- 0:00:00
1000000 -- (-571.567) [-572.143] (-573.455) (-571.643) * [-572.084] (-572.457) (-574.092) (-573.733) -- 0:00:00
Average standard deviation of split frequencies: 0.013191
Analysis completed in 46 seconds
Analysis used 44.78 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -570.65
Likelihood of best state for "cold" chain of run 2 was -570.65
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
72.6 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
32.4 % ( 30 %) Dirichlet(Pi{all})
32.6 % ( 26 %) Slider(Pi{all})
71.0 % ( 39 %) Multiplier(Alpha{1,2})
70.0 % ( 28 %) Multiplier(Alpha{3})
26.9 % ( 29 %) Slider(Pinvar{all})
99.9 % (100 %) NNI(Tau{all},V{all})
73.6 % ( 79 %) ParsSPR(Tau{all},V{all})
27.5 % ( 20 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
31.9 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
73.4 % ( 77 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
32.4 % ( 21 %) Dirichlet(Pi{all})
32.2 % ( 30 %) Slider(Pi{all})
71.3 % ( 37 %) Multiplier(Alpha{1,2})
70.5 % ( 29 %) Multiplier(Alpha{3})
24.9 % ( 33 %) Slider(Pinvar{all})
99.9 % (100 %) NNI(Tau{all},V{all})
73.5 % ( 72 %) ParsSPR(Tau{all},V{all})
27.6 % ( 23 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
31.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.84 0.69 0.57
2 | 166718 0.85 0.72
3 | 166195 166801 0.86
4 | 166772 166819 166695
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.84 0.70 0.57
2 | 167371 0.85 0.72
3 | 165902 167135 0.86
4 | 166834 166517 166241
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -572.30
| 21 |
| 1 1 1 1|
| 1 2 * 2 1 |
| 2 2 1 2 2 2 |
| 2 2 2 2 11 1 2 1 21 |
|2 *1 221 * 22 1 11 * 2 2 * 1 1 * 11 12|
| 1 2 2 21 21 2 21 * 2 1 |
|12 1 2 11 11 2 1 1 2 21 1 2 |
| 1 1 1 1 22 1 2 1 2 21 2 |
| * 1 1 22 2 1 1 2 2 |
| 2 2 22 |
| 1 |
| 2 |
| 2 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -574.27
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -572.35 -577.99
2 -572.40 -576.44
--------------------------------------
TOTAL -572.38 -577.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.500358 0.052995 0.101083 0.939600 0.464469 1323.41 1374.87 1.001
r(A<->C){all} 0.171380 0.021580 0.000314 0.464049 0.131056 211.28 322.36 1.000
r(A<->G){all} 0.168695 0.019535 0.000047 0.446833 0.134341 405.36 444.87 1.000
r(A<->T){all} 0.165111 0.021227 0.000046 0.457472 0.120420 256.89 263.98 1.000
r(C<->G){all} 0.156776 0.018980 0.000022 0.445604 0.118673 308.32 358.82 1.000
r(C<->T){all} 0.164102 0.018621 0.000081 0.440362 0.129142 320.91 334.69 1.000
r(G<->T){all} 0.173937 0.021991 0.000153 0.476540 0.135229 225.51 283.30 1.000
pi(A){all} 0.221622 0.000400 0.182973 0.259115 0.221046 1241.55 1338.82 1.001
pi(C){all} 0.335744 0.000515 0.291515 0.379624 0.335665 1073.45 1287.23 1.000
pi(G){all} 0.266044 0.000470 0.223316 0.308852 0.265816 1449.98 1475.49 1.000
pi(T){all} 0.176590 0.000345 0.141115 0.212391 0.176358 1306.76 1378.30 1.000
alpha{1,2} 0.402452 0.221782 0.000328 1.344947 0.233305 1103.49 1159.58 1.000
alpha{3} 0.455662 0.246486 0.000261 1.439950 0.287867 1317.27 1402.50 1.000
pinvar{all} 0.995925 0.000026 0.986550 0.999999 0.997590 1144.47 1183.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
Key to taxon bipartitions (saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------
1 -- .***
2 -- .*..
3 -- ..*.
