--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:18:09 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML1011/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -572.35          -577.99
2       -572.40          -576.44
--------------------------------------
TOTAL     -572.38          -577.49
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.500358    0.052995    0.101083    0.939600    0.464469   1323.41   1374.87    1.001
r(A<->C){all}   0.171380    0.021580    0.000314    0.464049    0.131056    211.28    322.36    1.000
r(A<->G){all}   0.168695    0.019535    0.000047    0.446833    0.134341    405.36    444.87    1.000
r(A<->T){all}   0.165111    0.021227    0.000046    0.457472    0.120420    256.89    263.98    1.000
r(C<->G){all}   0.156776    0.018980    0.000022    0.445604    0.118673    308.32    358.82    1.000
r(C<->T){all}   0.164102    0.018621    0.000081    0.440362    0.129142    320.91    334.69    1.000
r(G<->T){all}   0.173937    0.021991    0.000153    0.476540    0.135229    225.51    283.30    1.000
pi(A){all}      0.221622    0.000400    0.182973    0.259115    0.221046   1241.55   1338.82    1.001
pi(C){all}      0.335744    0.000515    0.291515    0.379624    0.335665   1073.45   1287.23    1.000
pi(G){all}      0.266044    0.000470    0.223316    0.308852    0.265816   1449.98   1475.49    1.000
pi(T){all}      0.176590    0.000345    0.141115    0.212391    0.176358   1306.76   1378.30    1.000
alpha{1,2}      0.402452    0.221782    0.000328    1.344947    0.233305   1103.49   1159.58    1.000
alpha{3}        0.455662    0.246486    0.000261    1.439950    0.287867   1317.27   1402.50    1.000
pinvar{all}     0.995925    0.000026    0.986550    0.999999    0.997590   1144.47   1183.45    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-563.166781
Model 2: PositiveSelection	-563.166833
Model 0: one-ratio	-563.166781
Model 7: beta	-563.16682
Model 8: beta&w>1	-563.166826


Model 0 vs 1	0.0

Model 2 vs 1	1.0399999996479892E-4

Model 8 vs 7	1.1999999969702912E-5
>C1
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C2
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C3
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C4
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=140 

C1              LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C2              LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C3              LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C4              LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
                **************************************************

C1              PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C2              PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C3              PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C4              PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
                **************************************************

C1              NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C2              NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C3              NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C4              NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
                ****************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  140 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  140 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [1680]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [1680]--->[1680]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.357 Mb, Max= 30.539 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C2              LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C3              LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
C4              LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
                **************************************************

C1              PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C2              PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C3              PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
C4              PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
                **************************************************

C1              NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C2              NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C3              NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
C4              NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
                ****************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
C2              TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
C3              TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
C4              TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
                **************************************************

C1              GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
C2              GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
C3              GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
C4              GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
                **************************************************

C1              TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
C2              TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
C3              TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
C4              TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
                **************************************************

C1              CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
C2              CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
C3              CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
C4              CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
                **************************************************

C1              CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
C2              CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
C3              CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
C4              CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
                **************************************************

C1              GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
C2              GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
C3              GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
C4              GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
                **************************************************

C1              AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
C2              AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
C3              AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
C4              AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
                **************************************************

C1              TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
C2              TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
C3              TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
C4              TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
                **************************************************

C1              GTGGGCGCAGCATCATCGGT
C2              GTGGGCGCAGCATCATCGGT
C3              GTGGGCGCAGCATCATCGGT
C4              GTGGGCGCAGCATCATCGGT
                ********************



>C1
TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
GTGGGCGCAGCATCATCGGT
>C2
TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
GTGGGCGCAGCATCATCGGT
>C3
TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
GTGGGCGCAGCATCATCGGT
>C4
TTGTGCGCACCAGCAGCTGCGCGATGTGTTCATCGAACGATGCCGAGTAC
GACATGTTCTGCGCGCACCCACCACCTTGGAGACCACCAAACCAATCCGA
TGACCGCCGATCCACTCACCCATGGAGCGCCGCTGGTGCCGCTGACTAGC
CCCTCACACGCCAACAAGGGAAACCCGCTCGCGGTGATCCCGGTTCTGGC
CTCACAGCCGATAGGTATGCTGCCCTGGGCAGGCGCCGTGCCTAGTGAAA
GCGCGGAGCCGACATGCGATTCCACCGCACCACCACCAGCTAACTCGGGC
AATCACTTAGTCGGCACGCGGATCCTTTATGGCAATCCAACGTGGATCTA
TGGCAATCCAACGTGGATCGAAGTAGAACTGGTCGACCTTCCACAAGTCG
GTGGGCGCAGCATCATCGGT
>C1
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C2
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C3
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
>C4
LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 420 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579799829
      Setting output file names to "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1337246001
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0279516671
      Seed = 1630450950
      Swapseed = 1579799829
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -784.152870 -- -26.620141
         Chain 2 -- -784.152870 -- -26.620141
         Chain 3 -- -784.152870 -- -26.620141
         Chain 4 -- -784.152870 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -784.152870 -- -26.620141
         Chain 2 -- -784.152870 -- -26.620141
         Chain 3 -- -784.152870 -- -26.620141
         Chain 4 -- -784.152870 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-784.153] (-784.153) (-784.153) (-784.153) * [-784.153] (-784.153) (-784.153) (-784.153) 
        500 -- [-581.698] (-579.712) (-582.603) (-578.202) * (-587.585) [-576.855] (-580.693) (-578.304) -- 0:00:00
       1000 -- (-582.218) (-576.417) (-575.460) [-574.694] * (-574.922) (-581.628) [-576.523] (-583.735) -- 0:00:00
       1500 -- [-577.889] (-576.310) (-577.967) (-576.483) * [-579.524] (-580.931) (-580.136) (-576.009) -- 0:00:00
       2000 -- [-577.076] (-580.172) (-583.398) (-575.183) * (-587.215) (-575.436) [-575.950] (-576.725) -- 0:00:00
       2500 -- [-576.083] (-578.656) (-578.562) (-579.454) * [-578.477] (-578.095) (-575.506) (-574.893) -- 0:00:00
       3000 -- (-573.474) (-574.853) [-575.925] (-578.814) * [-578.540] (-584.259) (-578.026) (-574.485) -- 0:00:00
       3500 -- (-577.519) (-577.861) (-580.077) [-575.995] * (-575.455) (-575.017) (-580.525) [-576.006] -- 0:00:00
       4000 -- (-577.252) (-575.490) [-576.988] (-575.288) * (-574.957) (-579.264) (-579.847) [-575.614] -- 0:00:00
       4500 -- (-581.659) (-579.759) [-578.605] (-575.553) * (-576.533) (-573.142) (-574.882) [-576.115] -- 0:00:00
       5000 -- (-582.742) [-576.288] (-576.138) (-577.729) * (-574.497) [-573.605] (-577.210) (-575.145) -- 0:00:00

      Average standard deviation of split frequencies: 0.052378

       5500 -- (-579.463) (-579.915) (-574.854) [-576.456] * (-579.558) (-576.355) (-572.619) [-583.161] -- 0:00:00
       6000 -- (-576.420) (-577.281) [-575.861] (-575.537) * (-581.069) [-577.988] (-573.850) (-574.430) -- 0:00:00
       6500 -- (-579.354) (-580.439) [-574.399] (-576.835) * (-577.446) (-577.170) (-577.561) [-576.934] -- 0:00:00
       7000 -- [-573.355] (-583.079) (-579.193) (-578.196) * (-578.615) [-574.293] (-574.359) (-577.304) -- 0:00:00
       7500 -- (-577.426) (-578.840) (-577.690) [-574.788] * (-575.127) (-576.318) [-572.659] (-583.805) -- 0:00:00
       8000 -- [-575.611] (-580.551) (-574.587) (-580.025) * (-575.254) (-574.538) (-575.093) [-578.122] -- 0:02:04
       8500 -- (-580.155) (-579.613) (-573.397) [-572.242] * (-574.474) (-578.042) [-574.264] (-576.580) -- 0:01:56
       9000 -- (-574.683) (-580.303) (-576.064) [-573.642] * (-582.480) (-581.264) (-572.228) [-573.950] -- 0:01:50
       9500 -- (-579.669) [-576.557] (-577.125) (-578.845) * (-578.559) (-579.232) [-573.642] (-579.577) -- 0:01:44
      10000 -- (-576.493) (-575.906) (-577.624) [-580.290] * (-574.994) (-580.100) [-573.671] (-572.132) -- 0:01:39

      Average standard deviation of split frequencies: 0.088388

      10500 -- [-579.411] (-581.387) (-575.519) (-577.057) * (-575.446) (-574.362) [-573.436] (-572.076) -- 0:01:34
      11000 -- (-579.020) (-582.230) (-580.174) [-574.218] * [-577.146] (-577.515) (-571.367) (-574.276) -- 0:01:29
      11500 -- (-580.661) (-581.284) [-579.159] (-577.517) * (-577.872) (-574.305) (-573.933) [-572.799] -- 0:01:25
      12000 -- [-574.185] (-582.261) (-579.992) (-581.893) * (-576.736) (-580.607) (-570.877) [-573.298] -- 0:01:22
      12500 -- (-580.499) (-581.734) [-577.481] (-576.710) * [-576.649] (-575.643) (-571.779) (-572.480) -- 0:01:19
      13000 -- (-579.529) (-575.042) [-574.918] (-578.611) * (-575.985) (-572.187) (-571.674) [-573.178] -- 0:01:15
      13500 -- (-577.091) [-574.976] (-576.101) (-576.569) * (-576.851) [-573.178] (-572.144) (-571.953) -- 0:01:13
      14000 -- [-575.281] (-582.044) (-574.407) (-576.036) * (-577.242) (-575.814) (-571.900) [-571.969] -- 0:01:10
      14500 -- (-575.617) [-577.525] (-577.560) (-578.380) * (-577.601) (-574.093) [-575.215] (-573.322) -- 0:01:07
      15000 -- (-577.444) [-576.505] (-577.058) (-580.686) * [-581.441] (-574.722) (-572.564) (-572.598) -- 0:01:05

      Average standard deviation of split frequencies: 0.019642

      15500 -- (-575.712) (-580.383) (-586.283) [-577.141] * (-580.207) [-573.417] (-572.921) (-572.844) -- 0:01:03
      16000 -- (-576.764) (-582.064) [-574.527] (-576.049) * (-580.735) (-574.049) [-575.534] (-572.567) -- 0:01:01
      16500 -- (-584.377) [-582.120] (-579.735) (-578.258) * [-576.277] (-572.564) (-573.120) (-578.703) -- 0:00:59
      17000 -- (-573.867) (-578.105) [-576.368] (-576.893) * (-583.647) [-573.367] (-573.007) (-572.731) -- 0:00:57
      17500 -- (-582.857) [-580.059] (-576.467) (-574.518) * (-578.600) (-572.694) [-575.662] (-576.177) -- 0:00:56
      18000 -- (-574.216) [-574.895] (-580.292) (-577.765) * (-576.754) [-570.960] (-570.964) (-572.220) -- 0:00:54
      18500 -- (-576.718) (-580.495) (-576.920) [-574.098] * (-578.016) (-571.449) (-578.668) [-573.065] -- 0:00:53
      19000 -- (-577.852) (-575.408) [-575.057] (-584.985) * [-579.159] (-572.539) (-573.745) (-573.579) -- 0:00:51
      19500 -- [-575.327] (-577.910) (-575.994) (-576.756) * (-574.700) (-572.962) (-571.267) [-572.205] -- 0:00:50
      20000 -- [-580.406] (-577.397) (-577.467) (-579.534) * (-577.504) (-576.871) (-579.936) [-573.732] -- 0:00:49

      Average standard deviation of split frequencies: 0.060826

      20500 -- (-575.864) (-576.187) (-575.325) [-573.250] * [-574.199] (-573.425) (-573.565) (-572.838) -- 0:00:47
      21000 -- (-577.468) (-578.821) [-575.252] (-580.904) * [-574.106] (-571.198) (-572.884) (-573.365) -- 0:00:46
      21500 -- (-573.671) (-582.647) (-575.942) [-576.182] * (-575.436) [-571.205] (-576.890) (-573.239) -- 0:00:45
      22000 -- (-576.868) (-578.003) [-577.056] (-575.616) * (-579.843) (-573.049) [-571.440] (-571.850) -- 0:00:44
      22500 -- (-581.313) [-574.153] (-577.426) (-577.146) * [-575.388] (-571.579) (-572.045) (-571.823) -- 0:00:43
      23000 -- (-578.347) [-575.196] (-578.062) (-579.123) * (-573.923) [-571.876] (-576.301) (-571.219) -- 0:00:42
      23500 -- (-576.051) (-576.936) [-576.346] (-578.071) * (-577.092) [-571.716] (-574.484) (-573.599) -- 0:00:41
      24000 -- (-575.703) (-581.411) [-572.807] (-579.616) * (-581.768) (-572.459) (-572.080) [-574.926] -- 0:00:40
      24500 -- (-579.395) [-576.951] (-579.399) (-577.410) * (-578.175) (-570.999) (-574.553) [-572.268] -- 0:01:19
      25000 -- (-578.033) [-572.851] (-577.170) (-574.955) * (-580.985) (-573.331) (-572.746) [-575.132] -- 0:01:18

      Average standard deviation of split frequencies: 0.060436

      25500 -- [-574.855] (-578.369) (-580.454) (-583.134) * [-577.288] (-577.294) (-573.376) (-571.042) -- 0:01:16
      26000 -- (-575.712) [-578.984] (-587.552) (-578.010) * (-579.326) (-572.331) [-571.413] (-573.319) -- 0:01:14
      26500 -- (-571.698) [-577.169] (-578.230) (-583.291) * (-575.746) [-571.668] (-571.737) (-573.690) -- 0:01:13
      27000 -- (-571.403) (-578.895) [-579.145] (-580.784) * [-575.238] (-573.753) (-575.616) (-571.778) -- 0:01:12
      27500 -- (-573.353) (-579.705) [-577.291] (-581.392) * (-578.091) (-576.433) (-571.349) [-573.123] -- 0:01:10
      28000 -- (-575.640) (-583.554) (-572.754) [-576.519] * (-576.340) (-575.696) [-574.783] (-571.972) -- 0:01:09
      28500 -- (-580.964) (-576.890) (-581.394) [-578.111] * (-576.935) (-578.408) [-571.789] (-572.789) -- 0:01:08
      29000 -- (-577.824) [-581.995] (-576.417) (-582.189) * (-580.039) (-573.806) (-572.188) [-571.964] -- 0:01:06
      29500 -- (-573.462) (-577.072) [-577.440] (-579.511) * (-574.874) (-573.524) (-572.927) [-573.739] -- 0:01:05
      30000 -- [-571.670] (-576.205) (-577.610) (-577.742) * (-581.042) (-574.734) [-577.436] (-584.243) -- 0:01:04

      Average standard deviation of split frequencies: 0.051240

      30500 -- (-576.620) [-577.722] (-581.604) (-573.743) * (-575.655) [-573.504] (-578.099) (-581.559) -- 0:01:03
      31000 -- (-572.548) [-576.488] (-575.772) (-576.058) * (-575.720) (-571.582) (-572.184) [-572.318] -- 0:01:02
      31500 -- (-573.196) (-575.342) (-575.964) [-573.025] * (-578.321) (-572.558) (-573.205) [-575.501] -- 0:01:01
      32000 -- (-571.394) (-577.709) [-579.755] (-575.807) * (-575.598) [-575.101] (-571.752) (-572.855) -- 0:01:00
      32500 -- [-571.270] (-575.017) (-575.567) (-579.408) * (-576.839) (-573.366) [-576.020] (-572.393) -- 0:00:59
      33000 -- (-572.536) (-575.623) (-578.887) [-575.231] * (-573.745) (-572.716) (-572.492) [-572.114] -- 0:00:58
      33500 -- (-573.873) [-578.587] (-581.902) (-576.289) * [-574.430] (-573.220) (-572.161) (-573.747) -- 0:00:57
      34000 -- (-571.886) (-582.212) (-581.101) [-575.916] * (-577.772) (-574.392) (-573.451) [-574.135] -- 0:00:56
      34500 -- (-573.731) (-577.674) (-576.145) [-575.754] * (-580.405) [-571.729] (-572.150) (-573.857) -- 0:00:55
      35000 -- [-573.215] (-580.522) (-583.841) (-574.001) * [-576.921] (-573.766) (-571.079) (-572.515) -- 0:00:55

      Average standard deviation of split frequencies: 0.043649

      35500 -- (-573.405) [-580.039] (-579.111) (-573.872) * (-573.649) (-576.723) (-573.064) [-575.844] -- 0:00:54
      36000 -- (-574.077) [-577.384] (-579.400) (-581.210) * (-581.430) [-577.160] (-575.860) (-574.569) -- 0:00:53
      36500 -- (-572.192) [-575.071] (-574.621) (-579.754) * [-577.727] (-571.100) (-580.072) (-578.503) -- 0:00:52
      37000 -- (-571.226) [-575.305] (-577.224) (-577.200) * (-578.728) (-572.891) (-576.247) [-573.228] -- 0:00:52
      37500 -- (-571.132) (-576.302) (-577.714) [-576.483] * (-578.912) (-573.737) (-571.883) [-572.634] -- 0:00:51
      38000 -- (-576.167) (-576.157) [-574.553] (-577.894) * (-582.468) [-577.311] (-578.503) (-573.203) -- 0:00:50
      38500 -- [-574.417] (-577.991) (-576.796) (-582.480) * (-576.263) (-575.987) (-580.072) [-574.248] -- 0:00:49
      39000 -- (-573.874) (-580.610) [-580.114] (-581.081) * (-574.426) (-571.629) (-575.766) [-571.668] -- 0:00:49
      39500 -- [-573.857] (-582.002) (-579.362) (-584.430) * (-576.609) (-571.919) (-574.877) [-571.279] -- 0:00:48
      40000 -- (-574.056) (-579.258) [-580.004] (-572.960) * [-573.660] (-572.244) (-574.354) (-574.359) -- 0:00:48

      Average standard deviation of split frequencies: 0.038640

      40500 -- (-571.469) (-578.344) [-575.033] (-572.280) * (-573.807) (-573.569) (-574.470) [-573.173] -- 0:00:47
      41000 -- (-573.951) (-575.715) [-574.733] (-572.606) * (-573.308) (-572.831) [-573.266] (-575.997) -- 0:00:46
      41500 -- (-572.298) (-579.320) (-582.256) [-571.536] * (-573.054) (-572.143) (-573.331) [-574.684] -- 0:00:46
      42000 -- (-572.448) (-577.301) [-576.937] (-573.761) * (-575.047) (-575.189) (-572.732) [-572.363] -- 0:00:45
      42500 -- (-571.185) [-577.612] (-581.302) (-573.926) * (-572.211) (-574.402) (-571.645) [-573.381] -- 0:00:45
      43000 -- (-572.002) [-576.111] (-576.160) (-573.702) * (-570.890) (-576.957) (-573.204) [-571.489] -- 0:00:44
      43500 -- (-573.440) [-580.206] (-576.071) (-571.865) * (-571.592) (-579.356) (-572.814) [-573.498] -- 0:00:43
      44000 -- [-571.483] (-581.113) (-574.275) (-572.231) * (-571.386) [-573.904] (-575.734) (-574.134) -- 0:00:43
      44500 -- [-574.510] (-578.811) (-579.333) (-572.379) * (-574.078) [-571.596] (-574.713) (-572.958) -- 0:00:42
      45000 -- (-572.863) (-582.789) (-576.812) [-572.170] * (-571.329) (-573.790) (-576.267) [-573.274] -- 0:01:03