4 -- ...*
5 -- ..**
6 -- .**.
7 -- .*.*
----------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
5 1037 0.345436 0.003298 0.343105 0.347768 2
6 985 0.328115 0.016488 0.316456 0.339773 2
7 980 0.326449 0.019786 0.312458 0.340440 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.104136 0.010923 0.000031 0.314366 0.070321 1.000 2
length{all}[2] 0.096717 0.009901 0.000013 0.296610 0.065581 1.000 2
length{all}[3] 0.100480 0.010515 0.000032 0.316140 0.069934 1.001 2
length{all}[4] 0.099546 0.010362 0.000017 0.298308 0.069090 1.000 2
length{all}[5] 0.101933 0.010446 0.000030 0.327541 0.071222 0.999 2
length{all}[6] 0.094631 0.009139 0.000324 0.283346 0.063401 0.999 2
length{all}[7] 0.101754 0.009852 0.000034 0.286623 0.073462 0.999 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.013191
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\------------------------------------------------------------------------ C4 (4)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------- C2 (2)
+
|------------------------------------------------------------------------ C3 (3)
|
\----------------------------------------------------------------------- C4 (4)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 3 trees
99 % credible set contains 3 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 4 ls = 420
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 140 / 140 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 140 / 140 sites (100.0%), 0:00
Counting codons..
48 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4); MP score: 0
0.090163 0.055693 0.057098 0.017084 0.300000 1.300000
ntime & nrate & np: 4 2 6
Bounds (np=6):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 6
lnL0 = -593.597517
Iterating by ming2
Initial: fx= 593.597517
x= 0.09016 0.05569 0.05710 0.01708 0.30000 1.30000
1 h-m-p 0.0000 0.0001 275.6505 ++ 584.226445 m 0.0001 11 | 1/6
2 h-m-p 0.0014 0.0230 20.5905 -----------.. | 1/6
3 h-m-p 0.0000 0.0003 238.8890 +++ 568.187843 m 0.0003 39 | 2/6
4 h-m-p 0.0038 0.0472 14.3473 ------------.. | 2/6
5 h-m-p 0.0000 0.0000 196.0918 ++ 567.795599 m 0.0000 67 | 3/6
6 h-m-p 0.0003 0.1460 9.2092 ----------.. | 3/6
7 h-m-p 0.0000 0.0002 138.3140 +++ 563.166838 m 0.0002 94 | 4/6
8 h-m-p 1.3764 8.0000 0.0000 ++ 563.166838 m 8.0000 103 | 4/6
9 h-m-p 0.0202 8.0000 0.0013 +++++ 563.166838 m 8.0000 117 | 4/6
10 h-m-p 0.0046 2.0055 2.3551 +++++ 563.166813 m 2.0055 131 | 5/6
11 h-m-p 0.3283 1.6413 2.9562 ++ 563.166781 m 1.6413 140 | 6/6
12 h-m-p 0.0160 8.0000 0.0000 Y 563.166781 0 0.0160 149 | 6/6
13 h-m-p 0.0160 8.0000 0.0000 Y 563.166781 0 0.0160 158
Out..
lnL = -563.166781
159 lfun, 159 eigenQcodon, 636 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4); MP score: 0
0.081947 0.088180 0.044958 0.090223 0.000100 0.539137 0.535483
ntime & nrate & np: 4 2 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.247234
np = 7
lnL0 = -604.811680
Iterating by ming2
Initial: fx= 604.811680
x= 0.08195 0.08818 0.04496 0.09022 0.00011 0.53914 0.53548
1 h-m-p 0.0000 0.0000 268.8454 ++ 603.999521 m 0.0000 12 | 1/7
2 h-m-p 0.0000 0.0020 122.2198 ++++ 580.161612 m 0.0020 24 | 2/7
3 h-m-p 0.0001 0.0005 162.0403 ++ 565.622475 m 0.0005 34 | 3/7
4 h-m-p 0.0004 0.0021 44.7022 ++ 563.305015 m 0.0021 44 | 4/7
5 h-m-p 0.0000 0.0000 37936.7353 ++ 563.166821 m 0.0000 54 | 5/7
6 h-m-p 1.6000 8.0000 0.0002 ++ 563.166821 m 8.0000 64 | 5/7
7 h-m-p 0.0018 0.2135 0.8299 ++++ 563.166811 m 0.2135 78 | 6/7
8 h-m-p 0.4839 3.9470 0.1846 ------------C 563.166811 0 0.0000 102 | 6/7
9 h-m-p 0.0160 8.0000 0.0001 +++++ 563.166811 m 8.0000 116 | 6/7
10 h-m-p 0.0044 2.1816 0.3342 ---------C 563.166811 0 0.0000 136 | 6/7
11 h-m-p 0.0002 0.1050 2.5807 +++++ 563.166781 m 0.1050 150 | 7/7
12 h-m-p 0.0160 8.0000 0.0000 Y 563.166781 0 0.0160 160 | 7/7
13 h-m-p 0.0160 8.0000 0.0000 Y 563.166781 0 0.0160 170
Out..
lnL = -563.166781
171 lfun, 513 eigenQcodon, 1368 P(t)
Time used: 0:00
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4); MP score: 0
initial w for M2:NSpselection reset.
0.084089 0.089122 0.100137 0.072641 0.000100 1.169023 0.117875 0.170851 2.591270
ntime & nrate & np: 4 3 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.787184
np = 9
lnL0 = -605.859593
Iterating by ming2
Initial: fx= 605.859593
x= 0.08409 0.08912 0.10014 0.07264 0.00011 1.16902 0.11787 0.17085 2.59127
1 h-m-p 0.0000 0.0000 221.2326 ++ 605.650452 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0018 106.2674 ++++ 589.332845 m 0.0018 28 | 2/9
3 h-m-p 0.0009 0.0043 80.0013 ++ 571.700204 m 0.0043 40 | 3/9
4 h-m-p 0.0010 0.0051 167.4286 ++ 563.845605 m 0.0051 52 | 4/9
5 h-m-p 0.0000 0.0000 4663.1196 ++ 563.431185 m 0.0000 64 | 5/9
6 h-m-p 0.0001 0.0010 2920.6994 ++ 563.166833 m 0.0010 76 | 6/9
7 h-m-p 1.6000 8.0000 0.0518 --------Y 563.166833 0 0.0000 96 | 6/9
8 h-m-p 0.0160 8.0000 0.0002 +++++ 563.166833 m 8.0000 114 | 6/9
9 h-m-p 0.0160 8.0000 8.7735 ----------Y 563.166833 0 0.0000 139 | 6/9
10 h-m-p 0.0160 8.0000 0.0000 +++++ 563.166833 m 8.0000 154 | 6/9
11 h-m-p 0.0160 8.0000 0.1226 +++++ 563.166833 m 8.0000 172 | 6/9
12 h-m-p 0.5210 3.6096 1.8826 -----------Y 563.166833 0 0.0000 198 | 6/9
13 h-m-p 0.0400 8.0000 0.0000 ---Y 563.166833 0 0.0002 213 | 6/9
14 h-m-p 0.0160 8.0000 0.0001 ----Y 563.166833 0 0.0000 232
Out..