      Average standard deviation of split frequencies: 0.034160

      45500 -- [-572.265] (-575.696) (-575.217) (-572.885) * (-570.751) (-572.484) [-574.244] (-571.509) -- 0:01:02
      46000 -- [-572.700] (-581.660) (-575.087) (-572.252) * [-572.036] (-572.282) (-576.223) (-575.968) -- 0:01:02
      46500 -- (-572.358) (-577.377) [-578.981] (-571.767) * (-573.610) (-574.061) (-573.851) [-575.589] -- 0:01:01
      47000 -- (-576.469) [-578.731] (-575.717) (-571.860) * [-573.191] (-572.476) (-577.016) (-572.011) -- 0:01:00
      47500 -- (-572.717) (-577.378) (-577.006) [-573.152] * [-574.732] (-573.747) (-573.039) (-575.989) -- 0:01:00
      48000 -- (-572.022) (-576.015) [-577.844] (-578.072) * [-575.319] (-572.886) (-573.289) (-574.126) -- 0:00:59
      48500 -- (-576.246) (-578.484) (-579.258) [-574.542] * (-574.336) [-576.241] (-575.804) (-578.340) -- 0:00:58
      49000 -- (-573.886) (-576.325) (-579.774) [-572.592] * (-575.072) (-572.507) (-571.038) [-572.433] -- 0:00:58
      49500 -- (-575.201) (-586.512) (-579.310) [-575.244] * (-574.849) [-576.460] (-571.679) (-574.063) -- 0:00:57
      50000 -- (-573.490) (-580.078) (-579.753) [-573.227] * [-575.088] (-573.435) (-571.002) (-573.422) -- 0:00:57

      Average standard deviation of split frequencies: 0.024811

      50500 -- (-572.139) (-573.661) [-576.019] (-572.239) * (-574.137) [-574.504] (-572.180) (-573.402) -- 0:00:56
      51000 -- (-570.848) (-574.145) [-579.192] (-572.344) * (-572.137) [-571.652] (-571.900) (-572.861) -- 0:00:55
      51500 -- (-572.933) (-572.710) [-577.487] (-574.158) * (-573.449) (-572.356) (-573.331) [-572.975] -- 0:00:55
      52000 -- [-573.465] (-573.861) (-576.291) (-575.643) * (-575.564) (-572.303) (-573.059) [-571.093] -- 0:00:54
      52500 -- (-572.617) (-579.494) [-577.032] (-574.546) * (-571.510) (-579.158) [-575.414] (-572.807) -- 0:00:54
      53000 -- (-571.815) [-575.207] (-581.392) (-574.238) * (-573.114) (-583.188) (-571.639) [-571.707] -- 0:00:53
      53500 -- (-573.822) [-582.038] (-578.055) (-573.401) * (-578.625) (-575.374) (-572.843) [-574.589] -- 0:00:53
      54000 -- (-573.039) (-579.846) [-578.705] (-573.445) * (-572.400) (-571.758) [-571.628] (-573.406) -- 0:00:52
      54500 -- [-574.716] (-575.764) (-576.942) (-573.032) * (-572.443) [-573.644] (-571.819) (-575.641) -- 0:00:52
      55000 -- (-573.197) (-574.680) [-578.563] (-572.192) * (-572.564) (-572.219) (-572.695) [-572.042] -- 0:00:51

      Average standard deviation of split frequencies: 0.022448

      55500 -- (-572.984) [-576.587] (-577.750) (-576.383) * [-573.434] (-577.049) (-571.925) (-573.482) -- 0:00:51
      56000 -- [-575.837] (-578.274) (-578.507) (-584.848) * [-572.276] (-571.875) (-572.562) (-576.085) -- 0:00:50
      56500 -- (-575.750) (-575.100) [-577.230] (-588.706) * (-571.854) [-575.051] (-579.627) (-576.667) -- 0:00:50
      57000 -- (-573.616) (-581.702) (-578.268) [-572.805] * [-572.137] (-572.301) (-575.035) (-577.405) -- 0:00:49
      57500 -- (-571.514) (-576.014) (-583.299) [-570.758] * [-573.090] (-573.091) (-571.547) (-574.984) -- 0:00:49
      58000 -- (-572.320) (-582.552) (-576.643) [-570.745] * (-572.870) [-573.775] (-572.286) (-571.771) -- 0:00:48
      58500 -- (-573.546) [-575.315] (-584.474) (-571.262) * (-575.318) (-571.186) (-576.281) [-573.544] -- 0:00:48
      59000 -- [-573.872] (-574.391) (-575.230) (-572.163) * (-571.927) [-572.570] (-573.374) (-572.590) -- 0:00:47
      59500 -- [-573.947] (-577.215) (-577.200) (-570.889) * [-572.096] (-576.712) (-574.344) (-573.031) -- 0:00:47
      60000 -- (-577.998) (-581.327) (-578.965) [-572.921] * (-572.239) (-573.282) [-574.773] (-573.000) -- 0:00:47

      Average standard deviation of split frequencies: 0.031082

      60500 -- [-575.125] (-577.799) (-580.471) (-573.226) * (-573.839) (-573.737) [-572.312] (-572.297) -- 0:00:46
      61000 -- (-576.600) [-575.536] (-575.199) (-571.544) * (-575.689) [-574.743] (-573.039) (-573.281) -- 0:00:46
      61500 -- (-573.628) (-578.265) (-585.036) [-575.452] * (-576.594) (-572.713) [-572.654] (-574.004) -- 0:00:45
      62000 -- (-575.134) [-582.084] (-582.518) (-573.214) * [-571.735] (-571.732) (-572.520) (-577.344) -- 0:00:45
      62500 -- (-575.646) (-577.075) [-575.280] (-574.810) * [-575.965] (-572.609) (-572.519) (-576.023) -- 0:00:45
      63000 -- (-573.589) (-577.538) (-573.285) [-574.008] * (-571.855) (-574.051) [-572.431] (-573.550) -- 0:00:44
      63500 -- (-573.706) [-573.938] (-574.179) (-575.972) * (-571.721) (-573.148) [-573.425] (-584.170) -- 0:00:44
      64000 -- (-575.581) (-572.927) (-572.943) [-572.267] * [-574.903] (-572.918) (-574.552) (-572.474) -- 0:00:43
      64500 -- (-575.740) (-573.229) [-576.257] (-572.087) * (-573.865) (-571.790) (-572.552) [-575.069] -- 0:00:58
      65000 -- (-574.787) (-573.571) (-574.166) [-572.708] * (-572.992) (-575.459) (-571.114) [-573.482] -- 0:00:57

      Average standard deviation of split frequencies: 0.028570

      65500 -- [-573.645] (-573.634) (-571.693) (-572.012) * (-570.901) (-574.621) (-572.052) [-571.581] -- 0:00:57
      66000 -- (-577.215) (-572.871) [-573.652] (-572.529) * (-574.011) [-573.241] (-571.912) (-571.470) -- 0:00:56
      66500 -- [-573.886] (-571.900) (-576.954) (-573.312) * [-571.622] (-573.951) (-570.958) (-581.095) -- 0:00:56
      67000 -- (-574.864) [-572.734] (-573.845) (-572.452) * (-572.980) (-574.133) [-573.098] (-575.709) -- 0:00:55
      67500 -- (-573.662) (-574.105) (-572.602) [-571.736] * (-572.328) (-571.916) (-573.384) [-571.859] -- 0:00:55
      68000 -- (-573.703) (-573.697) (-574.903) [-573.601] * (-575.645) [-572.041] (-573.887) (-572.914) -- 0:00:54
      68500 -- (-574.948) (-571.763) (-572.412) [-571.462] * (-574.470) [-572.427] (-573.047) (-572.579) -- 0:00:54
      69000 -- (-575.792) (-573.571) [-571.878] (-573.519) * (-571.233) [-572.261] (-573.428) (-575.369) -- 0:00:53
      69500 -- (-574.726) (-573.641) [-571.554] (-577.755) * (-574.767) (-574.185) (-573.759) [-574.776] -- 0:00:53
      70000 -- (-570.978) (-572.180) [-571.859] (-572.574) * (-574.061) (-575.608) (-572.792) [-572.703] -- 0:00:53

      Average standard deviation of split frequencies: 0.026683

      70500 -- (-575.513) (-572.316) [-573.103] (-572.933) * (-575.650) (-573.732) (-572.772) [-574.958] -- 0:00:52
      71000 -- (-575.987) (-571.301) [-573.670] (-572.182) * (-571.942) (-572.532) [-571.833] (-573.481) -- 0:00:52
      71500 -- [-572.222] (-572.793) (-577.784) (-574.836) * (-572.489) [-578.183] (-577.843) (-579.339) -- 0:00:51
      72000 -- (-576.166) (-574.092) (-571.619) [-572.809] * (-575.710) [-574.469] (-574.744) (-573.774) -- 0:00:51
      72500 -- (-576.067) (-578.435) (-571.656) [-572.112] * (-580.136) [-572.528] (-575.111) (-572.490) -- 0:00:51
      73000 -- (-576.481) [-573.293] (-575.485) (-571.966) * (-572.672) (-573.157) (-572.610) [-572.190] -- 0:00:50
      73500 -- [-571.350] (-572.165) (-578.528) (-571.372) * (-575.987) (-570.923) [-572.291] (-574.957) -- 0:00:50
      74000 -- [-571.524] (-573.587) (-571.386) (-572.959) * [-571.736] (-571.429) (-576.607) (-572.715) -- 0:00:50
      74500 -- [-571.857] (-574.075) (-571.756) (-580.795) * (-580.277) (-573.192) (-575.176) [-573.352] -- 0:00:49
      75000 -- (-574.125) (-571.969) (-571.961) [-571.047] * (-575.706) (-573.051) [-574.169] (-573.019) -- 0:00:49

      Average standard deviation of split frequencies: 0.020676

      75500 -- [-572.409] (-571.707) (-572.097) (-574.920) * (-573.295) (-570.934) (-570.851) [-572.570] -- 0:00:48
      76000 -- [-574.123] (-576.077) (-575.217) (-573.629) * (-576.318) (-572.943) [-573.593] (-580.244) -- 0:00:48
      76500 -- (-577.717) [-572.906] (-575.880) (-574.080) * (-574.315) [-571.997] (-571.419) (-574.731) -- 0:00:48
      77000 -- (-571.987) (-572.772) [-571.230] (-572.192) * (-573.528) (-576.447) (-574.758) [-573.289] -- 0:00:47
      77500 -- (-573.056) (-572.240) [-572.096] (-573.413) * [-574.094] (-577.992) (-573.393) (-577.133) -- 0:00:47
      78000 -- (-572.972) (-571.687) (-573.103) [-573.497] * (-571.700) (-578.297) [-571.308] (-575.861) -- 0:00:47
      78500 -- (-573.289) (-571.129) (-572.176) [-571.256] * [-573.156] (-573.807) (-573.330) (-573.603) -- 0:00:46
      79000 -- (-572.156) (-570.910) (-576.325) [-571.817] * (-570.839) [-574.987] (-577.800) (-574.943) -- 0:00:46
      79500 -- (-576.346) (-574.056) (-573.032) [-573.857] * (-572.064) [-571.887] (-572.189) (-571.963) -- 0:00:46
      80000 -- (-575.561) (-572.155) [-573.827] (-571.331) * [-574.499] (-571.539) (-573.206) (-572.322) -- 0:00:46

      Average standard deviation of split frequencies: 0.023375

      80500 -- [-572.817] (-571.374) (-574.752) (-572.240) * (-572.845) (-571.167) [-573.170] (-572.120) -- 0:00:45
      81000 -- (-571.739) (-571.913) [-574.974] (-573.135) * (-574.242) [-571.859] (-573.233) (-573.977) -- 0:00:45
      81500 -- (-575.081) (-573.443) (-572.901) [-571.622] * (-571.501) (-571.401) [-571.814] (-571.674) -- 0:00:45
      82000 -- (-577.189) (-573.062) [-571.660] (-573.111) * [-575.084] (-572.489) (-575.702) (-571.797) -- 0:00:44
      82500 -- (-571.628) (-573.047) [-571.674] (-575.256) * (-574.147) (-572.316) (-573.686) [-571.237] -- 0:00:44
      83000 -- (-577.465) (-574.016) (-573.170) [-574.695] * (-572.276) (-572.684) [-571.275] (-571.558) -- 0:00:44
      83500 -- (-573.117) (-580.965) (-571.590) [-573.172] * [-573.532] (-577.732) (-573.162) (-572.711) -- 0:00:43
      84000 -- (-573.536) (-581.665) [-573.752] (-571.386) * (-573.092) (-572.898) (-571.046) [-572.170] -- 0:00:43
      84500 -- (-572.992) [-573.448] (-572.032) (-570.848) * (-572.907) [-572.612] (-574.900) (-574.931) -- 0:00:43
      85000 -- (-573.268) [-574.319] (-573.066) (-573.542) * (-573.681) [-571.332] (-571.342) (-572.029) -- 0:00:53

      Average standard deviation of split frequencies: 0.018271

      85500 -- [-570.766] (-573.085) (-571.437) (-571.703) * (-572.382) (-573.528) (-573.250) [-570.830] -- 0:00:53
      86000 -- [-572.993] (-573.640) (-572.769) (-572.122) * (-571.534) (-573.148) (-572.455) [-571.613] -- 0:00:53
      86500 -- [-575.158] (-573.539) (-578.436) (-571.684) * (-572.451) [-574.527] (-572.614) (-572.457) -- 0:00:52
      87000 -- (-571.432) [-573.739] (-570.946) (-571.358) * (-571.753) (-572.736) (-572.194) [-576.055] -- 0:00:52
      87500 -- (-572.997) (-575.612) [-571.504] (-572.219) * (-572.178) (-570.871) (-572.711) [-574.339] -- 0:00:52
      88000 -- (-576.708) [-576.005] (-570.913) (-571.600) * [-572.397] (-576.159) (-573.524) (-571.108) -- 0:00:51
      88500 -- (-575.533) (-576.179) (-571.464) [-575.865] * [-572.281] (-576.073) (-572.248) (-574.494) -- 0:00:51
      89000 -- (-572.926) [-578.163] (-575.692) (-572.668) * (-573.121) (-575.293) (-572.342) [-571.833] -- 0:00:51
      89500 -- (-576.156) (-571.184) [-571.356] (-576.043) * (-571.789) (-576.097) [-573.736] (-571.510) -- 0:00:50
      90000 -- (-576.987) (-576.633) [-576.561] (-576.387) * [-572.618] (-575.493) (-573.515) (-575.695) -- 0:00:50

      Average standard deviation of split frequencies: 0.010399

      90500 -- (-573.102) (-573.541) (-582.261) [-571.776] * (-572.335) (-573.374) [-571.362] (-573.890) -- 0:00:50
      91000 -- (-575.088) (-575.111) (-574.492) [-574.252] * (-574.366) [-572.745] (-571.492) (-572.854) -- 0:00:49
      91500 -- (-574.933) (-573.914) (-574.069) [-574.309] * (-575.845) (-573.908) (-573.543) [-573.338] -- 0:00:49
      92000 -- (-573.830) [-572.008] (-571.838) (-570.849) * (-573.789) [-571.163] (-575.047) (-573.050) -- 0:00:49
      92500 -- [-572.309] (-575.384) (-571.736) (-573.054) * (-573.151) [-572.057] (-572.313) (-574.400) -- 0:00:49
      93000 -- (-574.503) [-574.178] (-573.278) (-572.945) * (-582.932) [-572.316] (-571.267) (-571.565) -- 0:00:48
      93500 -- (-572.410) (-571.270) [-571.345] (-574.089) * (-576.487) [-574.995] (-573.294) (-576.033) -- 0:00:48
      94000 -- (-572.933) (-573.205) [-571.924] (-572.801) * (-572.252) (-573.476) [-572.559] (-574.308) -- 0:00:48
      94500 -- [-572.916] (-572.353) (-573.407) (-572.277) * (-572.308) (-572.990) [-573.286] (-573.312) -- 0:00:47
      95000 -- (-576.733) (-573.720) (-574.460) [-572.823] * (-573.379) (-572.433) (-572.716) [-572.811] -- 0:00:47

      Average standard deviation of split frequencies: 0.019642

      95500 -- (-572.661) (-571.208) [-572.870] (-573.643) * (-574.501) (-571.680) [-572.281] (-573.508) -- 0:00:47
      96000 -- (-574.830) (-571.031) [-572.233] (-576.514) * (-575.680) (-577.592) [-571.984] (-574.599) -- 0:00:47
      96500 -- [-574.011] (-575.392) (-572.218) (-571.283) * (-571.873) (-576.702) (-573.653) [-575.188] -- 0:00:46
      97000 -- [-573.389] (-574.754) (-575.432) (-576.679) * (-573.443) [-572.205] (-579.229) (-584.288) -- 0:00:46
      97500 -- (-576.208) (-573.318) [-572.772] (-572.832) * (-571.547) (-572.204) (-577.300) [-574.311] -- 0:00:46
      98000 -- [-571.450] (-574.843) (-572.289) (-574.177) * (-575.749) (-572.782) (-572.257) [-571.198] -- 0:00:46
      98500 -- [-572.652] (-572.303) (-572.320) (-572.316) * (-572.088) [-570.710] (-572.828) (-572.353) -- 0:00:45
      99000 -- (-572.231) [-573.157] (-573.783) (-571.211) * (-572.690) (-572.696) [-574.015] (-573.168) -- 0:00:45
      99500 -- (-571.224) [-572.504] (-571.214) (-571.985) * (-573.801) (-574.323) (-576.618) [-573.636] -- 0:00:45
      100000 -- [-570.841] (-573.061) (-572.598) (-573.471) * (-576.504) [-573.126] (-576.350) (-577.808) -- 0:00:45

      Average standard deviation of split frequencies: 0.024975

      100500 -- (-572.517) (-573.886) [-571.874] (-573.473) * [-574.855] (-573.074) (-572.628) (-574.518) -- 0:00:44
      101000 -- (-573.759) (-571.073) (-576.269) [-571.891] * (-573.542) [-571.844] (-572.221) (-575.388) -- 0:00:44
      101500 -- [-571.315] (-575.467) (-573.456) (-581.569) * (-575.217) [-572.944] (-573.931) (-575.000) -- 0:00:44
      102000 -- (-572.094) [-572.651] (-574.991) (-573.480) * [-576.054] (-571.360) (-572.426) (-571.091) -- 0:00:44
      102500 -- (-571.800) (-571.971) (-575.379) [-577.170] * (-575.137) (-573.842) (-574.446) [-572.146] -- 0:00:43
      103000 -- (-573.700) (-572.492) [-573.378] (-575.527) * [-575.888] (-572.825) (-575.288) (-572.667) -- 0:00:43
      103500 -- (-577.855) [-576.841] (-572.972) (-573.595) * (-573.246) (-572.384) [-572.029] (-575.005) -- 0:00:43
      104000 -- (-574.933) (-575.081) (-573.341) [-575.696] * (-574.795) (-576.950) (-572.005) [-575.911] -- 0:00:43
      104500 -- (-572.167) (-576.345) (-572.422) [-573.217] * (-572.427) [-574.111] (-573.939) (-572.875) -- 0:00:42
      105000 -- [-572.452] (-574.809) (-575.586) (-575.308) * (-573.645) (-572.748) [-572.947] (-571.864) -- 0:00:42

      Average standard deviation of split frequencies: 0.023718

      105500 -- (-573.053) (-573.900) (-571.538) [-572.337] * [-571.439] (-575.535) (-573.031) (-576.318) -- 0:00:42
      106000 -- (-572.937) (-574.585) (-575.265) [-571.735] * (-572.391) (-577.336) (-573.891) [-571.714] -- 0:00:42
      106500 -- (-573.702) (-572.670) [-573.586] (-573.424) * (-573.401) (-575.105) (-572.348) [-572.942] -- 0:00:41
      107000 -- (-574.059) (-571.714) [-573.026] (-574.947) * [-572.094] (-573.282) (-572.966) (-573.688) -- 0:00:41
      107500 -- [-573.623] (-571.131) (-571.843) (-571.370) * (-573.862) [-571.985] (-572.951) (-575.538) -- 0:00:49
      108000 -- [-571.885] (-572.361) (-575.052) (-575.978) * (-573.795) (-572.327) (-573.478) [-574.070] -- 0:00:49
      108500 -- (-577.705) (-575.807) [-571.206] (-579.130) * (-576.827) [-573.374] (-574.473) (-571.337) -- 0:00:49
      109000 -- (-571.667) (-572.776) [-572.229] (-579.993) * (-575.470) (-572.205) (-577.007) [-572.154] -- 0:00:49
      109500 -- [-572.716] (-575.523) (-572.416) (-572.164) * [-574.323] (-573.347) (-574.874) (-570.976) -- 0:00:48
      110000 -- (-577.701) [-570.932] (-574.384) (-572.265) * [-571.575] (-573.616) (-581.371) (-573.685) -- 0:00:48

      Average standard deviation of split frequencies: 0.017039

      110500 -- (-573.489) (-571.103) [-575.854] (-571.442) * (-571.523) [-571.272] (-573.836) (-570.958) -- 0:00:48
      111000 -- (-573.357) (-574.472) [-572.467] (-571.516) * (-572.191) (-573.924) [-574.451] (-574.084) -- 0:00:48
      111500 -- [-576.654] (-572.314) (-574.589) (-572.269) * (-573.689) [-575.233] (-571.951) (-572.865) -- 0:00:47
      112000 -- [-573.412] (-572.603) (-574.617) (-571.778) * [-573.069] (-573.228) (-572.332) (-572.283) -- 0:00:47
      112500 -- (-574.146) (-575.415) (-573.879) [-573.977] * (-572.724) (-576.402) [-572.405] (-571.480) -- 0:00:47
      113000 -- (-577.900) [-575.758] (-576.560) (-571.222) * (-577.312) (-577.817) (-578.691) [-572.404] -- 0:00:47
      113500 -- (-575.163) [-572.671] (-574.345) (-576.694) * (-573.627) (-574.476) [-571.443] (-572.370) -- 0:00:46
      114000 -- (-571.304) (-572.675) (-576.901) [-574.593] * (-571.843) (-574.032) (-573.956) [-572.462] -- 0:00:46
      114500 -- (-573.699) (-573.922) (-573.802) [-572.082] * (-571.129) (-572.572) (-572.026) [-574.709] -- 0:00:46
      115000 -- (-572.207) (-571.877) [-576.749] (-571.314) * (-572.486) (-574.555) (-571.809) [-572.974] -- 0:00:46

      Average standard deviation of split frequencies: 0.016255

      115500 -- [-574.362] (-575.103) (-574.943) (-572.414) * (-573.363) (-570.897) (-573.988) [-574.354] -- 0:00:45
      116000 -- [-573.294] (-573.690) (-575.640) (-573.291) * (-572.742) (-572.249) [-573.778] (-573.962) -- 0:00:45
      116500 -- (-574.358) (-571.406) [-574.359] (-572.145) * [-573.784] (-571.206) (-575.769) (-573.829) -- 0:00:45
      117000 -- (-571.905) (-573.534) [-576.893] (-571.805) * (-575.214) (-573.630) (-576.494) [-573.309] -- 0:00:45
      117500 -- [-575.231] (-572.073) (-575.529) (-571.189) * (-572.086) (-575.543) (-571.161) [-573.359] -- 0:00:45
      118000 -- (-575.209) (-571.901) (-572.989) [-571.314] * [-571.839] (-573.446) (-571.153) (-572.271) -- 0:00:44
      118500 -- [-571.047] (-571.909) (-575.934) (-572.413) * (-571.595) (-573.242) (-572.090) [-572.033] -- 0:00:44
      119000 -- (-575.533) (-571.511) [-573.484] (-576.089) * (-571.949) (-571.226) (-575.728) [-571.861] -- 0:00:44
      119500 -- (-577.068) (-573.042) [-575.068] (-573.689) * (-576.474) (-574.347) [-573.396] (-573.064) -- 0:00:44
      120000 -- (-572.291) [-572.840] (-571.869) (-575.023) * (-572.765) [-573.183] (-573.418) (-573.857) -- 0:00:44

      Average standard deviation of split frequencies: 0.005209

      120500 -- [-570.948] (-573.566) (-573.353) (-574.567) * (-572.208) [-573.595] (-571.961) (-572.777) -- 0:00:43
      121000 -- (-571.932) [-571.115] (-573.299) (-573.633) * (-572.077) (-571.972) (-572.240) [-571.121] -- 0:00:43
      121500 -- [-573.973] (-571.701) (-572.576) (-576.021) * (-573.800) [-572.406] (-572.630) (-573.142) -- 0:00:43
      122000 -- (-575.486) [-571.531] (-575.405) (-575.175) * [-572.778] (-574.264) (-572.603) (-573.342) -- 0:00:43
      122500 -- (-577.411) (-572.355) [-572.282] (-574.861) * (-573.830) [-573.079] (-573.939) (-571.619) -- 0:00:42
      123000 -- (-574.077) (-573.792) [-571.707] (-571.934) * (-575.371) (-571.835) (-578.215) [-573.198] -- 0:00:42
      123500 -- (-572.980) (-571.987) (-570.962) [-574.714] * (-571.846) (-571.874) (-572.395) [-577.256] -- 0:00:42
      124000 -- [-571.173] (-572.222) (-570.787) (-572.714) * (-571.722) (-571.325) [-572.591] (-574.068) -- 0:00:42
      124500 -- (-571.528) (-571.975) (-571.071) [-573.737] * (-570.990) (-573.357) [-571.537] (-574.949) -- 0:00:42
      125000 -- (-572.901) [-571.056] (-571.940) (-572.000) * [-570.848] (-573.151) (-576.642) (-576.271) -- 0:00:42

      Average standard deviation of split frequencies: 0.012471

      125500 -- (-573.954) (-572.241) [-573.718] (-571.333) * (-571.674) [-573.266] (-572.394) (-574.265) -- 0:00:41
      126000 -- [-574.071] (-575.031) (-571.632) (-572.968) * (-571.758) (-572.900) (-574.985) [-572.280] -- 0:00:41
      126500 -- (-573.608) [-573.282] (-575.681) (-572.559) * (-573.203) [-572.232] (-575.324) (-573.301) -- 0:00:41
      127000 -- (-573.384) [-572.806] (-575.315) (-573.358) * [-573.800] (-572.173) (-575.570) (-572.585) -- 0:00:41
      127500 -- (-570.740) (-576.190) [-576.575] (-575.738) * (-575.419) (-574.190) (-571.425) [-572.624] -- 0:00:41
      128000 -- [-572.576] (-572.664) (-574.169) (-575.753) * (-572.851) [-577.219] (-573.617) (-572.906) -- 0:00:40
      128500 -- [-574.497] (-572.728) (-571.412) (-572.790) * (-571.218) (-574.772) (-573.486) [-572.370] -- 0:00:40
      129000 -- (-572.102) (-573.749) (-574.584) [-573.561] * (-572.039) [-573.342] (-574.445) (-571.311) -- 0:00:40
      129500 -- (-574.840) (-574.310) [-579.415] (-575.075) * (-572.437) [-571.742] (-576.496) (-572.762) -- 0:00:40
      130000 -- (-571.640) (-572.756) (-572.193) [-574.280] * (-572.187) (-572.804) (-572.738) [-572.448] -- 0:00:40

      Average standard deviation of split frequencies: 0.012026

      130500 -- (-575.082) [-571.816] (-575.355) (-581.622) * (-571.412) [-574.468] (-571.924) (-575.439) -- 0:00:46
      131000 -- (-575.685) (-572.497) (-572.974) [-575.593] * (-571.693) [-572.091] (-572.717) (-571.436) -- 0:00:46
      131500 -- (-572.337) [-573.600] (-578.150) (-576.156) * (-574.477) [-572.239] (-573.887) (-573.312) -- 0:00:46
      132000 -- (-571.080) (-572.644) [-573.410] (-573.218) * (-571.709) (-574.981) (-572.877) [-574.122] -- 0:00:46
      132500 -- [-571.487] (-573.363) (-573.178) (-573.734) * (-571.996) (-576.143) [-571.037] (-574.296) -- 0:00:45
      133000 -- (-571.679) (-572.092) [-573.961] (-573.433) * [-571.813] (-576.398) (-576.356) (-571.997) -- 0:00:45
      133500 -- (-574.465) (-572.350) [-572.454] (-573.249) * [-574.309] (-576.122) (-572.019) (-571.834) -- 0:00:45
      134000 -- (-571.616) (-575.411) [-571.126] (-573.890) * [-573.281] (-574.963) (-578.347) (-571.531) -- 0:00:45
      134500 -- [-574.699] (-574.076) (-573.085) (-573.270) * (-576.189) [-572.960] (-571.570) (-573.244) -- 0:00:45
      135000 -- (-575.148) (-572.038) (-574.245) [-574.692] * (-577.719) [-573.974] (-571.490) (-573.207) -- 0:00:44

      Average standard deviation of split frequencies: 0.016176

      135500 -- (-573.364) [-573.008] (-574.176) (-572.131) * [-574.309] (-574.198) (-576.263) (-574.862) -- 0:00:44
      136000 -- (-577.834) (-573.075) [-571.644] (-573.405) * (-572.663) (-574.342) [-572.612] (-573.325) -- 0:00:44
      136500 -- (-571.081) (-573.992) [-571.961] (-572.411) * (-578.281) [-573.729] (-572.140) (-571.266) -- 0:00:44
      137000 -- (-575.288) (-572.484) [-571.508] (-573.317) * (-575.554) (-575.528) (-571.643) [-572.889] -- 0:00:44
      137500 -- [-572.905] (-573.744) (-572.074) (-572.272) * (-572.826) (-573.060) (-572.302) [-571.263] -- 0:00:43
      138000 -- [-574.463] (-573.480) (-574.558) (-572.643) * [-575.549] (-572.299) (-575.218) (-572.174) -- 0:00:43
      138500 -- [-574.130] (-574.014) (-574.891) (-574.380) * (-571.524) (-573.820) (-572.189) [-572.109] -- 0:00:43
      139000 -- [-574.112] (-575.903) (-572.559) (-571.890) * (-571.249) (-572.243) (-571.757) [-572.464] -- 0:00:43
      139500 -- (-573.257) (-577.845) [-572.147] (-573.591) * (-571.881) (-571.278) [-575.973] (-571.339) -- 0:00:43
      140000 -- (-572.018) (-573.792) [-571.818] (-571.869) * (-577.782) (-573.795) [-573.174] (-572.145) -- 0:00:43

      Average standard deviation of split frequencies: 0.017873

      140500 -- (-572.184) (-573.807) [-572.126] (-573.142) * (-575.136) (-571.677) [-572.637] (-573.070) -- 0:00:42
      141000 -- [-572.093] (-573.456) (-573.858) (-572.544) * (-572.768) (-571.463) [-573.259] (-575.837) -- 0:00:42
      141500 -- (-575.085) (-572.200) (-575.084) [-574.179] * (-574.937) [-571.238] (-575.837) (-573.486) -- 0:00:42
      142000 -- (-572.387) (-572.984) (-571.230) [-571.068] * (-573.476) (-571.774) [-573.530] (-574.607) -- 0:00:42
      142500 -- [-573.387] (-572.838) (-574.339) (-572.350) * (-572.805) (-573.053) (-572.726) [-572.772] -- 0:00:42
      143000 -- (-574.154) (-579.846) (-573.493) [-572.506] * (-574.380) (-571.167) (-573.411) [-573.078] -- 0:00:41
      143500 -- (-573.650) [-575.109] (-575.135) (-576.298) * (-573.089) (-578.945) (-574.897) [-575.275] -- 0:00:41
      144000 -- (-574.202) (-572.826) [-573.249] (-573.897) * (-572.128) [-577.889] (-572.801) (-572.606) -- 0:00:41
      144500 -- (-573.476) (-578.016) (-574.643) [-572.792] * (-571.730) (-574.107) [-572.931] (-573.208) -- 0:00:41
      145000 -- (-573.007) (-572.546) [-573.007] (-574.066) * (-573.834) (-573.409) (-574.324) [-574.464] -- 0:00:41

      Average standard deviation of split frequencies: 0.019373

      145500 -- (-573.334) [-571.006] (-572.069) (-573.675) * (-576.412) (-575.480) [-572.237] (-572.338) -- 0:00:41
      146000 -- (-571.427) (-571.705) [-576.149] (-576.669) * (-576.470) (-572.667) (-572.892) [-572.281] -- 0:00:40
      146500 -- (-573.015) [-574.195] (-572.596) (-577.997) * (-572.147) [-576.924] (-572.554) (-572.282) -- 0:00:40
      147000 -- [-573.327] (-570.906) (-577.797) (-572.346) * [-572.057] (-574.366) (-573.057) (-574.467) -- 0:00:40
      147500 -- (-571.630) [-571.619] (-575.640) (-571.996) * (-578.232) (-577.358) (-575.383) [-572.465] -- 0:00:40
      148000 -- [-572.321] (-572.595) (-578.840) (-572.606) * (-571.897) (-572.001) (-578.017) [-575.876] -- 0:00:40
      148500 -- [-572.357] (-575.444) (-572.077) (-577.394) * (-576.936) (-575.901) [-572.326] (-572.443) -- 0:00:40
      149000 -- (-574.163) (-572.944) (-571.425) [-572.599] * (-582.208) [-573.852] (-572.382) (-571.475) -- 0:00:39
      149500 -- (-572.306) (-573.797) (-573.087) [-572.515] * [-574.424] (-573.224) (-575.581) (-572.147) -- 0:00:39
      150000 -- [-572.483] (-574.379) (-573.665) (-573.106) * [-572.538] (-573.832) (-571.711) (-574.509) -- 0:00:39

      Average standard deviation of split frequencies: 0.020859

      150500 -- (-571.730) (-574.528) [-571.339] (-574.983) * (-573.543) (-573.044) (-572.658) [-576.112] -- 0:00:39
      151000 -- (-572.123) (-572.261) (-577.053) [-572.384] * (-578.897) (-571.420) (-571.663) [-574.586] -- 0:00:39
      151500 -- (-572.035) (-571.616) [-572.878] (-573.775) * (-572.312) (-574.351) [-575.989] (-573.006) -- 0:00:39
      152000 -- (-573.822) (-571.629) (-572.076) [-578.518] * [-572.475] (-571.125) (-573.588) (-572.166) -- 0:00:39
      152500 -- (-572.806) (-571.595) [-571.882] (-574.729) * [-572.829] (-571.705) (-575.118) (-572.753) -- 0:00:38
      153000 -- (-576.588) (-575.001) (-576.740) [-573.453] * (-571.418) (-573.346) (-574.893) [-573.894] -- 0:00:44
      153500 -- (-572.192) (-573.123) (-573.592) [-572.126] * [-572.425] (-574.747) (-574.062) (-572.929) -- 0:00:44
      154000 -- (-573.249) (-572.186) [-574.815] (-576.593) * [-571.170] (-572.416) (-572.819) (-572.766) -- 0:00:43
      154500 -- [-572.676] (-575.604) (-572.044) (-573.976) * (-573.502) (-574.425) (-575.805) [-572.796] -- 0:00:43
      155000 -- (-574.632) (-574.014) (-573.143) [-571.554] * [-574.301] (-574.627) (-571.604) (-573.034) -- 0:00:43

      Average standard deviation of split frequencies: 0.014102

      155500 -- (-573.972) (-572.020) (-571.619) [-575.320] * (-571.302) (-574.941) (-572.656) [-572.930] -- 0:00:43
      156000 -- [-572.658] (-575.956) (-575.861) (-571.704) * (-573.732) (-572.357) (-575.712) [-572.880] -- 0:00:43
      156500 -- (-571.889) [-574.843] (-570.806) (-572.470) * (-575.354) (-576.994) [-580.532] (-572.222) -- 0:00:43
      157000 -- (-573.989) (-572.544) (-574.592) [-572.907] * (-574.588) (-579.911) (-572.040) [-571.959] -- 0:00:42
      157500 -- (-574.334) [-571.907] (-572.881) (-571.976) * (-574.200) [-571.793] (-573.368) (-571.548) -- 0:00:42
      158000 -- [-575.267] (-572.725) (-573.798) (-571.707) * [-571.960] (-577.028) (-574.824) (-574.860) -- 0:00:42
      158500 -- [-573.299] (-573.276) (-573.456) (-575.742) * (-572.905) (-574.552) (-576.460) [-572.882] -- 0:00:42
      159000 -- [-571.681] (-572.772) (-573.432) (-571.692) * [-572.146] (-571.613) (-573.919) (-573.195) -- 0:00:42
      159500 -- (-575.351) [-573.950] (-574.808) (-571.753) * [-570.983] (-576.147) (-572.815) (-571.795) -- 0:00:42
      160000 -- (-572.160) (-572.449) (-571.851) [-572.087] * (-572.705) (-574.271) [-572.106] (-572.980) -- 0:00:42

      Average standard deviation of split frequencies: 0.019560

      160500 -- [-574.920] (-575.293) (-573.261) (-573.506) * [-572.970] (-578.051) (-573.287) (-574.017) -- 0:00:41
      161000 -- (-575.312) (-577.419) [-573.262] (-577.100) * [-574.582] (-572.351) (-571.681) (-571.153) -- 0:00:41
      161500 -- [-573.196] (-573.920) (-572.759) (-572.893) * (-575.728) [-571.880] (-571.760) (-572.120) -- 0:00:41
      162000 -- (-572.381) [-574.736] (-572.807) (-573.809) * [-572.928] (-571.038) (-572.342) (-575.532) -- 0:00:41
      162500 -- (-572.133) (-577.024) [-576.865] (-573.600) * (-574.113) [-572.728] (-572.683) (-573.158) -- 0:00:41
      163000 -- (-571.018) [-571.197] (-574.207) (-571.582) * (-571.603) (-573.916) [-574.212] (-572.849) -- 0:00:41
      163500 -- (-575.401) (-579.130) [-576.235] (-573.140) * [-571.387] (-571.349) (-573.126) (-571.147) -- 0:00:40
      164000 -- (-574.051) [-574.342] (-571.589) (-575.454) * (-573.056) (-573.087) [-573.095] (-573.557) -- 0:00:40
      164500 -- (-574.827) (-578.696) (-574.563) [-572.345] * (-573.976) (-573.346) [-572.589] (-574.518) -- 0:00:40
      165000 -- (-572.452) [-573.653] (-573.159) (-572.982) * (-572.002) (-573.762) (-573.011) [-572.971] -- 0:00:40

      Average standard deviation of split frequencies: 0.022718

      165500 -- (-573.614) (-573.259) (-575.016) [-572.101] * (-573.032) (-572.941) (-573.524) [-573.000] -- 0:00:40
      166000 -- (-572.386) (-575.235) (-573.294) [-572.774] * (-571.642) (-574.492) (-571.805) [-575.148] -- 0:00:40
      166500 -- (-572.381) (-574.799) [-572.036] (-573.685) * [-574.464] (-576.955) (-575.737) (-575.856) -- 0:00:40
      167000 -- (-571.479) (-571.631) [-572.225] (-571.939) * (-571.758) [-574.044] (-578.812) (-573.958) -- 0:00:39
      167500 -- (-571.640) (-574.414) (-572.914) [-571.576] * (-572.538) (-571.964) [-571.216] (-571.696) -- 0:00:39
      168000 -- (-571.549) (-573.312) (-572.881) [-575.439] * (-572.870) (-572.504) (-572.426) [-574.988] -- 0:00:39
      168500 -- (-572.114) (-572.775) (-577.245) [-572.385] * (-576.960) [-573.685] (-573.349) (-574.119) -- 0:00:39
      169000 -- [-572.189] (-573.602) (-573.358) (-573.201) * [-574.878] (-576.086) (-571.792) (-573.263) -- 0:00:39
      169500 -- (-572.179) (-572.633) [-572.765] (-573.023) * (-575.178) (-577.722) [-573.053] (-578.043) -- 0:00:39
      170000 -- (-571.452) (-577.324) (-573.714) [-577.062] * [-572.085] (-580.704) (-573.753) (-573.202) -- 0:00:39

      Average standard deviation of split frequencies: 0.020256

      170500 -- (-572.203) (-573.996) [-572.077] (-578.651) * (-573.298) (-576.311) (-576.316) [-573.523] -- 0:00:38
      171000 -- [-573.117] (-573.633) (-575.037) (-572.376) * (-572.785) (-573.729) (-573.480) [-573.388] -- 0:00:38
      171500 -- (-571.301) (-571.821) [-572.187] (-574.862) * (-572.859) (-575.134) (-573.580) [-575.691] -- 0:00:38
      172000 -- [-573.714] (-572.282) (-574.360) (-571.761) * (-573.048) (-574.195) [-575.760] (-575.808) -- 0:00:38
      172500 -- (-574.788) (-572.420) [-572.508] (-571.594) * (-573.249) (-573.270) [-573.895] (-571.844) -- 0:00:38
      173000 -- (-572.480) (-575.389) (-572.935) [-572.738] * [-574.039] (-572.479) (-573.544) (-570.978) -- 0:00:38
      173500 -- [-572.515] (-572.213) (-573.974) (-571.783) * (-574.374) (-575.502) [-571.186] (-572.151) -- 0:00:38
      174000 -- (-578.874) [-575.120] (-573.946) (-573.470) * (-573.163) [-572.830] (-573.656) (-573.136) -- 0:00:37
      174500 -- [-572.310] (-574.115) (-571.282) (-570.998) * (-572.498) [-573.902] (-572.549) (-575.769) -- 0:00:37
      175000 -- (-572.052) [-574.624] (-573.546) (-572.257) * (-572.275) (-575.007) (-574.616) [-572.931] -- 0:00:42