lnL = -563.166833
233 lfun, 932 eigenQcodon, 2796 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -563.169520 S = -563.165348 -0.001594
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:01
did 20 / 52 patterns 0:01
did 30 / 52 patterns 0:01
did 40 / 52 patterns 0:01
did 50 / 52 patterns 0:01
did 52 / 52 patterns 0:01
Time used: 0:01
Model 7: beta
TREE # 1
(1, 2, 3, 4); MP score: 0
0.055238 0.036433 0.013940 0.037530 0.000100 0.998611 1.288146
ntime & nrate & np: 4 1 7
Bounds (np=7):
0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.492311
np = 7
lnL0 = -582.633933
Iterating by ming2
Initial: fx= 582.633933
x= 0.05524 0.03643 0.01394 0.03753 0.00011 0.99861 1.28815
1 h-m-p 0.0000 0.0000 268.6280 ++ 580.844137 m 0.0000 12 | 1/7
2 h-m-p 0.0004 0.0681 15.3361 -----------.. | 1/7
3 h-m-p 0.0000 0.0001 269.2995 ++ 575.154697 m 0.0001 41 | 2/7
4 h-m-p 0.0014 0.0802 13.1244 -----------.. | 2/7
5 h-m-p 0.0000 0.0002 234.5753 +++ 565.931102 m 0.0002 71 | 3/7
6 h-m-p 0.0039 0.1358 8.1985 ------------.. | 3/7
7 h-m-p 0.0000 0.0000 194.1030 ++ 565.627470 m 0.0000 101 | 4/7
8 h-m-p 0.0005 0.2548 4.8519 -----------.. | 4/7
9 h-m-p 0.0000 0.0001 136.9784 ++ 563.166820 m 0.0001 130 | 5/7
10 h-m-p 1.6000 8.0000 0.0000 ++ 563.166820 m 8.0000 140 | 5/7
11 h-m-p 0.1546 8.0000 0.0001 +++ 563.166820 m 8.0000 153 | 5/7
12 h-m-p 0.0025 1.2419 1.2372 ----------N 563.166820 0 0.0000 175 | 5/7
13 h-m-p 0.0719 8.0000 0.0000 C 563.166820 0 0.0719 185 | 5/7
14 h-m-p 0.0573 8.0000 0.0000 N 563.166820 0 0.0143 197
Out..
lnL = -563.166820
198 lfun, 2178 eigenQcodon, 7920 P(t)
Time used: 0:04
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.104449 0.092764 0.047547 0.045960 0.000100 0.900000 1.143429 1.670422 2.369712
ntime & nrate & np: 4 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.915199
np = 9
lnL0 = -600.694733
Iterating by ming2
Initial: fx= 600.694733
x= 0.10445 0.09276 0.04755 0.04596 0.00011 0.90000 1.14343 1.67042 2.36971
1 h-m-p 0.0000 0.0000 243.2238 ++ 600.336448 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0009 194.4765 ++++ 577.199492 m 0.0009 28 | 2/9
3 h-m-p 0.0000 0.0000 5619074.5797 ++ 576.583538 m 0.0000 40 | 3/9
4 h-m-p 0.0005 0.0820 10.3754 -----------.. | 3/9
5 h-m-p 0.0000 0.0003 183.6563 +++ 564.768973 m 0.0003 74 | 4/9
6 h-m-p 0.0051 0.0355 8.6478 ------------.. | 4/9
7 h-m-p 0.0000 0.0001 137.3950 ++ 563.166833 m 0.0001 108 | 5/9
8 h-m-p 0.4584 8.0000 0.0000 +++ 563.166833 m 8.0000 121 | 5/9
9 h-m-p 0.0160 8.0000 0.0667 +++++ 563.166830 m 8.0000 140 | 5/9
10 h-m-p 0.1051 0.5253 2.2826 +C 563.166827 0 0.4273 157 | 5/9
11 h-m-p 1.6000 8.0000 0.0149 Y 563.166827 0 0.2528 169 | 5/9
12 h-m-p 1.6000 8.0000 0.0000 ++ 563.166827 m 8.0000 185 | 5/9
13 h-m-p 0.0160 8.0000 0.0272 ++++Y 563.166827 0 3.3509 205 | 5/9
14 h-m-p 1.6000 8.0000 0.0025 ++ 563.166827 m 8.0000 221 | 5/9
15 h-m-p 0.0163 0.8798 1.2147 ----------Y 563.166827 0 0.0000 247 | 5/9
16 h-m-p 0.0000 0.0023 115.8281 ++++ 563.166826 m 0.0023 261 | 6/9
17 h-m-p 0.1793 1.0096 0.8055 -------------Y 563.166826 0 0.0000 286 | 6/9
18 h-m-p 0.0160 8.0000 0.0000 Y 563.166826 0 0.0160 301
Out..