      Average standard deviation of split frequencies: 0.016071

      175500 -- (-572.687) (-573.085) (-573.795) [-573.068] * (-571.086) [-572.395] (-576.129) (-574.833) -- 0:00:42
      176000 -- (-573.771) [-571.800] (-574.856) (-573.191) * (-576.288) [-571.572] (-575.462) (-572.529) -- 0:00:42
      176500 -- (-572.072) (-575.900) [-572.333] (-574.411) * (-572.501) [-572.813] (-573.626) (-575.113) -- 0:00:41
      177000 -- (-571.297) (-574.183) (-572.865) [-575.908] * [-573.272] (-575.082) (-572.790) (-572.058) -- 0:00:41
      177500 -- (-571.914) (-573.987) [-571.048] (-574.820) * (-576.254) [-574.026] (-575.580) (-575.258) -- 0:00:41
      178000 -- (-571.961) (-571.776) [-571.744] (-576.063) * (-575.747) [-572.888] (-575.151) (-576.295) -- 0:00:41
      178500 -- (-572.193) (-571.714) [-571.905] (-572.966) * [-573.482] (-572.722) (-571.709) (-577.532) -- 0:00:41
      179000 -- (-575.207) (-573.764) (-573.997) [-572.529] * (-571.777) (-574.185) (-573.897) [-574.253] -- 0:00:41
      179500 -- (-573.532) (-571.630) (-574.056) [-573.098] * [-572.735] (-573.871) (-574.313) (-574.095) -- 0:00:41
      180000 -- [-573.273] (-575.838) (-572.113) (-571.307) * [-574.405] (-574.621) (-574.098) (-574.129) -- 0:00:41

      Average standard deviation of split frequencies: 0.017395

      180500 -- [-575.683] (-573.316) (-574.297) (-572.422) * (-574.824) (-580.826) [-573.488] (-571.870) -- 0:00:40
      181000 -- [-573.227] (-575.054) (-573.188) (-575.044) * (-575.704) (-573.079) [-574.434] (-572.078) -- 0:00:40
      181500 -- [-572.104] (-572.767) (-575.440) (-574.859) * (-576.549) (-575.330) (-575.184) [-571.851] -- 0:00:40
      182000 -- (-574.826) (-574.782) [-575.216] (-571.467) * (-574.120) (-574.350) [-575.979] (-574.374) -- 0:00:40
      182500 -- (-573.944) (-571.109) (-571.522) [-577.328] * [-571.865] (-574.779) (-572.821) (-579.954) -- 0:00:40
      183000 -- (-573.392) (-575.394) (-574.861) [-571.510] * (-574.697) (-576.769) [-571.976] (-571.646) -- 0:00:40
      183500 -- (-572.476) [-573.799] (-572.428) (-574.706) * [-572.924] (-574.423) (-573.630) (-571.912) -- 0:00:40
      184000 -- (-574.890) (-575.103) [-571.528] (-572.573) * (-573.940) (-572.415) (-573.890) [-576.180] -- 0:00:39
      184500 -- [-571.878] (-573.625) (-571.750) (-574.833) * (-574.425) (-572.616) (-574.477) [-575.086] -- 0:00:39
      185000 -- (-571.326) [-572.371] (-573.433) (-571.674) * [-575.950] (-572.306) (-572.705) (-571.029) -- 0:00:39

      Average standard deviation of split frequencies: 0.018586

      185500 -- (-572.993) (-573.300) [-571.274] (-572.600) * [-571.690] (-575.585) (-573.823) (-571.798) -- 0:00:39
      186000 -- (-574.449) (-572.664) [-571.670] (-576.019) * (-575.610) [-572.207] (-574.192) (-572.447) -- 0:00:39
      186500 -- [-574.252] (-573.436) (-577.801) (-575.521) * (-572.431) (-573.810) [-572.797] (-571.317) -- 0:00:39
      187000 -- (-573.775) (-571.949) [-572.242] (-571.482) * (-574.226) [-573.901] (-572.570) (-575.612) -- 0:00:39
      187500 -- (-573.745) [-572.620] (-575.739) (-571.090) * (-571.839) [-571.833] (-572.585) (-577.481) -- 0:00:39
      188000 -- (-571.796) [-574.183] (-578.814) (-571.961) * [-570.979] (-574.855) (-577.415) (-574.326) -- 0:00:38
      188500 -- [-570.680] (-571.869) (-571.229) (-571.951) * (-572.591) (-574.377) (-573.346) [-572.329] -- 0:00:38
      189000 -- [-572.540] (-573.279) (-572.450) (-571.593) * [-578.188] (-574.191) (-572.255) (-572.682) -- 0:00:38
      189500 -- (-578.467) (-572.691) (-572.467) [-571.765] * (-574.570) (-573.506) (-572.840) [-572.867] -- 0:00:38
      190000 -- (-572.785) [-576.781] (-574.471) (-573.988) * [-572.090] (-573.137) (-574.699) (-575.227) -- 0:00:38

      Average standard deviation of split frequencies: 0.013186

      190500 -- (-573.922) [-572.423] (-572.404) (-574.321) * [-572.678] (-572.077) (-573.659) (-572.560) -- 0:00:38
      191000 -- (-573.915) (-573.028) (-575.391) [-572.193] * [-573.689] (-572.655) (-572.615) (-572.667) -- 0:00:38
      191500 -- (-573.652) [-570.989] (-575.954) (-574.865) * (-576.368) (-571.568) [-573.736] (-572.616) -- 0:00:37
      192000 -- [-572.699] (-571.820) (-571.995) (-575.087) * (-575.359) (-574.690) (-573.561) [-571.146] -- 0:00:37
      192500 -- (-578.707) (-573.163) (-571.885) [-574.765] * [-571.967] (-573.054) (-574.821) (-573.552) -- 0:00:37
      193000 -- (-574.519) (-573.396) (-576.089) [-576.465] * [-573.770] (-571.054) (-577.059) (-574.207) -- 0:00:37
      193500 -- [-573.236] (-571.225) (-572.687) (-578.363) * (-577.312) [-571.133] (-573.505) (-572.172) -- 0:00:37
      194000 -- (-572.963) (-571.504) [-570.990] (-573.858) * (-573.258) (-574.390) (-573.799) [-574.130] -- 0:00:37
      194500 -- (-571.157) (-574.005) [-576.608] (-575.820) * (-573.276) [-574.682] (-573.156) (-573.896) -- 0:00:37
      195000 -- [-572.159] (-574.480) (-575.778) (-581.173) * (-572.452) [-573.201] (-572.223) (-573.375) -- 0:00:37

      Average standard deviation of split frequencies: 0.016034

      195500 -- (-573.165) (-573.017) (-571.499) [-575.097] * (-574.521) (-571.887) [-576.243] (-572.337) -- 0:00:37
      196000 -- [-573.276] (-571.951) (-571.542) (-571.823) * [-571.831] (-575.942) (-573.691) (-574.159) -- 0:00:36
      196500 -- (-572.534) [-573.589] (-573.066) (-573.690) * [-572.520] (-575.379) (-572.103) (-572.470) -- 0:00:36
      197000 -- (-572.611) (-574.876) (-571.423) [-575.208] * (-570.994) (-572.154) (-576.911) [-572.153] -- 0:00:36
      197500 -- [-573.578] (-573.484) (-575.198) (-574.220) * (-584.491) [-572.501] (-573.104) (-572.080) -- 0:00:40
      198000 -- (-573.703) (-573.388) (-572.961) [-571.613] * (-572.520) [-575.631] (-578.452) (-573.027) -- 0:00:40
      198500 -- (-572.360) [-571.986] (-571.875) (-571.639) * [-573.016] (-572.548) (-573.617) (-571.617) -- 0:00:40
      199000 -- (-572.354) [-576.269] (-572.138) (-578.624) * (-572.312) (-574.400) [-573.787] (-572.276) -- 0:00:40
      199500 -- (-575.155) (-572.247) (-573.789) [-572.705] * (-574.882) [-573.160] (-575.820) (-573.109) -- 0:00:40
      200000 -- (-575.076) (-575.211) [-572.384] (-574.243) * (-571.411) (-574.104) [-572.786] (-574.326) -- 0:00:40

      Average standard deviation of split frequencies: 0.015661

      200500 -- [-572.086] (-573.307) (-574.364) (-574.671) * (-572.375) [-574.850] (-572.875) (-571.788) -- 0:00:39
      201000 -- [-571.357] (-573.126) (-574.997) (-576.058) * [-579.516] (-573.472) (-572.118) (-572.826) -- 0:00:39
      201500 -- [-572.044] (-576.640) (-572.951) (-571.574) * [-573.787] (-572.931) (-573.211) (-575.690) -- 0:00:39
      202000 -- (-571.446) (-573.053) (-578.537) [-571.495] * (-572.163) (-572.071) [-575.758] (-571.477) -- 0:00:39
      202500 -- (-573.596) [-572.225] (-572.660) (-575.413) * (-572.835) [-572.556] (-570.832) (-574.266) -- 0:00:39
      203000 -- (-572.984) (-574.071) [-571.790] (-571.980) * [-571.004] (-574.372) (-572.341) (-573.953) -- 0:00:39
      203500 -- [-574.619] (-576.324) (-574.782) (-572.412) * (-571.601) (-575.080) (-576.333) [-570.910] -- 0:00:39
      204000 -- (-573.996) (-571.955) [-572.873] (-572.636) * [-571.280] (-577.884) (-577.179) (-573.582) -- 0:00:39
      204500 -- (-571.581) (-573.870) [-572.660] (-574.747) * (-572.784) (-571.210) (-580.160) [-574.517] -- 0:00:38
      205000 -- (-571.064) [-574.808] (-574.412) (-572.236) * (-573.230) (-572.882) (-576.013) [-572.284] -- 0:00:38

      Average standard deviation of split frequencies: 0.016781

      205500 -- (-572.815) (-571.506) (-571.299) [-574.044] * (-573.795) [-571.509] (-572.622) (-573.413) -- 0:00:38
      206000 -- (-572.155) (-575.761) [-572.360] (-573.299) * [-573.857] (-572.740) (-575.896) (-578.062) -- 0:00:38
      206500 -- (-573.278) (-571.825) [-571.555] (-571.092) * (-571.890) (-572.350) (-575.699) [-572.529] -- 0:00:38
      207000 -- (-575.109) (-573.807) (-573.740) [-571.776] * (-573.603) (-577.457) [-572.730] (-572.263) -- 0:00:38
      207500 -- (-576.817) (-574.408) [-575.941] (-571.157) * (-577.685) (-571.707) (-573.841) [-575.864] -- 0:00:38
      208000 -- (-575.894) [-573.735] (-574.185) (-571.783) * (-572.390) (-571.982) [-572.251] (-573.248) -- 0:00:38
      208500 -- (-572.606) [-573.302] (-573.913) (-572.430) * (-572.419) [-573.698] (-571.666) (-574.465) -- 0:00:37
      209000 -- (-572.562) [-574.400] (-572.062) (-573.658) * [-572.926] (-575.176) (-571.624) (-574.309) -- 0:00:37
      209500 -- [-573.393] (-574.921) (-572.276) (-574.385) * [-571.941] (-574.136) (-571.876) (-573.991) -- 0:00:37
      210000 -- (-572.637) [-574.531] (-573.223) (-571.436) * (-572.572) [-571.665] (-572.531) (-573.317) -- 0:00:37

      Average standard deviation of split frequencies: 0.013426

      210500 -- (-572.977) [-572.258] (-576.033) (-575.236) * [-571.537] (-572.987) (-574.395) (-575.812) -- 0:00:37
      211000 -- (-572.983) (-574.190) [-571.277] (-574.958) * (-573.384) (-571.161) (-575.933) [-572.002] -- 0:00:37
      211500 -- [-572.907] (-572.397) (-573.610) (-572.152) * [-573.314] (-574.147) (-580.094) (-573.229) -- 0:00:37
      212000 -- (-574.050) (-571.094) [-572.555] (-573.887) * (-571.673) (-575.798) (-577.459) [-572.819] -- 0:00:37
      212500 -- (-571.420) (-574.173) (-576.105) [-571.275] * (-572.234) (-571.968) [-573.525] (-571.898) -- 0:00:37
      213000 -- (-574.577) (-572.467) (-575.194) [-572.264] * (-571.926) (-576.415) (-575.210) [-572.541] -- 0:00:36
      213500 -- [-572.084] (-575.704) (-575.226) (-572.499) * (-573.054) (-572.536) [-572.239] (-574.234) -- 0:00:36
      214000 -- [-572.702] (-572.796) (-572.607) (-573.187) * (-572.332) (-575.537) (-572.343) [-573.099] -- 0:00:36
      214500 -- (-574.585) [-572.689] (-573.139) (-573.079) * [-571.000] (-575.450) (-573.961) (-574.039) -- 0:00:36
      215000 -- (-572.799) [-575.020] (-571.669) (-575.681) * (-573.849) (-573.303) (-574.412) [-571.743] -- 0:00:36

      Average standard deviation of split frequencies: 0.016004

      215500 -- (-575.059) (-573.758) (-571.073) [-573.488] * [-573.750] (-573.385) (-573.174) (-571.982) -- 0:00:36
      216000 -- (-573.383) [-571.827] (-574.264) (-575.292) * (-573.559) (-571.321) [-572.843] (-577.016) -- 0:00:36
      216500 -- [-573.719] (-572.014) (-572.625) (-576.781) * (-574.252) [-575.695] (-572.955) (-576.199) -- 0:00:36
      217000 -- [-572.710] (-576.181) (-573.211) (-576.998) * (-571.174) [-572.676] (-574.186) (-573.563) -- 0:00:36
      217500 -- (-571.643) (-573.376) [-571.292] (-572.515) * (-577.500) (-571.372) (-571.380) [-576.542] -- 0:00:35
      218000 -- [-572.468] (-572.304) (-572.135) (-572.072) * (-571.814) (-574.635) [-572.557] (-572.622) -- 0:00:35
      218500 -- (-572.944) (-572.996) (-576.908) [-573.092] * (-574.211) (-571.361) (-571.533) [-572.902] -- 0:00:35
      219000 -- (-572.665) [-572.357] (-571.855) (-573.553) * (-571.560) [-572.599] (-572.451) (-574.761) -- 0:00:35
      219500 -- (-572.374) (-572.011) (-576.884) [-571.832] * (-574.624) (-571.754) (-572.356) [-573.062] -- 0:00:39
      220000 -- (-575.357) (-573.524) [-572.448] (-571.413) * (-574.194) (-571.369) [-572.061] (-572.475) -- 0:00:39

      Average standard deviation of split frequencies: 0.018514

      220500 -- (-572.297) [-572.203] (-573.711) (-572.745) * [-572.669] (-573.165) (-576.760) (-573.519) -- 0:00:38
      221000 -- (-572.714) (-571.573) (-574.351) [-573.741] * (-573.611) (-572.979) [-573.320] (-575.642) -- 0:00:38
      221500 -- (-573.402) [-576.338] (-575.117) (-572.872) * (-572.350) (-571.433) (-573.989) [-571.908] -- 0:00:38
      222000 -- (-573.170) [-577.027] (-581.991) (-574.320) * (-574.503) [-575.524] (-573.871) (-572.799) -- 0:00:38
      222500 -- (-574.345) (-571.652) (-572.382) [-573.093] * (-576.177) [-573.400] (-572.233) (-571.549) -- 0:00:38
      223000 -- (-577.586) [-571.237] (-574.157) (-573.776) * (-574.249) [-574.436] (-572.176) (-571.262) -- 0:00:38
      223500 -- (-577.376) [-571.664] (-575.779) (-577.364) * [-572.566] (-573.187) (-572.289) (-571.858) -- 0:00:38
      224000 -- (-575.618) (-575.145) [-571.321] (-572.340) * [-571.438] (-573.075) (-572.766) (-571.637) -- 0:00:38
      224500 -- (-571.059) [-573.567] (-572.184) (-573.265) * (-570.829) [-573.023] (-574.353) (-572.229) -- 0:00:37
      225000 -- [-571.669] (-571.071) (-573.461) (-571.792) * (-572.828) (-572.628) (-573.405) [-571.370] -- 0:00:37

      Average standard deviation of split frequencies: 0.016687

      225500 -- (-576.517) (-575.230) (-571.238) [-572.996] * (-575.425) (-573.580) [-571.866] (-574.557) -- 0:00:37
      226000 -- [-571.685] (-572.240) (-573.031) (-575.249) * (-572.956) (-573.321) (-573.350) [-571.307] -- 0:00:37
      226500 -- (-574.858) (-577.613) (-573.164) [-577.048] * [-572.609] (-571.610) (-571.966) (-571.273) -- 0:00:37
      227000 -- (-574.608) (-574.447) (-571.421) [-572.272] * (-571.678) (-573.466) (-571.939) [-576.462] -- 0:00:37
      227500 -- [-572.439] (-572.231) (-572.340) (-574.030) * (-573.975) (-576.070) (-571.219) [-571.314] -- 0:00:37
      228000 -- (-572.840) (-572.533) (-573.269) [-572.208] * (-576.771) (-573.447) (-575.344) [-573.943] -- 0:00:37
      228500 -- (-572.749) (-572.733) (-574.442) [-575.609] * (-573.255) [-573.780] (-573.346) (-571.740) -- 0:00:37
      229000 -- (-571.742) (-573.385) (-572.323) [-573.441] * [-571.974] (-573.972) (-571.535) (-571.654) -- 0:00:37
      229500 -- (-571.910) [-577.341] (-571.191) (-573.523) * (-576.273) [-572.199] (-576.069) (-574.495) -- 0:00:36
      230000 -- [-573.924] (-571.669) (-573.783) (-571.865) * (-572.015) (-573.179) [-572.301] (-570.766) -- 0:00:36

      Average standard deviation of split frequencies: 0.014987

      230500 -- (-572.191) (-574.756) (-574.740) [-572.427] * (-573.054) [-571.546] (-573.920) (-571.168) -- 0:00:36
      231000 -- [-572.790] (-572.979) (-571.810) (-572.942) * (-571.083) [-573.666] (-573.467) (-574.519) -- 0:00:36
      231500 -- (-578.311) (-572.428) [-572.216] (-578.039) * (-571.521) (-571.291) [-571.670] (-571.556) -- 0:00:36
      232000 -- (-576.186) [-575.822] (-571.637) (-574.682) * (-574.471) [-571.939] (-573.568) (-572.017) -- 0:00:36
      232500 -- (-575.663) [-575.325] (-571.697) (-572.379) * (-571.719) (-572.943) (-572.775) [-572.252] -- 0:00:36
      233000 -- (-572.399) (-573.307) (-571.363) [-572.550] * (-572.181) (-572.940) (-572.230) [-571.839] -- 0:00:36
      233500 -- (-571.829) (-571.050) (-573.902) [-571.980] * (-575.113) [-572.380] (-572.721) (-572.771) -- 0:00:36
      234000 -- (-575.885) [-574.036] (-574.092) (-572.865) * [-576.317] (-572.898) (-576.517) (-573.765) -- 0:00:36
      234500 -- (-573.749) (-574.717) [-571.459] (-571.283) * (-574.644) (-572.357) (-572.285) [-574.328] -- 0:00:35
      235000 -- (-574.132) (-575.225) [-572.436] (-572.045) * (-575.682) (-572.678) (-574.724) [-581.811] -- 0:00:35

      Average standard deviation of split frequencies: 0.017311

      235500 -- [-571.231] (-571.784) (-575.121) (-574.069) * (-576.412) (-573.868) (-575.301) [-574.037] -- 0:00:35
      236000 -- (-573.342) [-575.192] (-572.125) (-571.672) * (-572.988) (-572.372) (-574.213) [-573.556] -- 0:00:35
      236500 -- [-572.329] (-574.524) (-574.480) (-573.509) * [-573.138] (-574.527) (-570.829) (-574.148) -- 0:00:35
      237000 -- (-571.076) (-574.335) [-572.080] (-573.495) * (-571.919) (-577.332) (-575.040) [-575.055] -- 0:00:35
      237500 -- (-573.120) (-573.977) (-572.760) [-571.542] * (-572.134) [-572.361] (-577.281) (-573.766) -- 0:00:35
      238000 -- [-572.570] (-573.814) (-575.915) (-573.242) * [-573.130] (-572.583) (-572.595) (-576.460) -- 0:00:35
      238500 -- (-574.276) (-574.618) [-572.715] (-572.238) * (-574.883) (-572.501) (-574.291) [-572.357] -- 0:00:35
      239000 -- [-573.413] (-576.213) (-577.911) (-574.530) * (-574.623) [-574.056] (-574.340) (-571.593) -- 0:00:35
      239500 -- (-575.147) [-572.328] (-573.684) (-573.315) * (-573.007) (-571.607) (-573.707) [-573.514] -- 0:00:34
      240000 -- (-574.354) (-572.873) (-572.493) [-572.468] * (-577.504) (-572.879) (-576.816) [-578.174] -- 0:00:34

      Average standard deviation of split frequencies: 0.019587

      240500 -- [-577.428] (-574.906) (-571.478) (-574.668) * (-576.446) [-573.547] (-579.301) (-573.146) -- 0:00:34
      241000 -- (-571.408) (-572.258) (-571.158) [-571.307] * (-572.873) (-572.873) [-572.086] (-572.085) -- 0:00:34
      241500 -- (-572.950) (-572.593) (-574.950) [-572.606] * (-573.534) (-571.979) [-574.351] (-571.885) -- 0:00:37
      242000 -- [-571.798] (-572.563) (-574.210) (-572.715) * (-573.134) [-572.231] (-572.256) (-574.757) -- 0:00:37
      242500 -- (-571.052) (-575.627) (-572.505) [-572.272] * (-576.576) [-574.493] (-571.534) (-573.033) -- 0:00:37
      243000 -- (-572.509) (-572.624) [-571.400] (-572.504) * (-571.331) (-572.386) [-571.941] (-573.772) -- 0:00:37
      243500 -- [-573.431] (-573.507) (-571.837) (-571.077) * (-573.331) (-571.869) (-573.661) [-572.204] -- 0:00:37
      244000 -- [-571.189] (-571.522) (-571.917) (-571.987) * (-571.555) [-572.905] (-576.117) (-574.456) -- 0:00:37
      244500 -- (-575.204) [-573.024] (-573.076) (-571.466) * (-573.212) [-574.353] (-574.011) (-571.938) -- 0:00:37
      245000 -- (-576.414) (-571.876) (-571.660) [-572.171] * (-575.534) [-573.264] (-573.885) (-572.514) -- 0:00:36

      Average standard deviation of split frequencies: 0.021718

      245500 -- (-574.191) (-575.714) (-574.498) [-572.603] * (-574.072) (-573.379) (-573.496) [-573.270] -- 0:00:36
      246000 -- (-574.075) (-576.002) (-572.586) [-572.054] * (-576.380) (-572.213) [-573.807] (-575.037) -- 0:00:36
      246500 -- (-576.805) [-575.985] (-574.637) (-572.073) * [-573.107] (-571.498) (-578.859) (-574.682) -- 0:00:36
      247000 -- (-574.980) (-574.409) [-571.386] (-574.465) * (-574.122) (-571.739) [-573.425] (-577.481) -- 0:00:36
      247500 -- (-577.940) (-572.505) [-571.191] (-572.508) * [-572.886] (-574.846) (-574.919) (-577.932) -- 0:00:36
      248000 -- (-574.596) (-571.916) [-575.134] (-571.632) * [-573.581] (-575.045) (-580.121) (-572.994) -- 0:00:36
      248500 -- (-572.215) (-571.797) (-573.318) [-574.391] * (-574.632) (-571.423) (-582.268) [-571.909] -- 0:00:36
      249000 -- (-572.164) (-572.121) [-571.206] (-572.424) * (-573.877) [-572.695] (-577.684) (-573.345) -- 0:00:36
      249500 -- [-573.469] (-570.911) (-572.038) (-573.342) * [-571.840] (-573.588) (-576.307) (-572.938) -- 0:00:36
      250000 -- [-572.415] (-572.029) (-571.327) (-572.605) * (-572.176) (-574.844) (-574.263) [-572.855] -- 0:00:36

      Average standard deviation of split frequencies: 0.023821

      250500 -- (-572.271) [-572.509] (-571.818) (-572.789) * [-572.228] (-574.331) (-572.288) (-571.659) -- 0:00:35
      251000 -- (-574.901) (-573.010) [-571.318] (-572.459) * (-575.917) (-573.854) [-571.638] (-571.601) -- 0:00:35
      251500 -- (-571.613) (-574.773) (-571.477) [-573.227] * [-572.736] (-572.359) (-573.479) (-572.722) -- 0:00:35
      252000 -- (-574.116) [-572.361] (-573.173) (-574.057) * (-576.679) (-572.057) (-575.845) [-573.706] -- 0:00:35
      252500 -- (-571.869) (-571.777) [-575.873] (-573.366) * (-573.762) (-572.645) (-572.840) [-572.363] -- 0:00:35
      253000 -- (-573.917) (-571.819) [-573.781] (-571.396) * (-575.815) (-573.419) (-574.818) [-572.706] -- 0:00:35
      253500 -- (-572.157) (-572.396) (-574.232) [-571.459] * (-572.626) (-574.039) (-571.893) [-575.439] -- 0:00:35
      254000 -- (-576.252) (-574.033) (-573.820) [-572.222] * (-572.886) (-575.234) (-572.086) [-575.974] -- 0:00:35
      254500 -- [-575.525] (-571.395) (-575.110) (-574.053) * (-573.835) (-573.201) [-571.147] (-575.677) -- 0:00:35
      255000 -- [-572.330] (-571.621) (-574.730) (-577.447) * (-572.717) (-572.346) [-574.375] (-571.671) -- 0:00:35

      Average standard deviation of split frequencies: 0.027008

      255500 -- (-576.060) [-570.847] (-574.707) (-577.006) * [-573.012] (-571.533) (-574.242) (-571.624) -- 0:00:34
      256000 -- (-574.941) (-575.283) [-573.693] (-575.677) * (-574.593) [-571.668] (-572.422) (-573.264) -- 0:00:34
      256500 -- (-576.304) (-575.076) [-573.370] (-572.753) * [-572.515] (-571.736) (-573.981) (-572.766) -- 0:00:34
      257000 -- [-571.883] (-572.109) (-571.745) (-572.499) * [-572.122] (-573.564) (-572.576) (-573.934) -- 0:00:34
      257500 -- [-575.548] (-571.906) (-573.361) (-572.543) * (-573.838) (-571.896) [-572.033] (-574.859) -- 0:00:34
      258000 -- (-573.593) [-573.812] (-574.458) (-571.427) * (-573.361) (-572.908) (-572.389) [-573.076] -- 0:00:34
      258500 -- (-572.579) (-572.353) [-571.147] (-573.361) * (-572.037) (-573.645) [-571.688] (-577.058) -- 0:00:34
      259000 -- (-572.468) (-573.430) (-573.688) [-571.190] * (-571.868) (-571.231) [-573.338] (-574.799) -- 0:00:34
      259500 -- (-575.329) (-574.564) [-574.715] (-573.486) * (-575.478) (-571.975) [-573.164] (-574.930) -- 0:00:34
      260000 -- (-572.859) (-574.952) (-573.973) [-576.230] * (-573.158) [-575.175] (-571.840) (-577.127) -- 0:00:34

      Average standard deviation of split frequencies: 0.022907

      260500 -- [-573.844] (-574.527) (-572.829) (-576.741) * (-575.058) [-573.829] (-573.455) (-575.554) -- 0:00:34
      261000 -- (-574.178) [-574.822] (-574.609) (-575.943) * (-576.811) [-573.169] (-574.074) (-575.004) -- 0:00:33
      261500 -- (-575.732) [-574.006] (-572.840) (-576.316) * (-571.635) (-573.907) (-576.771) [-571.397] -- 0:00:33
      262000 -- (-575.029) (-572.046) [-574.326] (-574.677) * (-572.175) [-573.709] (-573.262) (-575.332) -- 0:00:33
      262500 -- (-572.125) (-573.372) (-575.806) [-571.236] * [-571.766] (-576.575) (-571.655) (-573.088) -- 0:00:33
      263000 -- (-574.431) (-572.457) (-573.222) [-573.926] * (-575.100) [-571.503] (-573.413) (-572.436) -- 0:00:33
      263500 -- (-573.004) (-573.067) [-571.197] (-574.617) * [-573.915] (-575.697) (-571.261) (-573.019) -- 0:00:33
      264000 -- (-572.891) [-574.512] (-572.731) (-570.876) * [-573.130] (-576.308) (-571.766) (-573.538) -- 0:00:33
      264500 -- (-572.512) [-572.281] (-573.029) (-573.399) * (-571.327) (-574.553) [-572.544] (-571.795) -- 0:00:36
      265000 -- (-572.328) (-572.379) [-579.831] (-571.754) * (-577.716) (-571.723) [-571.329] (-574.444) -- 0:00:36

      Average standard deviation of split frequencies: 0.018903

      265500 -- [-573.467] (-573.463) (-573.959) (-572.800) * [-572.040] (-573.276) (-572.227) (-574.701) -- 0:00:35
      266000 -- (-572.880) [-572.324] (-572.861) (-574.456) * (-570.844) (-573.061) (-572.275) [-573.486] -- 0:00:35
      266500 -- (-572.141) (-571.645) (-571.325) [-571.085] * (-572.325) [-572.322] (-571.514) (-571.333) -- 0:00:35
      267000 -- [-577.380] (-572.322) (-572.120) (-572.918) * (-575.839) (-572.097) (-571.844) [-571.149] -- 0:00:35
      267500 -- (-573.093) (-572.443) (-572.133) [-572.878] * [-577.285] (-572.347) (-574.734) (-574.426) -- 0:00:35
      268000 -- [-573.742] (-573.433) (-571.485) (-573.809) * (-573.159) (-572.157) [-574.427] (-572.561) -- 0:00:35
      268500 -- (-574.653) [-573.362] (-572.265) (-576.426) * [-573.243] (-575.676) (-574.252) (-575.999) -- 0:00:35
      269000 -- (-574.032) (-572.080) (-572.221) [-572.556] * (-571.843) (-572.558) (-577.540) [-573.909] -- 0:00:35
      269500 -- (-571.597) [-575.015] (-571.374) (-573.201) * (-574.310) (-572.269) (-576.349) [-575.503] -- 0:00:35
      270000 -- (-571.130) (-574.707) [-573.927] (-578.649) * (-574.683) [-573.672] (-573.514) (-573.408) -- 0:00:35

      Average standard deviation of split frequencies: 0.024383

      270500 -- (-571.322) (-571.971) (-572.479) [-572.769] * (-575.412) (-576.826) [-572.927] (-577.079) -- 0:00:35
      271000 -- (-571.583) (-575.619) (-572.707) [-573.246] * (-573.925) (-573.521) (-574.258) [-573.867] -- 0:00:34
      271500 -- [-572.421] (-573.396) (-572.137) (-574.165) * (-571.243) (-575.438) [-573.687] (-573.674) -- 0:00:34
      272000 -- (-571.872) (-574.940) (-571.924) [-573.018] * (-573.774) (-573.524) [-573.326] (-574.234) -- 0:00:34
      272500 -- (-571.660) [-571.786] (-571.408) (-572.064) * (-573.271) [-572.793] (-573.072) (-571.761) -- 0:00:34
      273000 -- [-572.769] (-575.708) (-573.803) (-574.710) * (-574.534) (-575.759) [-574.658] (-573.117) -- 0:00:34
      273500 -- (-573.547) (-573.355) (-575.907) [-572.769] * (-573.594) (-572.058) [-573.922] (-571.734) -- 0:00:34
      274000 -- (-575.088) [-573.881] (-574.913) (-580.256) * (-574.538) (-575.976) (-572.026) [-572.840] -- 0:00:34
      274500 -- (-574.742) (-574.768) [-575.280] (-572.903) * [-573.052] (-574.419) (-572.086) (-575.411) -- 0:00:34
      275000 -- (-571.966) (-573.994) [-573.097] (-570.984) * (-571.761) [-575.424] (-573.976) (-575.011) -- 0:00:34

      Average standard deviation of split frequencies: 0.023912

      275500 -- (-575.288) [-571.672] (-575.384) (-573.243) * (-573.369) [-575.239] (-574.827) (-573.716) -- 0:00:34
      276000 -- [-571.501] (-572.634) (-572.654) (-577.728) * (-580.417) (-574.144) (-572.570) [-573.108] -- 0:00:34
      276500 -- [-574.114] (-575.735) (-574.452) (-574.979) * (-576.571) (-573.873) (-575.888) [-571.769] -- 0:00:34
      277000 -- (-571.266) [-572.434] (-575.029) (-572.280) * [-574.947] (-571.990) (-576.707) (-571.159) -- 0:00:33
      277500 -- [-575.832] (-571.426) (-574.181) (-571.308) * (-575.644) [-574.259] (-573.358) (-574.865) -- 0:00:33
      278000 -- (-573.645) (-571.545) (-572.446) [-572.698] * (-574.184) (-576.043) [-572.130] (-572.627) -- 0:00:33
      278500 -- (-573.197) (-572.955) (-571.039) [-571.863] * (-573.292) (-571.394) (-576.105) [-572.152] -- 0:00:33
      279000 -- (-577.736) (-572.358) (-571.204) [-571.630] * [-571.537] (-576.701) (-574.464) (-572.287) -- 0:00:33
      279500 -- (-573.510) (-571.978) (-573.127) [-572.006] * (-571.788) [-573.497] (-577.498) (-573.704) -- 0:00:33
      280000 -- [-571.826] (-572.178) (-572.976) (-571.559) * (-574.656) [-571.670] (-578.540) (-571.884) -- 0:00:33

      Average standard deviation of split frequencies: 0.027993

      280500 -- (-573.581) (-572.722) [-574.201] (-576.398) * (-572.820) [-571.982] (-574.921) (-571.121) -- 0:00:33
      281000 -- (-574.803) [-572.357] (-578.030) (-574.716) * (-572.471) (-571.029) (-573.166) [-572.678] -- 0:00:33
      281500 -- (-572.130) [-572.326] (-573.641) (-575.897) * (-580.203) (-576.540) [-572.811] (-574.752) -- 0:00:33
      282000 -- (-571.963) (-572.690) (-572.067) [-574.407] * [-571.861] (-573.243) (-573.089) (-572.766) -- 0:00:33
      282500 -- [-571.033] (-576.216) (-571.597) (-571.345) * (-572.126) (-571.583) (-573.062) [-573.211] -- 0:00:33
      283000 -- (-575.690) [-573.127] (-572.945) (-571.448) * [-573.630] (-573.096) (-576.074) (-572.954) -- 0:00:32
      283500 -- [-573.256] (-574.119) (-578.489) (-571.311) * (-572.322) [-571.195] (-573.189) (-573.691) -- 0:00:32
      284000 -- (-573.648) (-575.431) (-573.949) [-573.185] * (-573.679) (-571.823) [-572.018] (-571.788) -- 0:00:32
      284500 -- (-573.631) [-576.139] (-572.495) (-571.263) * (-571.870) [-571.810] (-572.352) (-572.345) -- 0:00:32
      285000 -- (-574.845) (-574.970) [-573.626] (-572.538) * (-579.218) [-571.471] (-572.378) (-577.944) -- 0:00:32

      Average standard deviation of split frequencies: 0.029669

      285500 -- (-571.277) (-573.357) [-572.800] (-571.736) * (-574.966) (-573.680) [-572.257] (-576.966) -- 0:00:32
      286000 -- [-578.182] (-574.242) (-571.655) (-574.205) * (-570.957) [-572.429] (-571.777) (-574.199) -- 0:00:32
      286500 -- [-573.035] (-573.980) (-573.758) (-571.737) * (-571.012) (-572.669) (-574.627) [-573.066] -- 0:00:34
      287000 -- (-571.422) [-571.461] (-573.136) (-573.252) * (-572.839) (-573.763) (-577.833) [-575.393] -- 0:00:34
      287500 -- [-571.306] (-571.640) (-572.167) (-572.252) * (-571.365) (-573.864) (-574.913) [-572.981] -- 0:00:34
      288000 -- (-571.046) [-573.562] (-574.383) (-572.610) * (-574.933) (-573.012) [-573.438] (-573.926) -- 0:00:34
      288500 -- (-572.910) [-571.872] (-572.296) (-572.711) * (-572.726) (-575.924) [-571.713] (-571.889) -- 0:00:34
      289000 -- [-571.194] (-571.237) (-571.983) (-573.955) * (-573.983) (-572.560) [-575.051] (-572.254) -- 0:00:34
      289500 -- [-573.830] (-572.271) (-574.452) (-575.525) * (-572.453) (-576.380) [-571.502] (-574.012) -- 0:00:34
      290000 -- [-571.968] (-570.779) (-572.961) (-577.018) * (-572.248) (-571.844) [-571.315] (-572.190) -- 0:00:34

      Average standard deviation of split frequencies: 0.027030

      290500 -- (-571.953) (-576.559) [-574.628] (-573.286) * (-572.208) (-572.089) (-571.870) [-574.522] -- 0:00:34
      291000 -- (-573.331) [-570.979] (-577.703) (-573.319) * (-574.337) (-572.957) [-572.412] (-574.386) -- 0:00:34
      291500 -- (-573.236) (-575.858) [-574.771] (-572.885) * [-574.688] (-574.333) (-570.980) (-574.158) -- 0:00:34
      292000 -- [-573.660] (-573.365) (-572.033) (-571.887) * (-572.148) (-571.506) (-570.962) [-575.358] -- 0:00:33
      292500 -- (-572.402) (-571.469) (-571.255) [-573.405] * (-573.038) (-573.011) [-572.655] (-572.675) -- 0:00:33
      293000 -- (-574.545) (-572.212) (-574.046) [-571.799] * (-574.403) [-572.250] (-574.137) (-574.669) -- 0:00:33
      293500 -- [-572.475] (-573.350) (-572.118) (-571.078) * [-578.749] (-572.176) (-571.562) (-579.580) -- 0:00:33
      294000 -- [-573.745] (-574.371) (-573.619) (-571.863) * (-573.156) (-576.367) [-572.768] (-577.495) -- 0:00:33
      294500 -- (-571.643) (-571.781) [-573.301] (-571.173) * (-572.324) (-574.174) [-572.929] (-571.282) -- 0:00:33
      295000 -- [-573.381] (-574.591) (-582.342) (-574.959) * (-571.400) (-571.717) [-571.297] (-573.580) -- 0:00:33

      Average standard deviation of split frequencies: 0.028666

      295500 -- (-575.188) [-573.258] (-575.945) (-574.503) * (-573.681) (-573.009) (-571.268) [-572.651] -- 0:00:33
      296000 -- [-573.306] (-573.210) (-571.920) (-575.426) * (-573.965) (-575.812) [-572.218] (-572.852) -- 0:00:33
      296500 -- (-572.717) (-574.554) [-573.473] (-576.408) * (-571.840) (-575.288) [-572.451] (-575.053) -- 0:00:33
      297000 -- [-570.947] (-575.803) (-574.053) (-574.896) * (-574.453) (-572.996) (-572.564) [-571.806] -- 0:00:33
      297500 -- (-570.816) [-573.738] (-574.419) (-573.717) * (-571.285) (-573.682) [-572.621] (-573.951) -- 0:00:33
      298000 -- (-572.738) [-574.546] (-573.311) (-578.485) * (-572.202) (-575.155) (-573.122) [-572.916] -- 0:00:32
      298500 -- (-575.906) (-573.366) [-572.208] (-574.357) * (-575.793) [-571.038] (-570.812) (-573.119) -- 0:00:32
      299000 -- [-575.652] (-572.010) (-576.003) (-571.740) * (-573.732) (-572.769) (-577.257) [-573.128] -- 0:00:32
      299500 -- (-572.799) [-571.657] (-573.077) (-571.444) * (-571.263) [-572.285] (-573.236) (-573.534) -- 0:00:32
      300000 -- (-577.534) (-572.581) (-573.193) [-573.078] * (-573.962) (-574.282) [-571.633] (-571.332) -- 0:00:32