lnL = -563.166826
302 lfun, 3624 eigenQcodon, 13288 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -563.172681 S = -563.165573 -0.003116
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:09
did 20 / 52 patterns 0:09
did 30 / 52 patterns 0:09
did 40 / 52 patterns 0:10
did 50 / 52 patterns 0:10
did 52 / 52 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=140
NC_011896_1_WP_010908072_1_1047_MLBR_RS16100 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
NC_002677_1_NP_301748_1_620_ML1011 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
**************************************************
NC_011896_1_WP_010908072_1_1047_MLBR_RS16100 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NC_002677_1_NP_301748_1_620_ML1011 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600 PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
**************************************************
NC_011896_1_WP_010908072_1_1047_MLBR_RS16100 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
NC_002677_1_NP_301748_1_620_ML1011 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600 NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
****************************************
>NC_011896_1_WP_010908072_1_1047_MLBR_RS16100 TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG GTGGGCGCAGCATCATCGGT >NC_002677_1_NP_301748_1_620_ML1011 TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG GTGGGCGCAGCATCATCGGT >NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235 TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG GTGGGCGCAGCATCATCGGT >NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600 TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG GTGGGCGCAGCATCATCGGT
>NC_011896_1_WP_010908072_1_1047_MLBR_RS16100 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG >NC_002677_1_NP_301748_1_620_ML1011 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG >NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG >NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600 LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
#NEXUS
[ID: 0279516671]
begin taxa;
dimensions ntax=4;
taxlabels
NC_011896_1_WP_010908072_1_1047_MLBR_RS16100
NC_002677_1_NP_301748_1_620_ML1011
NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235
NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908072_1_1047_MLBR_RS16100,
2 NC_002677_1_NP_301748_1_620_ML1011,
3 NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235,
4 NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.070321,2:0.06558142,3:0.06993423,4:0.06909002);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.070321,2:0.06558142,3:0.06993423,4:0.06909002);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -572.35 -577.99
2 -572.40 -576.44
--------------------------------------
TOTAL -572.38 -577.49
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.500358 0.052995 0.101083 0.939600 0.464469 1323.41 1374.87 1.001
r(A<->C){all} 0.171380 0.021580 0.000314 0.464049 0.131056 211.28 322.36 1.000
r(A<->G){all} 0.168695 0.019535 0.000047 0.446833 0.134341 405.36 444.87 1.000
r(A<->T){all} 0.165111 0.021227 0.000046 0.457472 0.120420 256.89 263.98 1.000
r(C<->G){all} 0.156776 0.018980 0.000022 0.445604 0.118673 308.32 358.82 1.000
r(C<->T){all} 0.164102 0.018621 0.000081 0.440362 0.129142 320.91 334.69 1.000
r(G<->T){all} 0.173937 0.021991 0.000153 0.476540 0.135229 225.51 283.30 1.000
pi(A){all} 0.221622 0.000400 0.182973 0.259115 0.221046 1241.55 1338.82 1.001
pi(C){all} 0.335744 0.000515 0.291515 0.379624 0.335665 1073.45 1287.23 1.000
pi(G){all} 0.266044 0.000470 0.223316 0.308852 0.265816 1449.98 1475.49 1.000
pi(T){all} 0.176590 0.000345 0.141115 0.212391 0.176358 1306.76 1378.30 1.000
alpha{1,2} 0.402452 0.221782 0.000328 1.344947 0.233305 1103.49 1159.58 1.000
alpha{3} 0.455662 0.246486 0.000261 1.439950 0.287867 1317.27 1402.50 1.000