      Average standard deviation of split frequencies: 0.027176

      300500 -- [-574.773] (-575.284) (-571.918) (-572.798) * [-575.107] (-575.222) (-572.751) (-571.086) -- 0:00:32
      301000 -- (-580.955) [-572.681] (-570.940) (-573.015) * (-572.647) (-576.369) (-574.191) [-572.651] -- 0:00:32
      301500 -- [-572.312] (-578.250) (-576.447) (-574.559) * (-572.861) [-571.737] (-573.222) (-576.073) -- 0:00:32
      302000 -- (-577.660) (-577.835) (-573.411) [-572.923] * (-574.574) [-575.572] (-573.808) (-572.735) -- 0:00:32
      302500 -- (-573.773) [-572.894] (-572.140) (-572.703) * (-577.004) (-579.030) [-572.217] (-574.093) -- 0:00:32
      303000 -- (-570.793) [-571.069] (-572.890) (-573.025) * (-576.762) (-573.461) (-573.874) [-575.497] -- 0:00:32
      303500 -- (-575.219) [-573.490] (-572.161) (-573.449) * [-572.164] (-576.762) (-572.402) (-573.157) -- 0:00:32
      304000 -- (-574.307) (-572.142) (-572.452) [-574.865] * (-574.556) [-571.268] (-573.671) (-573.310) -- 0:00:32
      304500 -- (-572.048) (-574.287) [-573.350] (-575.392) * (-572.025) (-571.607) (-573.962) [-571.694] -- 0:00:31
      305000 -- (-571.116) (-571.659) (-576.428) [-576.526] * [-572.727] (-573.265) (-571.670) (-572.053) -- 0:00:31

      Average standard deviation of split frequencies: 0.027730

      305500 -- [-573.470] (-575.280) (-575.463) (-573.320) * (-577.241) (-572.645) [-571.194] (-575.130) -- 0:00:31
      306000 -- (-572.312) [-573.553] (-573.123) (-572.710) * (-573.636) (-572.168) (-571.870) [-571.257] -- 0:00:31
      306500 -- (-573.547) [-571.392] (-572.597) (-571.244) * [-573.294] (-573.102) (-578.979) (-575.168) -- 0:00:31
      307000 -- (-575.369) [-572.209] (-571.046) (-572.105) * (-574.555) [-575.726] (-577.092) (-575.219) -- 0:00:31
      307500 -- (-572.846) (-573.538) (-572.910) [-571.654] * (-573.940) (-571.629) [-570.987] (-572.240) -- 0:00:31
      308000 -- (-574.830) (-574.713) (-576.776) [-571.540] * [-572.199] (-573.706) (-571.319) (-572.445) -- 0:00:31
      308500 -- (-575.913) (-572.968) (-573.003) [-572.445] * (-575.408) (-572.578) [-571.085] (-572.276) -- 0:00:31
      309000 -- (-574.032) (-572.301) (-573.883) [-572.168] * (-571.384) (-572.058) [-573.937] (-572.940) -- 0:00:33
      309500 -- [-575.843] (-572.834) (-575.461) (-571.879) * (-570.982) [-572.702] (-576.308) (-575.538) -- 0:00:33
      310000 -- (-572.294) [-572.452] (-573.314) (-575.932) * (-571.661) (-574.440) [-573.633] (-578.125) -- 0:00:33

      Average standard deviation of split frequencies: 0.028325

      310500 -- [-571.943] (-571.965) (-572.086) (-571.476) * (-576.339) (-573.330) [-571.202] (-574.159) -- 0:00:33
      311000 -- (-573.583) (-572.851) (-572.933) [-572.404] * [-572.879] (-572.518) (-572.404) (-574.350) -- 0:00:33
      311500 -- (-573.532) (-573.173) (-572.529) [-573.310] * (-575.905) (-575.772) (-576.878) [-574.588] -- 0:00:33
      312000 -- (-573.105) [-572.675] (-572.996) (-571.458) * (-576.146) (-572.678) (-571.508) [-572.686] -- 0:00:33
      312500 -- (-571.742) (-573.586) [-575.353] (-572.160) * (-571.083) (-572.667) [-572.095] (-574.313) -- 0:00:33
      313000 -- (-572.119) [-571.241] (-575.447) (-572.518) * (-571.826) (-572.217) (-574.926) [-573.683] -- 0:00:32
      313500 -- (-570.932) (-575.054) (-573.284) [-571.767] * (-575.894) (-571.413) (-572.275) [-574.360] -- 0:00:32
      314000 -- (-571.859) (-571.553) (-572.294) [-572.324] * [-572.131] (-574.357) (-576.000) (-572.317) -- 0:00:32
      314500 -- (-575.584) (-575.504) (-571.277) [-573.222] * (-573.157) [-573.195] (-574.325) (-571.767) -- 0:00:32
      315000 -- (-573.140) [-571.164] (-571.500) (-572.935) * (-574.569) (-574.062) [-572.421] (-571.673) -- 0:00:32

      Average standard deviation of split frequencies: 0.028841

      315500 -- (-577.667) [-572.655] (-580.000) (-578.175) * (-575.388) (-573.244) (-573.698) [-573.826] -- 0:00:32
      316000 -- [-572.249] (-575.896) (-574.794) (-575.477) * (-577.471) (-574.147) [-571.422] (-575.448) -- 0:00:32
      316500 -- (-572.982) [-571.353] (-574.041) (-573.916) * (-578.781) (-574.269) [-573.979] (-573.859) -- 0:00:32
      317000 -- [-570.936] (-576.226) (-575.622) (-572.392) * [-575.072] (-573.087) (-575.681) (-577.959) -- 0:00:32
      317500 -- (-571.424) (-571.536) (-572.960) [-573.352] * (-574.379) (-574.306) [-572.256] (-575.277) -- 0:00:32
      318000 -- (-572.132) (-571.263) (-573.359) [-576.503] * (-575.133) [-573.648] (-573.525) (-573.801) -- 0:00:32
      318500 -- (-572.206) (-572.816) (-574.567) [-572.815] * (-571.975) [-571.963] (-574.651) (-573.911) -- 0:00:32
      319000 -- (-571.073) [-571.919] (-572.653) (-572.940) * (-577.250) [-574.939] (-572.794) (-573.136) -- 0:00:32
      319500 -- [-571.334] (-572.907) (-572.543) (-573.704) * (-577.769) [-572.447] (-574.085) (-572.893) -- 0:00:31
      320000 -- [-571.347] (-573.024) (-573.617) (-574.076) * (-571.627) [-573.454] (-573.663) (-576.343) -- 0:00:31

      Average standard deviation of split frequencies: 0.025481

      320500 -- (-571.403) (-571.930) [-576.083] (-573.048) * (-573.078) (-575.853) [-575.127] (-575.851) -- 0:00:31
      321000 -- (-577.251) (-571.549) (-574.445) [-572.692] * [-573.555] (-573.524) (-572.546) (-574.677) -- 0:00:31
      321500 -- (-574.088) (-572.816) [-572.090] (-572.681) * (-571.734) [-571.702] (-574.111) (-573.247) -- 0:00:31
      322000 -- (-572.463) [-571.924] (-573.618) (-573.731) * [-573.459] (-574.518) (-574.513) (-575.478) -- 0:00:31
      322500 -- (-571.976) (-572.743) (-571.207) [-571.625] * (-571.355) [-573.224] (-573.776) (-571.736) -- 0:00:31
      323000 -- (-571.349) (-573.649) [-572.609] (-571.185) * (-571.468) [-574.089] (-573.692) (-573.341) -- 0:00:31
      323500 -- (-574.174) (-572.657) [-571.494] (-573.631) * [-571.618] (-572.794) (-573.996) (-572.033) -- 0:00:31
      324000 -- (-577.503) (-573.762) [-571.338] (-573.181) * (-573.507) (-572.343) (-575.379) [-573.256] -- 0:00:31
      324500 -- (-572.148) (-571.000) [-572.525] (-573.722) * (-578.008) (-573.809) (-572.590) [-572.793] -- 0:00:31
      325000 -- (-575.509) (-570.835) [-571.980] (-576.939) * [-574.354] (-571.360) (-573.780) (-573.531) -- 0:00:31

      Average standard deviation of split frequencies: 0.025064

      325500 -- (-575.581) (-572.463) [-571.891] (-571.343) * [-571.116] (-573.541) (-574.008) (-573.392) -- 0:00:31
      326000 -- (-575.081) [-572.056] (-574.748) (-570.725) * (-570.994) (-571.960) (-573.027) [-573.577] -- 0:00:31
      326500 -- [-573.636] (-573.160) (-579.603) (-573.718) * (-571.107) (-570.814) [-572.558] (-573.971) -- 0:00:30
      327000 -- (-573.655) [-571.462] (-571.469) (-574.392) * [-571.842] (-572.192) (-572.060) (-573.840) -- 0:00:30
      327500 -- (-572.334) (-576.540) (-573.356) [-576.079] * (-572.356) (-572.170) (-572.959) [-570.928] -- 0:00:30
      328000 -- (-574.825) [-571.926] (-571.757) (-573.580) * (-573.436) (-572.792) (-573.411) [-573.125] -- 0:00:30
      328500 -- (-571.734) [-575.061] (-572.162) (-574.097) * (-572.066) [-576.385] (-573.946) (-572.449) -- 0:00:30
      329000 -- (-573.588) [-571.869] (-572.498) (-572.582) * (-571.863) (-579.488) (-573.205) [-573.832] -- 0:00:30
      329500 -- (-571.793) (-573.927) (-573.560) [-571.964] * [-573.251] (-575.088) (-574.859) (-572.292) -- 0:00:30
      330000 -- (-572.132) [-574.256] (-575.043) (-572.983) * (-572.539) [-574.353] (-573.173) (-574.124) -- 0:00:30

      Average standard deviation of split frequencies: 0.022810

      330500 -- (-576.818) [-574.013] (-572.750) (-573.543) * (-573.025) (-571.899) [-574.290] (-574.460) -- 0:00:30
      331000 -- (-581.039) [-573.456] (-571.901) (-575.141) * (-571.430) (-571.954) [-573.692] (-573.902) -- 0:00:32
      331500 -- (-572.464) [-573.286] (-572.102) (-573.202) * (-574.046) (-572.974) (-574.786) [-573.615] -- 0:00:32
      332000 -- (-572.375) (-573.057) [-571.323] (-574.692) * (-571.292) (-573.228) (-574.311) [-573.433] -- 0:00:32
      332500 -- (-572.796) (-575.573) (-574.527) [-575.028] * (-570.909) [-573.208] (-571.690) (-573.104) -- 0:00:32
      333000 -- (-572.115) [-574.046] (-573.531) (-572.990) * [-571.751] (-572.067) (-571.586) (-573.813) -- 0:00:32
      333500 -- (-573.791) (-572.476) (-573.476) [-571.162] * (-572.479) (-573.195) [-571.169] (-573.307) -- 0:00:31
      334000 -- (-572.590) (-576.723) (-576.166) [-573.303] * (-574.287) (-572.578) [-574.178] (-571.179) -- 0:00:31
      334500 -- (-575.433) (-572.170) [-575.961] (-571.233) * [-572.953] (-572.725) (-573.295) (-572.084) -- 0:00:31
      335000 -- (-574.754) (-573.157) [-573.708] (-574.651) * (-573.601) (-575.612) [-573.887] (-573.341) -- 0:00:31

      Average standard deviation of split frequencies: 0.022448

      335500 -- (-572.256) [-574.149] (-572.162) (-574.765) * (-571.757) (-577.091) [-571.041] (-575.553) -- 0:00:31
      336000 -- [-576.329] (-573.716) (-572.045) (-577.189) * [-572.144] (-570.953) (-572.730) (-572.827) -- 0:00:31
      336500 -- (-573.670) [-574.108] (-571.678) (-577.842) * (-576.092) (-572.703) (-571.190) [-572.390] -- 0:00:31
      337000 -- [-571.361] (-576.498) (-573.032) (-574.463) * (-576.108) (-571.495) [-572.329] (-573.174) -- 0:00:31
      337500 -- [-572.440] (-572.230) (-572.443) (-575.082) * (-574.911) (-572.601) [-571.976] (-572.258) -- 0:00:31
      338000 -- (-573.143) (-573.374) (-574.287) [-571.711] * (-572.277) (-571.344) (-572.225) [-571.558] -- 0:00:31
      338500 -- (-574.665) [-572.045] (-574.183) (-573.756) * (-572.809) [-572.171] (-575.259) (-571.501) -- 0:00:31
      339000 -- [-574.264] (-571.956) (-573.101) (-573.842) * (-570.925) (-575.546) (-576.689) [-576.289] -- 0:00:31
      339500 -- [-575.617] (-575.464) (-574.554) (-573.625) * (-572.222) [-572.696] (-571.888) (-571.759) -- 0:00:31
      340000 -- (-574.524) [-575.921] (-572.341) (-575.876) * [-572.037] (-571.051) (-574.386) (-571.712) -- 0:00:31

      Average standard deviation of split frequencies: 0.025830

      340500 -- [-573.503] (-573.847) (-571.186) (-573.244) * (-572.364) (-572.657) [-575.589] (-574.781) -- 0:00:30
      341000 -- (-576.113) [-572.618] (-571.165) (-574.391) * [-572.910] (-573.005) (-573.273) (-572.367) -- 0:00:30
      341500 -- [-573.927] (-571.629) (-573.539) (-572.309) * (-573.787) [-572.834] (-571.876) (-575.482) -- 0:00:30
      342000 -- [-572.487] (-571.392) (-572.080) (-577.521) * (-577.383) [-571.562] (-571.898) (-578.797) -- 0:00:30
      342500 -- (-575.037) (-572.435) [-572.732] (-578.112) * [-573.233] (-570.847) (-574.325) (-571.247) -- 0:00:30
      343000 -- (-574.738) (-572.495) (-575.728) [-571.623] * (-571.302) (-574.613) [-572.566] (-572.970) -- 0:00:30
      343500 -- [-571.685] (-574.252) (-573.111) (-575.517) * (-574.689) (-574.292) [-573.694] (-572.118) -- 0:00:30
      344000 -- (-571.655) [-571.987] (-572.335) (-572.729) * [-571.687] (-575.051) (-575.439) (-573.478) -- 0:00:30
      344500 -- (-574.313) (-572.407) [-573.693] (-574.351) * (-571.458) (-574.562) [-573.906] (-574.598) -- 0:00:30
      345000 -- (-576.094) (-571.903) [-573.441] (-576.509) * (-572.537) (-579.380) [-572.677] (-572.587) -- 0:00:30

      Average standard deviation of split frequencies: 0.023616

      345500 -- (-574.267) [-575.551] (-573.593) (-572.411) * (-576.399) [-571.628] (-573.067) (-574.791) -- 0:00:30
      346000 -- (-571.848) (-571.465) [-573.937] (-573.249) * (-573.847) (-574.240) (-573.322) [-575.587] -- 0:00:30
      346500 -- (-572.935) (-577.000) [-578.646] (-572.966) * [-573.914] (-574.488) (-572.015) (-573.852) -- 0:00:30
      347000 -- (-572.127) [-571.241] (-576.777) (-574.425) * (-575.411) (-572.638) (-575.070) [-573.874] -- 0:00:30
      347500 -- (-572.475) [-571.382] (-574.101) (-573.981) * (-571.428) (-574.163) (-573.414) [-575.195] -- 0:00:30
      348000 -- (-571.859) (-572.263) [-572.216] (-573.548) * [-573.412] (-576.141) (-571.920) (-574.981) -- 0:00:29
      348500 -- (-574.412) (-573.072) [-577.683] (-574.875) * [-570.969] (-574.152) (-572.422) (-573.147) -- 0:00:29
      349000 -- (-575.230) (-572.428) (-572.823) [-572.280] * (-571.656) (-572.483) (-575.519) [-571.662] -- 0:00:29
      349500 -- (-572.413) (-572.049) [-572.970] (-571.456) * [-572.243] (-573.387) (-575.156) (-572.978) -- 0:00:29
      350000 -- (-573.453) (-574.146) [-575.725] (-571.371) * [-576.930] (-580.212) (-572.617) (-572.227) -- 0:00:29

      Average standard deviation of split frequencies: 0.023301

      350500 -- (-575.374) (-571.925) [-574.047] (-574.737) * (-575.583) [-572.202] (-573.911) (-573.579) -- 0:00:29
      351000 -- (-581.048) [-572.454] (-574.513) (-577.591) * (-572.444) [-572.782] (-573.764) (-571.971) -- 0:00:29
      351500 -- (-574.239) (-571.699) [-573.170] (-574.326) * (-571.102) (-571.919) [-573.843] (-572.358) -- 0:00:29
      352000 -- (-573.269) (-571.781) (-574.070) [-571.249] * (-574.693) (-576.270) [-572.445] (-570.965) -- 0:00:29
      352500 -- (-575.662) [-575.851] (-572.927) (-570.970) * (-574.960) (-571.857) (-572.368) [-573.196] -- 0:00:29
      353000 -- (-573.938) [-571.590] (-573.517) (-573.591) * (-574.853) [-572.452] (-574.008) (-576.447) -- 0:00:29
      353500 -- [-573.968] (-574.937) (-573.216) (-575.123) * (-572.468) (-573.631) (-573.163) [-573.297] -- 0:00:31
      354000 -- (-574.309) (-575.825) [-571.851] (-573.839) * (-572.649) (-572.897) [-571.476] (-572.554) -- 0:00:31
      354500 -- [-574.814] (-572.728) (-572.891) (-573.974) * (-571.118) (-572.538) [-571.337] (-574.091) -- 0:00:30
      355000 -- (-574.353) (-573.102) (-573.638) [-573.549] * (-572.140) (-576.142) [-573.176] (-573.786) -- 0:00:30

      Average standard deviation of split frequencies: 0.023835

      355500 -- (-577.586) (-573.232) (-575.753) [-572.906] * (-574.029) (-572.627) [-574.052] (-573.174) -- 0:00:30
      356000 -- (-578.251) (-576.226) (-573.217) [-575.547] * (-572.775) (-571.694) [-574.846] (-573.863) -- 0:00:30
      356500 -- (-573.280) (-572.733) (-571.978) [-571.542] * (-574.121) [-572.816] (-573.183) (-574.700) -- 0:00:30
      357000 -- [-573.457] (-576.070) (-575.485) (-571.061) * (-572.158) (-576.950) (-572.166) [-571.775] -- 0:00:30
      357500 -- [-573.849] (-572.898) (-572.377) (-574.783) * (-571.955) [-573.082] (-572.449) (-572.369) -- 0:00:30
      358000 -- (-576.524) (-574.195) [-574.247] (-574.080) * [-572.664] (-572.166) (-573.518) (-572.378) -- 0:00:30
      358500 -- (-575.481) (-576.585) (-572.926) [-571.806] * [-572.163] (-572.286) (-574.794) (-573.803) -- 0:00:30
      359000 -- [-574.418] (-573.518) (-577.734) (-571.561) * (-575.576) (-576.190) (-573.088) [-574.155] -- 0:00:30
      359500 -- [-572.032] (-571.683) (-576.298) (-572.144) * (-574.325) (-576.516) [-572.069] (-575.490) -- 0:00:30
      360000 -- [-572.099] (-575.736) (-571.483) (-571.164) * (-572.725) [-572.264] (-573.443) (-574.288) -- 0:00:30

      Average standard deviation of split frequencies: 0.023527

      360500 -- (-572.325) (-571.708) [-570.769] (-573.683) * (-575.256) (-574.413) (-575.794) [-571.355] -- 0:00:30
      361000 -- (-572.680) (-574.150) (-571.329) [-571.623] * (-575.504) (-571.568) [-570.964] (-573.650) -- 0:00:30
      361500 -- (-571.959) (-573.234) (-571.163) [-570.877] * (-573.018) (-571.829) [-571.377] (-574.435) -- 0:00:30
      362000 -- [-572.755] (-574.440) (-572.873) (-574.414) * (-571.650) (-571.265) (-571.928) [-573.454] -- 0:00:29
      362500 -- (-577.604) (-571.761) [-571.357] (-571.457) * [-574.046] (-571.290) (-571.168) (-572.222) -- 0:00:29
      363000 -- (-573.224) (-571.481) (-572.507) [-574.269] * (-571.638) (-575.383) (-575.287) [-573.565] -- 0:00:29
      363500 -- (-572.378) [-571.053] (-575.774) (-577.606) * (-572.659) (-574.242) (-571.500) [-571.052] -- 0:00:29
      364000 -- (-573.873) (-574.230) (-572.586) [-577.840] * [-573.184] (-571.988) (-571.539) (-575.340) -- 0:00:29
      364500 -- (-572.457) (-572.859) [-573.488] (-576.804) * [-573.130] (-571.570) (-572.962) (-575.580) -- 0:00:29
      365000 -- (-575.022) (-573.128) (-573.336) [-572.187] * [-573.348] (-572.894) (-571.701) (-574.024) -- 0:00:29