pinvar{all} 0.995925 0.000026 0.986550 0.999999 0.997590 1144.47 1183.45 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML1011/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 4 ls = 140
Codon usage in sequences
------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 | Ser TCT 1 1 1 1 | Tyr TAT 2 2 2 2 | Cys TGT 2 2 2 2
TTC 0 0 0 0 | TCC 1 1 1 1 | TAC 0 0 0 0 | TGC 2 2 2 2
Leu TTA 1 1 1 1 | TCA 2 2 2 2 | *** TAA 0 0 0 0 | *** TGA 0 0 0 0
TTG 1 1 1 1 | TCG 1 1 1 1 | TAG 0 0 0 0 | Trp TGG 3 3 3 3
------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 | Pro CCT 1 1 1 1 | His CAT 2 2 2 2 | Arg CGT 0 0 0 0
CTC 2 2 2 2 | CCC 2 2 2 2 | CAC 5 5 5 5 | CGC 2 2 2 2
CTA 0 0 0 0 | CCA 8 8 8 8 | Gln CAA 2 2 2 2 | CGA 2 2 2 2
CTG 5 5 5 5 | CCG 8 8 8 8 | CAG 1 1 1 1 | CGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 | Thr ACT 1 1 1 1 | Asn AAT 4 4 4 4 | Ser AGT 2 2 2 2
ATC 6 6 6 6 | ACC 5 5 5 5 | AAC 3 3 3 3 | AGC 3 3 3 3
ATA 1 1 1 1 | ACA 2 2 2 2 | Lys AAA 0 0 0 0 | Arg AGA 0 0 0 0
Met ATG 3 3 3 3 | ACG 5 5 5 5 | AAG 1 1 1 1 | AGG 0 0 0 0
------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 | Ala GCT 2 2 2 2 | Asp GAT 2 2 2 2 | Gly GGT 3 3 3 3
GTC 3 3 3 3 | GCC 4 4 4 4 | GAC 2 2 2 2 | GGC 5 5 5 5
GTA 1 1 1 1 | GCA 4 4 4 4 | Glu GAA 3 3 3 3 | GGA 3 3 3 3
GTG 3 3 3 3 | GCG 5 5 5 5 | GAG 1 1 1 1 | GGG 1 1 1 1
------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908072_1_1047_MLBR_RS16100
position 1: T:0.11429 C:0.31429 A:0.25714 G:0.31429
position 2: T:0.22143 C:0.37143 A:0.20000 G:0.20714
position 3: T:0.19286 C:0.32143 A:0.20714 G:0.27857
Average T:0.17619 C:0.33571 A:0.22143 G:0.26667
#2: NC_002677_1_NP_301748_1_620_ML1011
position 1: T:0.11429 C:0.31429 A:0.25714 G:0.31429
position 2: T:0.22143 C:0.37143 A:0.20000 G:0.20714
position 3: T:0.19286 C:0.32143 A:0.20714 G:0.27857
Average T:0.17619 C:0.33571 A:0.22143 G:0.26667
#3: NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235
position 1: T:0.11429 C:0.31429 A:0.25714 G:0.31429
position 2: T:0.22143 C:0.37143 A:0.20000 G:0.20714
position 3: T:0.19286 C:0.32143 A:0.20714 G:0.27857
Average T:0.17619 C:0.33571 A:0.22143 G:0.26667
#4: NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600
position 1: T:0.11429 C:0.31429 A:0.25714 G:0.31429
position 2: T:0.22143 C:0.37143 A:0.20000 G:0.20714
position 3: T:0.19286 C:0.32143 A:0.20714 G:0.27857
Average T:0.17619 C:0.33571 A:0.22143 G:0.26667
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 4 | Tyr Y TAT 8 | Cys C TGT 8
TTC 0 | TCC 4 | TAC 0 | TGC 8
Leu L TTA 4 | TCA 8 | *** * TAA 0 | *** * TGA 0
TTG 4 | TCG 4 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 4 | His H CAT 8 | Arg R CGT 0
CTC 8 | CCC 8 | CAC 20 | CGC 8
CTA 0 | CCA 32 | Gln Q CAA 8 | CGA 8
CTG 20 | CCG 32 | CAG 4 | CGG 4
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 4 | Asn N AAT 16 | Ser S AGT 8
ATC 24 | ACC 20 | AAC 12 | AGC 12
ATA 4 | ACA 8 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 12 | ACG 20 | AAG 4 | AGG 0
------------------------------------------------------------------------------
Val V GTT 8 | Ala A GCT 8 | Asp D GAT 8 | Gly G GGT 12
GTC 12 | GCC 16 | GAC 8 | GGC 20
GTA 4 | GCA 16 | Glu E GAA 12 | GGA 12
GTG 12 | GCG 20 | GAG 4 | GGG 4
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11429 C:0.31429 A:0.25714 G:0.31429
position 2: T:0.22143 C:0.37143 A:0.20000 G:0.20714
position 3: T:0.19286 C:0.32143 A:0.20714 G:0.27857
Average T:0.17619 C:0.33571 A:0.22143 G:0.26667
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 6): -563.166781 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908072_1_1047_MLBR_RS16100: 0.000004, NC_002677_1_NP_301748_1_620_ML1011: 0.000004, NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235: 0.000004, NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 301.2 118.8 0.0001 0.0000 0.0000 0.0 0.0
5..2 0.000 301.2 118.8 0.0001 0.0000 0.0000 0.0 0.0