      Average standard deviation of split frequencies: 0.023184

      365500 -- [-575.604] (-571.710) (-572.255) (-573.277) * [-574.250] (-574.338) (-572.947) (-571.650) -- 0:00:29
      366000 -- [-572.193] (-572.357) (-581.545) (-572.831) * (-575.447) (-572.695) (-572.499) [-572.222] -- 0:00:29
      366500 -- [-571.515] (-570.773) (-575.626) (-571.334) * (-573.016) (-573.252) (-573.582) [-574.004] -- 0:00:29
      367000 -- (-575.202) [-570.807] (-577.968) (-571.260) * (-574.519) (-572.200) [-573.174] (-576.955) -- 0:00:29
      367500 -- (-572.216) (-573.936) (-577.020) [-572.519] * [-572.567] (-574.731) (-571.999) (-578.954) -- 0:00:29
      368000 -- [-573.236] (-572.890) (-573.158) (-571.059) * (-571.587) (-573.094) (-577.171) [-574.034] -- 0:00:29
      368500 -- (-573.573) (-573.970) (-574.939) [-571.879] * (-571.975) (-572.002) [-571.707] (-574.372) -- 0:00:29
      369000 -- [-574.952] (-572.425) (-574.018) (-576.841) * (-572.755) [-574.348] (-574.770) (-575.285) -- 0:00:29
      369500 -- (-572.167) (-577.967) (-575.410) [-570.951] * (-572.793) (-574.674) (-575.399) [-574.559] -- 0:00:29
      370000 -- (-574.275) [-578.576] (-571.768) (-571.954) * (-575.155) [-572.966] (-574.390) (-575.730) -- 0:00:28

      Average standard deviation of split frequencies: 0.021196

      370500 -- (-575.250) (-574.644) (-575.673) [-572.847] * (-572.263) (-573.003) (-573.584) [-574.357] -- 0:00:28
      371000 -- (-573.274) (-571.118) (-574.814) [-574.923] * (-573.284) [-573.710] (-571.735) (-573.477) -- 0:00:28
      371500 -- (-576.765) (-572.991) (-574.963) [-573.451] * [-571.723] (-573.958) (-574.818) (-572.081) -- 0:00:28
      372000 -- [-572.749] (-571.449) (-576.039) (-574.343) * [-573.918] (-571.899) (-572.669) (-577.009) -- 0:00:28
      372500 -- [-573.046] (-576.005) (-572.261) (-573.618) * (-575.374) (-573.155) [-572.579] (-572.575) -- 0:00:28
      373000 -- (-573.610) [-573.394] (-573.779) (-573.440) * (-574.042) (-571.535) (-572.859) [-573.119] -- 0:00:28
      373500 -- (-573.072) (-572.608) (-573.953) [-573.048] * (-572.163) (-574.213) (-576.198) [-578.717] -- 0:00:28
      374000 -- (-576.814) [-571.705] (-576.689) (-573.469) * (-572.638) [-572.263] (-573.465) (-574.343) -- 0:00:28
      374500 -- (-573.722) (-571.829) (-574.253) [-577.328] * (-572.114) [-571.055] (-572.717) (-573.658) -- 0:00:28
      375000 -- (-574.338) [-577.652] (-572.132) (-571.596) * (-574.189) (-571.635) (-578.437) [-572.058] -- 0:00:28

      Average standard deviation of split frequencies: 0.018388

      375500 -- (-571.692) (-576.604) (-571.597) [-572.801] * (-577.692) [-572.812] (-575.747) (-572.968) -- 0:00:28
      376000 -- (-572.973) (-572.164) (-574.236) [-572.912] * [-572.597] (-573.721) (-580.295) (-571.785) -- 0:00:29
      376500 -- (-571.519) [-573.267] (-575.932) (-571.639) * (-572.850) (-572.174) (-571.822) [-572.871] -- 0:00:29
      377000 -- [-572.962] (-572.730) (-576.418) (-576.765) * (-574.304) (-571.522) (-571.299) [-572.040] -- 0:00:29
      377500 -- (-573.758) [-570.855] (-574.017) (-572.271) * [-577.919] (-574.008) (-571.951) (-571.993) -- 0:00:29
      378000 -- (-573.823) [-571.544] (-572.857) (-573.803) * [-575.663] (-576.137) (-573.148) (-572.468) -- 0:00:29
      378500 -- [-572.873] (-573.352) (-572.776) (-573.399) * (-573.209) (-575.004) [-577.795] (-573.087) -- 0:00:29
      379000 -- (-578.400) (-572.291) [-572.628] (-576.059) * (-572.526) [-572.307] (-571.727) (-578.009) -- 0:00:29
      379500 -- [-573.583] (-571.299) (-575.699) (-572.882) * (-575.493) (-572.768) (-571.553) [-574.670] -- 0:00:29
      380000 -- [-572.495] (-572.913) (-573.011) (-575.587) * [-574.850] (-572.576) (-575.050) (-572.660) -- 0:00:29

      Average standard deviation of split frequencies: 0.020639

      380500 -- [-572.651] (-573.013) (-573.837) (-574.272) * [-572.801] (-572.014) (-572.986) (-573.296) -- 0:00:29
      381000 -- [-572.949] (-577.085) (-573.267) (-574.282) * (-573.832) (-574.658) [-571.297] (-571.360) -- 0:00:29
      381500 -- (-571.721) (-572.428) (-574.775) [-573.265] * (-573.691) [-572.949] (-571.344) (-573.124) -- 0:00:29
      382000 -- [-572.436] (-573.169) (-571.101) (-572.225) * (-576.575) [-573.948] (-574.049) (-571.909) -- 0:00:29
      382500 -- (-571.806) (-573.587) [-571.537] (-574.514) * (-575.386) [-575.900] (-572.956) (-573.544) -- 0:00:29
      383000 -- (-573.125) [-571.703] (-576.688) (-572.007) * (-577.798) (-572.202) [-572.866] (-573.617) -- 0:00:28
      383500 -- (-571.891) (-574.294) [-571.777] (-571.262) * (-571.973) [-574.518] (-572.139) (-572.893) -- 0:00:28
      384000 -- [-570.898] (-572.204) (-574.382) (-571.690) * (-571.497) (-572.612) [-574.169] (-570.914) -- 0:00:28
      384500 -- [-571.655] (-572.838) (-572.536) (-578.550) * (-576.085) [-577.238] (-574.609) (-572.014) -- 0:00:28
      385000 -- (-574.503) (-573.251) [-573.286] (-575.227) * (-574.419) (-573.760) (-573.720) [-571.478] -- 0:00:28

      Average standard deviation of split frequencies: 0.022797

      385500 -- (-572.786) (-578.535) (-574.520) [-574.896] * (-573.156) (-573.882) [-579.294] (-572.120) -- 0:00:28
      386000 -- (-574.577) (-573.824) (-575.159) [-572.313] * (-570.869) [-573.928] (-572.521) (-571.540) -- 0:00:28
      386500 -- [-575.109] (-572.382) (-573.194) (-574.913) * (-575.198) [-572.648] (-573.230) (-571.658) -- 0:00:28
      387000 -- [-571.257] (-572.680) (-577.858) (-573.006) * (-576.945) [-572.302] (-572.787) (-575.326) -- 0:00:28
      387500 -- (-571.889) (-577.795) (-574.274) [-575.039] * (-574.567) [-575.707] (-572.243) (-573.602) -- 0:00:28
      388000 -- (-570.818) [-571.606] (-574.369) (-579.855) * (-575.978) (-572.229) [-573.605] (-573.303) -- 0:00:28
      388500 -- (-570.796) (-573.393) [-573.053] (-574.554) * [-575.092] (-573.287) (-573.568) (-576.882) -- 0:00:28
      389000 -- (-571.901) (-575.054) (-573.078) [-576.208] * (-577.293) (-573.032) (-571.028) [-571.089] -- 0:00:28
      389500 -- (-576.566) [-574.000] (-575.821) (-577.989) * (-573.296) (-571.862) [-574.459] (-573.091) -- 0:00:28
      390000 -- (-572.638) (-571.785) [-571.579] (-574.317) * (-574.593) (-573.581) [-573.768] (-577.543) -- 0:00:28

      Average standard deviation of split frequencies: 0.024133

      390500 -- (-576.161) [-572.459] (-573.245) (-573.742) * [-573.083] (-575.813) (-573.692) (-574.401) -- 0:00:28
      391000 -- (-573.348) (-573.808) (-573.944) [-573.065] * [-576.236] (-573.845) (-571.596) (-575.665) -- 0:00:28
      391500 -- (-572.987) (-573.767) (-575.153) [-572.393] * (-578.871) (-575.131) (-572.396) [-574.495] -- 0:00:27
      392000 -- (-575.513) (-573.612) (-576.574) [-572.437] * (-577.457) (-571.544) (-571.650) [-571.078] -- 0:00:27
      392500 -- (-574.608) (-575.586) [-576.660] (-572.396) * [-573.949] (-572.326) (-576.165) (-572.283) -- 0:00:27
      393000 -- [-572.108] (-575.492) (-576.362) (-571.661) * [-573.536] (-573.563) (-579.399) (-570.851) -- 0:00:27
      393500 -- (-571.330) (-572.056) (-574.813) [-573.845] * [-575.744] (-571.330) (-573.052) (-571.715) -- 0:00:27
      394000 -- [-574.462] (-574.179) (-573.636) (-573.275) * (-571.910) (-575.312) [-575.336] (-572.248) -- 0:00:27
      394500 -- (-574.947) (-578.922) (-571.233) [-582.083] * [-571.523] (-574.579) (-572.884) (-572.720) -- 0:00:27
      395000 -- (-573.088) [-573.534] (-575.584) (-572.935) * (-572.295) [-571.906] (-574.630) (-572.756) -- 0:00:27

      Average standard deviation of split frequencies: 0.023808

      395500 -- [-573.730] (-572.737) (-572.407) (-574.944) * (-578.781) (-571.779) [-574.188] (-572.741) -- 0:00:27
      396000 -- (-571.403) (-578.910) (-571.552) [-571.167] * [-572.129] (-573.279) (-572.020) (-573.561) -- 0:00:27
      396500 -- (-571.476) (-576.324) (-573.672) [-573.003] * (-571.075) [-573.420] (-575.335) (-575.139) -- 0:00:27
      397000 -- (-572.834) (-572.737) (-572.674) [-571.402] * (-573.318) (-572.774) (-572.845) [-571.387] -- 0:00:27
      397500 -- (-574.479) (-573.612) (-575.135) [-571.644] * (-573.325) (-572.528) (-573.670) [-572.077] -- 0:00:27
      398000 -- (-573.851) [-572.198] (-571.741) (-572.226) * [-578.020] (-578.475) (-575.434) (-572.146) -- 0:00:28
      398500 -- (-573.859) (-571.649) [-575.910] (-572.224) * (-571.467) [-574.254] (-573.913) (-575.751) -- 0:00:28
      399000 -- (-575.443) (-571.791) (-572.321) [-572.939] * (-572.221) [-572.116] (-574.999) (-571.320) -- 0:00:28
      399500 -- [-572.795] (-571.470) (-571.952) (-572.386) * (-575.658) (-574.308) [-571.677] (-571.776) -- 0:00:28
      400000 -- (-573.756) [-572.386] (-571.147) (-571.043) * (-576.651) [-571.396] (-574.267) (-571.369) -- 0:00:28

      Average standard deviation of split frequencies: 0.025100

      400500 -- [-571.054] (-572.422) (-572.691) (-572.703) * (-573.831) [-573.411] (-572.046) (-572.835) -- 0:00:28
      401000 -- [-575.540] (-577.274) (-573.578) (-572.188) * (-574.662) (-571.825) (-573.310) [-574.183] -- 0:00:28
      401500 -- (-573.877) (-574.064) (-572.744) [-573.392] * (-573.790) [-571.888] (-571.555) (-573.280) -- 0:00:28
      402000 -- [-573.097] (-572.522) (-572.497) (-573.020) * [-571.248] (-575.589) (-575.909) (-574.281) -- 0:00:28
      402500 -- [-572.643] (-574.191) (-572.968) (-572.053) * [-571.844] (-571.909) (-574.963) (-573.933) -- 0:00:28
      403000 -- (-574.563) (-575.556) (-573.538) [-572.326] * (-570.930) (-572.900) [-573.672] (-575.210) -- 0:00:28
      403500 -- (-575.197) [-572.362] (-571.455) (-576.993) * (-575.814) (-572.092) [-576.999] (-573.948) -- 0:00:28
      404000 -- (-573.278) (-575.128) (-573.212) [-571.390] * [-573.336] (-573.486) (-571.398) (-576.089) -- 0:00:28
      404500 -- (-574.757) [-574.725] (-572.539) (-571.846) * (-574.310) (-573.536) (-572.772) [-571.226] -- 0:00:27
      405000 -- (-571.301) (-574.403) (-576.280) [-571.416] * (-573.706) (-575.088) (-575.274) [-571.812] -- 0:00:27

      Average standard deviation of split frequencies: 0.027092

      405500 -- (-573.194) (-571.889) (-573.955) [-579.552] * [-573.910] (-573.106) (-572.723) (-571.939) -- 0:00:27
      406000 -- (-572.752) [-576.003] (-574.669) (-572.351) * (-572.963) (-573.395) (-573.735) [-571.510] -- 0:00:27
      406500 -- (-574.266) [-571.001] (-572.167) (-571.841) * (-573.343) [-575.216] (-577.307) (-572.027) -- 0:00:27
      407000 -- [-573.543] (-574.806) (-574.669) (-577.021) * (-573.647) [-575.094] (-572.145) (-572.200) -- 0:00:27
      407500 -- (-573.512) (-576.658) (-573.487) [-572.300] * [-574.397] (-572.555) (-573.617) (-571.669) -- 0:00:27
      408000 -- [-571.972] (-573.835) (-572.309) (-574.637) * (-573.473) [-572.990] (-571.046) (-571.122) -- 0:00:27
      408500 -- [-574.734] (-574.518) (-576.782) (-573.812) * (-574.314) [-571.834] (-571.918) (-572.269) -- 0:00:27
      409000 -- (-572.533) (-573.433) [-572.831] (-570.902) * [-575.279] (-573.646) (-574.887) (-575.772) -- 0:00:27
      409500 -- (-571.653) (-572.811) [-574.221] (-572.551) * (-572.200) (-574.363) [-571.453] (-572.279) -- 0:00:27
      410000 -- (-571.990) (-576.014) (-572.102) [-572.122] * (-572.078) (-574.202) (-571.698) [-571.331] -- 0:00:27

      Average standard deviation of split frequencies: 0.026784

      410500 -- (-574.164) [-571.279] (-572.100) (-573.334) * (-573.211) [-571.269] (-573.421) (-571.120) -- 0:00:27
      411000 -- (-572.763) [-571.713] (-571.043) (-572.238) * (-573.653) (-572.326) (-571.828) [-572.035] -- 0:00:27
      411500 -- [-572.984] (-573.599) (-574.107) (-576.800) * (-571.610) (-573.296) (-574.519) [-573.143] -- 0:00:27
      412000 -- (-572.186) [-572.112] (-575.041) (-574.106) * (-573.859) (-572.519) (-575.839) [-574.793] -- 0:00:27
      412500 -- [-572.771] (-575.640) (-572.540) (-573.166) * (-572.173) (-574.360) (-576.183) [-572.519] -- 0:00:27
      413000 -- (-572.121) [-573.290] (-574.308) (-572.702) * (-573.038) [-572.165] (-573.783) (-574.111) -- 0:00:27
      413500 -- (-572.494) [-574.346] (-571.279) (-573.321) * [-573.755] (-574.395) (-573.685) (-575.139) -- 0:00:26
      414000 -- (-572.730) [-575.211] (-573.820) (-574.791) * [-573.860] (-571.722) (-577.454) (-574.828) -- 0:00:26
      414500 -- (-572.793) [-573.501] (-575.886) (-572.450) * (-573.534) [-573.325] (-572.715) (-578.289) -- 0:00:26
      415000 -- (-571.749) (-575.065) [-572.586] (-571.798) * (-574.122) (-573.286) (-575.090) [-573.251] -- 0:00:26

      Average standard deviation of split frequencies: 0.028707

      415500 -- (-571.109) (-577.110) [-572.883] (-573.188) * [-573.760] (-571.868) (-572.156) (-571.550) -- 0:00:26
      416000 -- (-575.377) [-572.730] (-574.135) (-571.787) * [-573.190] (-572.209) (-573.402) (-572.073) -- 0:00:26
      416500 -- (-572.205) [-573.032] (-571.526) (-572.256) * (-573.264) [-571.632] (-572.835) (-571.194) -- 0:00:26
      417000 -- (-571.562) (-573.957) (-573.727) [-572.607] * (-574.151) [-571.475] (-571.104) (-573.628) -- 0:00:26
      417500 -- (-574.392) [-574.601] (-572.009) (-573.022) * (-572.813) [-575.307] (-571.786) (-573.314) -- 0:00:26
      418000 -- (-574.630) (-578.637) (-574.137) [-572.326] * (-572.388) [-571.741] (-573.027) (-573.716) -- 0:00:26
      418500 -- (-572.582) (-574.459) [-572.653] (-575.602) * [-572.261] (-573.791) (-574.050) (-572.789) -- 0:00:26
      419000 -- [-572.162] (-571.709) (-574.933) (-574.293) * (-574.949) [-572.623] (-574.386) (-572.845) -- 0:00:26
      419500 -- (-572.290) [-571.639] (-575.686) (-572.048) * (-572.425) [-573.393] (-571.475) (-572.197) -- 0:00:26
      420000 -- (-571.251) (-573.882) (-572.169) [-571.710] * (-577.783) (-574.019) (-573.804) [-572.594] -- 0:00:27

      Average standard deviation of split frequencies: 0.029136

      420500 -- [-575.373] (-573.079) (-572.515) (-576.902) * (-571.962) (-572.436) (-571.833) [-573.757] -- 0:00:27
      421000 -- (-577.358) (-572.811) [-575.854] (-572.893) * (-574.064) [-572.468] (-572.224) (-572.243) -- 0:00:27
      421500 -- [-572.014] (-572.438) (-573.676) (-574.606) * (-575.328) [-572.845] (-572.112) (-572.753) -- 0:00:27
      422000 -- (-571.866) (-573.209) [-575.891] (-575.269) * [-575.888] (-573.435) (-572.936) (-576.241) -- 0:00:27
      422500 -- (-575.877) (-573.879) [-577.265] (-572.249) * [-573.866] (-572.332) (-572.295) (-573.031) -- 0:00:27
      423000 -- (-572.550) (-572.360) (-572.232) [-571.462] * (-571.290) (-575.363) (-571.156) [-573.412] -- 0:00:27
      423500 -- (-572.768) (-574.080) [-572.317] (-575.226) * [-573.655] (-572.797) (-574.538) (-571.419) -- 0:00:27
      424000 -- (-572.149) [-572.522] (-572.421) (-576.056) * (-571.405) [-573.308] (-572.836) (-579.432) -- 0:00:27
      424500 -- (-574.230) [-572.320] (-573.839) (-571.967) * (-575.463) [-572.071] (-572.103) (-571.473) -- 0:00:27
      425000 -- (-572.617) (-572.447) [-572.340] (-575.262) * (-573.611) (-573.915) (-573.181) [-575.973] -- 0:00:27