5..3 0.000 301.2 118.8 0.0001 0.0000 0.0000 0.0 0.0
5..4 0.000 301.2 118.8 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 7): -563.166781 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908072_1_1047_MLBR_RS16100: 0.000004, NC_002677_1_NP_301748_1_620_ML1011: 0.000004, NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235: 0.000004, NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 301.2 118.8 0.0000 0.0000 0.0000 0.0 0.0
5..2 0.000 301.2 118.8 0.0000 0.0000 0.0000 0.0 0.0
5..3 0.000 301.2 118.8 0.0000 0.0000 0.0000 0.0 0.0
5..4 0.000 301.2 118.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:00
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 9): -563.166833 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.861694 0.017353 0.000001 7.472954
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908072_1_1047_MLBR_RS16100: 0.000004, NC_002677_1_NP_301748_1_620_ML1011: 0.000004, NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235: 0.000004, NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.86169 0.01735 0.12095
w: 0.00000 1.00000 7.47295
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 301.2 118.8 0.9212 0.0000 0.0000 0.0 0.0
5..2 0.000 301.2 118.8 0.9212 0.0000 0.0000 0.0 0.0
5..3 0.000 301.2 118.8 0.9212 0.0000 0.0000 0.0 0.0
5..4 0.000 301.2 118.8 0.9212 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908072_1_1047_MLBR_RS16100)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908072_1_1047_MLBR_RS16100)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:01
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 7): -563.166820 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.998839 1.288581
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908072_1_1047_MLBR_RS16100: 0.000004, NC_002677_1_NP_301748_1_620_ML1011: 0.000004, NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235: 0.000004, NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.99884 q = 1.28858
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.03888 0.11822 0.19974 0.28378 0.37081 0.46150 0.55689 0.65869 0.77038 0.90210
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 301.2 118.8 0.4361 0.0000 0.0000 0.0 0.0
5..2 0.000 301.2 118.8 0.4361 0.0000 0.0000 0.0 0.0
5..3 0.000 301.2 118.8 0.4361 0.0000 0.0000 0.0 0.0
5..4 0.000 301.2 118.8 0.4361 0.0000 0.0000 0.0 0.0
Time used: 0:04
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4); MP score: 0
lnL(ntime: 4 np: 9): -563.166826 +0.000000
5..1 5..2 5..3 5..4
0.000004 0.000004 0.000004 0.000004 0.000100 0.892349 1.740053 1.334254 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000016
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004);
(NC_011896_1_WP_010908072_1_1047_MLBR_RS16100: 0.000004, NC_002677_1_NP_301748_1_620_ML1011: 0.000004, NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235: 0.000004, NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.89235 p = 1.74005 q = 1.33425
(p1 = 0.10765) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08923 0.08923 0.08923 0.08923 0.08923 0.08923 0.08923 0.08923 0.08923 0.08923 0.10765
w: 0.14397 0.27585 0.37591 0.46310 0.54336 0.61972 0.69430 0.76908 0.84687 0.93476 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
5..1 0.000 301.2 118.8 0.6133 0.0000 0.0000 0.0 0.0
5..2 0.000 301.2 118.8 0.6133 0.0000 0.0000 0.0 0.0
5..3 0.000 301.2 118.8 0.6133 0.0000 0.0000 0.0 0.0
5..4 0.000 301.2 118.8 0.6133 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908072_1_1047_MLBR_RS16100)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:10
Model 1: NearlyNeutral -563.166781 Model 2: PositiveSelection -563.166833 Model 0: one-ratio -563.166781 Model 7: beta -563.16682 Model 8: beta&w>1 -563.166826 Model 0 vs 1 0.0 Model 2 vs 1 1.0399999996479892E-4 Model 8 vs 7 1.1999999969702912E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