      Average standard deviation of split frequencies: 0.025083

      425500 -- [-572.042] (-574.851) (-578.458) (-572.811) * (-575.793) [-572.398] (-573.938) (-573.856) -- 0:00:27
      426000 -- (-575.448) (-573.169) [-572.701] (-573.129) * (-571.776) (-580.959) (-573.099) [-571.746] -- 0:00:26
      426500 -- (-571.247) [-571.711] (-572.171) (-574.153) * [-571.533] (-575.303) (-573.338) (-573.403) -- 0:00:26
      427000 -- [-573.231] (-571.632) (-572.793) (-574.129) * [-574.500] (-573.240) (-575.139) (-572.675) -- 0:00:26
      427500 -- [-572.238] (-572.176) (-574.060) (-571.215) * (-574.205) [-570.932] (-575.758) (-574.856) -- 0:00:26
      428000 -- [-574.473] (-574.069) (-577.699) (-573.792) * (-574.373) (-574.487) [-573.086] (-572.243) -- 0:00:26
      428500 -- (-572.859) [-574.358] (-579.243) (-573.827) * (-572.512) [-571.324] (-576.686) (-571.152) -- 0:00:26
      429000 -- (-572.246) (-571.942) [-581.317] (-577.035) * [-574.862] (-574.508) (-573.142) (-571.692) -- 0:00:26
      429500 -- (-572.988) [-572.347] (-576.596) (-575.496) * (-571.245) [-574.381] (-572.801) (-571.540) -- 0:00:26
      430000 -- (-571.964) (-573.027) [-571.225] (-576.153) * [-572.077] (-573.816) (-573.924) (-571.588) -- 0:00:26

      Average standard deviation of split frequencies: 0.027000

      430500 -- (-574.529) [-575.396] (-572.089) (-573.729) * (-571.710) (-573.856) [-576.476] (-574.839) -- 0:00:26
      431000 -- (-573.550) (-572.728) [-571.871] (-578.441) * [-571.216] (-571.728) (-574.162) (-574.546) -- 0:00:26
      431500 -- (-574.448) (-576.242) (-571.539) [-572.439] * [-572.857] (-573.278) (-573.319) (-573.768) -- 0:00:26
      432000 -- (-574.498) (-579.507) [-572.544] (-575.933) * (-573.867) (-572.615) [-572.272] (-574.867) -- 0:00:26
      432500 -- (-571.941) (-572.795) [-572.221] (-575.016) * (-572.314) (-572.619) [-571.250] (-572.517) -- 0:00:26
      433000 -- (-571.825) [-576.056] (-575.083) (-571.899) * [-573.426] (-572.744) (-572.525) (-573.795) -- 0:00:26
      433500 -- (-572.345) [-574.127] (-575.296) (-571.533) * [-572.550] (-573.594) (-571.369) (-573.766) -- 0:00:26
      434000 -- (-573.654) (-572.817) (-572.699) [-572.459] * (-572.168) (-578.003) (-574.114) [-571.761] -- 0:00:26
      434500 -- (-575.609) (-573.138) [-572.054] (-575.278) * (-573.199) (-571.945) [-577.194] (-573.357) -- 0:00:26
      435000 -- (-571.568) (-573.565) (-573.028) [-572.179] * [-573.628] (-571.494) (-575.741) (-572.133) -- 0:00:25

      Average standard deviation of split frequencies: 0.024507

      435500 -- (-571.948) [-571.835] (-572.271) (-572.134) * (-572.205) [-571.803] (-576.683) (-576.204) -- 0:00:25
      436000 -- (-571.961) (-575.192) [-571.792] (-571.540) * (-573.495) [-571.629] (-573.902) (-571.366) -- 0:00:25
      436500 -- (-572.353) (-571.458) (-572.171) [-573.704] * [-574.349] (-573.424) (-571.546) (-574.341) -- 0:00:25
      437000 -- (-572.550) [-574.133] (-572.792) (-571.732) * (-575.909) [-572.755] (-570.892) (-573.547) -- 0:00:25
      437500 -- (-572.519) (-581.822) [-571.537] (-576.790) * (-572.226) (-573.164) (-574.261) [-575.665] -- 0:00:25
      438000 -- (-572.039) (-573.434) [-573.899] (-576.003) * (-574.924) (-575.445) (-572.712) [-572.129] -- 0:00:25
      438500 -- (-572.069) [-572.652] (-575.900) (-570.915) * [-574.357] (-575.987) (-571.633) (-576.945) -- 0:00:25
      439000 -- [-575.043] (-574.317) (-576.000) (-577.600) * (-573.165) (-576.391) [-572.934] (-578.108) -- 0:00:25
      439500 -- (-573.698) (-573.853) (-574.807) [-574.843] * (-574.018) [-571.744] (-574.048) (-574.862) -- 0:00:25
      440000 -- (-572.018) (-572.460) [-572.247] (-572.396) * [-572.412] (-572.615) (-573.035) (-571.685) -- 0:00:25

      Average standard deviation of split frequencies: 0.023535

      440500 -- [-571.823] (-572.633) (-572.026) (-575.987) * [-572.563] (-572.316) (-572.554) (-571.517) -- 0:00:25
      441000 -- (-571.799) (-571.697) (-572.331) [-577.906] * [-571.545] (-574.039) (-574.048) (-574.416) -- 0:00:25
      441500 -- (-575.039) [-572.035] (-573.276) (-576.085) * [-571.862] (-574.679) (-571.686) (-573.056) -- 0:00:25
      442000 -- [-574.249] (-572.707) (-571.704) (-571.055) * [-571.667] (-571.491) (-572.027) (-576.173) -- 0:00:25
      442500 -- (-572.810) (-572.958) [-572.293] (-574.389) * (-573.838) (-572.818) (-572.381) [-575.066] -- 0:00:26
      443000 -- (-571.867) (-574.752) (-572.796) [-572.732] * (-571.041) (-572.835) [-573.115] (-573.192) -- 0:00:26
      443500 -- [-573.239] (-574.086) (-576.076) (-573.823) * (-571.711) (-571.576) (-571.613) [-572.063] -- 0:00:26
      444000 -- (-575.936) (-571.957) [-579.509] (-572.981) * (-573.882) (-571.907) (-574.124) [-574.005] -- 0:00:26
      444500 -- (-577.940) [-571.818] (-583.012) (-575.800) * [-573.538] (-573.390) (-572.438) (-572.701) -- 0:00:26
      445000 -- (-572.790) (-572.694) (-574.091) [-574.172] * (-575.687) (-572.051) (-573.499) [-571.890] -- 0:00:26

      Average standard deviation of split frequencies: 0.023253

      445500 -- (-573.061) (-575.161) (-574.117) [-573.185] * (-573.837) [-577.020] (-574.511) (-573.671) -- 0:00:26
      446000 -- (-574.374) (-572.944) (-573.090) [-573.241] * (-571.272) [-572.637] (-579.218) (-572.588) -- 0:00:26
      446500 -- [-573.596] (-574.966) (-574.160) (-572.414) * (-571.816) (-573.957) (-573.259) [-572.387] -- 0:00:26
      447000 -- (-572.982) [-572.131] (-572.549) (-573.207) * (-571.062) (-574.214) (-571.884) [-571.783] -- 0:00:25
      447500 -- (-573.629) [-571.790] (-572.922) (-571.459) * (-572.198) [-573.511] (-572.014) (-574.218) -- 0:00:25
      448000 -- (-572.132) [-574.466] (-571.606) (-573.003) * (-574.268) (-574.120) [-571.737] (-577.152) -- 0:00:25
      448500 -- [-574.009] (-573.337) (-577.579) (-572.426) * (-571.329) (-572.215) [-572.480] (-572.836) -- 0:00:25
      449000 -- [-572.210] (-572.950) (-574.448) (-577.378) * [-575.838] (-573.170) (-572.459) (-573.578) -- 0:00:25
      449500 -- [-572.744] (-573.469) (-574.023) (-571.485) * (-573.643) [-573.270] (-573.059) (-574.255) -- 0:00:25
      450000 -- (-572.001) (-570.956) [-575.554] (-572.751) * (-573.237) [-571.963] (-577.006) (-571.656) -- 0:00:25

      Average standard deviation of split frequencies: 0.022315

      450500 -- (-579.576) (-572.009) (-573.324) [-572.124] * (-572.475) (-571.834) [-572.342] (-572.179) -- 0:00:25
      451000 -- [-574.522] (-572.436) (-571.239) (-574.468) * [-573.459] (-579.934) (-572.786) (-571.306) -- 0:00:25
      451500 -- [-575.688] (-576.820) (-573.695) (-573.189) * (-572.532) (-574.566) (-571.150) [-575.259] -- 0:00:25
      452000 -- (-576.376) (-573.188) [-573.267] (-571.475) * (-576.007) [-574.410] (-573.361) (-572.806) -- 0:00:25
      452500 -- (-573.349) (-577.668) (-577.094) [-571.237] * (-576.031) (-580.030) (-573.124) [-570.855] -- 0:00:25
      453000 -- (-573.969) (-572.608) [-574.449] (-575.293) * [-573.868] (-572.687) (-571.960) (-572.753) -- 0:00:25
      453500 -- (-573.480) (-572.676) [-572.811] (-572.826) * (-573.532) (-571.643) (-573.993) [-571.015] -- 0:00:25
      454000 -- (-575.143) [-574.319] (-574.462) (-572.361) * (-571.151) [-572.920] (-571.441) (-574.107) -- 0:00:25
      454500 -- (-574.731) [-575.250] (-575.015) (-577.314) * (-572.614) (-572.166) (-571.136) [-571.089] -- 0:00:25
      455000 -- (-576.189) (-576.833) (-572.076) [-572.711] * (-570.961) (-572.168) (-571.736) [-572.209] -- 0:00:25

      Average standard deviation of split frequencies: 0.021365

      455500 -- [-573.104] (-575.232) (-573.931) (-574.266) * (-572.943) [-573.105] (-572.168) (-574.532) -- 0:00:25
      456000 -- (-572.132) (-574.762) [-571.541] (-572.104) * (-574.901) [-573.055] (-572.226) (-572.695) -- 0:00:25
      456500 -- (-573.374) [-570.827] (-572.114) (-571.648) * [-574.445] (-572.448) (-571.208) (-572.777) -- 0:00:25
      457000 -- (-575.350) (-573.975) [-573.907] (-574.670) * (-576.935) [-570.802] (-571.680) (-579.260) -- 0:00:24
      457500 -- (-572.813) (-572.769) [-571.014] (-576.417) * [-571.665] (-571.499) (-574.689) (-572.618) -- 0:00:24
      458000 -- (-573.806) (-575.804) (-572.101) [-574.018] * [-572.309] (-573.331) (-572.357) (-572.187) -- 0:00:24
      458500 -- (-572.206) (-573.438) (-572.757) [-572.708] * (-571.886) (-575.663) [-575.220] (-574.587) -- 0:00:24
      459000 -- (-573.628) [-572.669] (-573.878) (-571.403) * (-571.949) (-572.330) (-575.459) [-573.160] -- 0:00:24
      459500 -- (-576.575) (-572.783) [-577.729] (-573.778) * (-572.599) (-572.253) (-573.279) [-571.953] -- 0:00:24
      460000 -- (-571.732) [-573.497] (-575.348) (-574.887) * (-575.431) (-573.416) [-571.925] (-572.637) -- 0:00:24

      Average standard deviation of split frequencies: 0.019102

      460500 -- [-572.478] (-574.932) (-572.784) (-573.617) * (-573.680) (-573.345) (-572.164) [-573.728] -- 0:00:24
      461000 -- (-574.837) (-575.847) [-574.362] (-576.117) * (-573.731) [-572.284] (-571.940) (-573.223) -- 0:00:24
      461500 -- (-571.414) [-572.246] (-571.534) (-572.633) * (-571.761) (-571.621) [-574.078] (-574.178) -- 0:00:24
      462000 -- (-573.162) (-572.700) [-573.240] (-572.593) * (-571.165) (-573.941) [-571.838] (-573.538) -- 0:00:24
      462500 -- (-574.062) [-572.025] (-574.737) (-572.190) * (-572.321) (-572.791) [-571.866] (-573.847) -- 0:00:24
      463000 -- (-585.034) (-572.915) (-572.101) [-571.465] * [-571.911] (-573.477) (-572.746) (-571.148) -- 0:00:24
      463500 -- [-573.835] (-572.558) (-572.190) (-577.157) * (-572.182) [-571.459] (-574.019) (-574.499) -- 0:00:24
      464000 -- (-577.759) (-575.514) (-573.513) [-573.384] * (-571.191) (-572.686) [-571.792] (-571.941) -- 0:00:24
      464500 -- [-572.290] (-574.198) (-574.431) (-574.152) * (-571.271) (-575.148) [-574.655] (-571.968) -- 0:00:25
      465000 -- [-572.189] (-573.127) (-576.150) (-571.032) * (-571.610) [-573.558] (-572.125) (-573.039) -- 0:00:25

      Average standard deviation of split frequencies: 0.015511

      465500 -- [-574.524] (-579.567) (-575.808) (-575.566) * (-572.583) (-571.407) [-571.290] (-574.210) -- 0:00:25
      466000 -- (-572.335) (-576.212) [-573.458] (-571.326) * (-579.143) (-574.917) [-574.173] (-573.095) -- 0:00:25
      466500 -- (-573.652) (-573.255) (-577.893) [-573.256] * [-571.744] (-577.211) (-572.552) (-578.575) -- 0:00:25
      467000 -- [-572.135] (-572.094) (-572.567) (-576.026) * (-572.021) (-571.430) [-571.442] (-573.803) -- 0:00:25
      467500 -- (-570.859) (-572.841) (-576.357) [-574.046] * (-572.372) (-571.200) [-575.518] (-571.808) -- 0:00:25
      468000 -- (-572.385) (-571.911) (-574.460) [-570.812] * (-572.223) [-571.026] (-572.310) (-572.427) -- 0:00:25
      468500 -- (-573.224) (-573.145) (-572.010) [-573.171] * (-571.590) [-576.354] (-575.434) (-573.153) -- 0:00:24
      469000 -- (-573.781) (-571.984) (-576.869) [-573.940] * (-573.116) [-574.178] (-575.922) (-572.442) -- 0:00:24
      469500 -- (-580.960) (-572.259) [-571.130] (-570.885) * (-574.268) (-571.913) (-576.356) [-572.473] -- 0:00:24
      470000 -- (-573.249) [-571.169] (-573.542) (-572.866) * (-571.873) (-574.072) (-573.511) [-572.879] -- 0:00:24

      Average standard deviation of split frequencies: 0.016025

      470500 -- (-571.173) [-573.135] (-576.033) (-571.681) * [-572.309] (-573.526) (-573.422) (-572.430) -- 0:00:24
      471000 -- [-572.169] (-572.487) (-573.085) (-572.199) * (-575.656) (-572.847) (-571.460) [-573.732] -- 0:00:24
      471500 -- (-574.211) (-574.319) (-574.524) [-571.833] * (-574.741) (-572.963) (-575.816) [-574.546] -- 0:00:24
      472000 -- [-576.998] (-573.601) (-580.418) (-571.532) * [-572.981] (-574.827) (-571.383) (-576.747) -- 0:00:24
      472500 -- (-574.245) [-576.833] (-574.441) (-571.982) * (-572.495) (-572.657) [-573.030] (-575.936) -- 0:00:24
      473000 -- (-571.406) (-572.596) [-571.944] (-571.525) * (-581.016) [-572.933] (-575.034) (-574.312) -- 0:00:24
      473500 -- (-572.083) (-574.691) (-572.514) [-572.998] * (-577.172) (-572.678) (-573.510) [-570.992] -- 0:00:24
      474000 -- (-576.301) [-573.776] (-572.923) (-574.504) * (-579.093) [-571.828] (-575.106) (-576.661) -- 0:00:24
      474500 -- (-572.736) (-577.140) [-572.068] (-573.082) * [-580.096] (-574.545) (-575.779) (-573.569) -- 0:00:24
      475000 -- [-572.299] (-571.343) (-572.093) (-571.297) * (-579.533) [-573.062] (-573.854) (-572.967) -- 0:00:24

      Average standard deviation of split frequencies: 0.016506

      475500 -- [-576.699] (-574.069) (-578.294) (-573.902) * [-572.410] (-572.929) (-575.679) (-572.537) -- 0:00:24
      476000 -- [-571.873] (-574.219) (-576.283) (-571.974) * (-573.005) (-571.624) [-574.478] (-575.588) -- 0:00:24
      476500 -- (-576.167) (-572.883) [-573.817] (-574.238) * (-573.609) [-574.252] (-572.487) (-574.879) -- 0:00:24
      477000 -- (-579.163) [-572.445] (-572.453) (-575.605) * (-573.792) (-574.164) (-572.844) [-573.898] -- 0:00:24
      477500 -- (-575.138) [-572.696] (-573.503) (-574.445) * (-575.310) (-573.406) (-572.142) [-572.767] -- 0:00:24
      478000 -- [-574.909] (-573.164) (-573.046) (-573.483) * [-573.842] (-574.488) (-572.602) (-572.309) -- 0:00:24
      478500 -- (-574.812) (-574.383) [-572.209] (-572.177) * (-572.908) (-571.790) (-575.918) [-571.335] -- 0:00:23
      479000 -- [-571.259] (-572.161) (-574.553) (-572.732) * [-574.650] (-571.869) (-574.320) (-573.790) -- 0:00:23
      479500 -- (-574.884) (-571.867) (-574.327) [-573.569] * (-574.620) (-571.207) (-573.181) [-572.805] -- 0:00:23
      480000 -- [-573.350] (-575.909) (-573.062) (-574.461) * [-575.536] (-572.211) (-574.888) (-574.552) -- 0:00:23

      Average standard deviation of split frequencies: 0.015038

      480500 -- (-574.453) (-574.031) (-572.536) [-573.409] * (-572.292) [-574.540] (-572.262) (-575.075) -- 0:00:23
      481000 -- (-575.438) (-571.541) (-571.151) [-571.179] * (-574.029) [-575.142] (-574.209) (-575.097) -- 0:00:23
      481500 -- [-572.468] (-573.471) (-575.889) (-572.342) * (-576.084) (-571.724) (-571.720) [-572.333] -- 0:00:23
      482000 -- (-572.512) (-576.769) [-572.173] (-572.550) * [-572.525] (-572.309) (-573.504) (-579.093) -- 0:00:23
      482500 -- (-572.589) [-572.968] (-572.495) (-574.266) * (-572.572) (-575.074) (-574.134) [-572.470] -- 0:00:23
      483000 -- (-573.693) [-571.932] (-573.719) (-572.725) * [-572.175] (-573.080) (-572.296) (-572.556) -- 0:00:23
      483500 -- (-573.929) (-574.282) (-574.883) [-573.709] * [-574.891] (-571.229) (-572.676) (-571.188) -- 0:00:23
      484000 -- (-575.082) (-576.785) (-573.314) [-575.136] * (-572.166) (-575.071) [-572.603] (-572.325) -- 0:00:23
      484500 -- (-572.998) [-572.873] (-572.559) (-575.827) * [-571.019] (-571.327) (-572.275) (-575.118) -- 0:00:23
      485000 -- (-571.336) (-572.204) [-572.345] (-574.603) * [-571.748] (-571.419) (-572.554) (-573.261) -- 0:00:23

      Average standard deviation of split frequencies: 0.016166

      485500 -- (-571.743) [-573.838] (-574.303) (-575.847) * (-575.712) [-572.395] (-573.974) (-573.239) -- 0:00:23
      486000 -- (-571.630) (-574.919) (-576.844) [-574.457] * (-570.914) [-574.209] (-573.441) (-576.745) -- 0:00:23
      486500 -- (-571.741) (-572.371) (-575.136) [-571.287] * (-574.837) (-571.645) [-577.427] (-572.135) -- 0:00:24
      487000 -- (-571.653) (-573.105) [-575.915] (-573.312) * (-571.778) (-578.600) (-572.673) [-572.079] -- 0:00:24
      487500 -- [-572.665] (-580.460) (-573.266) (-576.934) * [-573.624] (-571.945) (-574.278) (-572.028) -- 0:00:24
      488000 -- [-573.352] (-575.247) (-574.215) (-573.945) * (-573.210) (-573.953) [-571.662] (-572.652) -- 0:00:24
      488500 -- (-571.122) [-577.330] (-577.949) (-571.930) * [-576.870] (-573.991) (-571.176) (-572.055) -- 0:00:24
      489000 -- (-571.512) (-572.596) [-572.750] (-571.171) * (-572.147) [-572.546] (-571.410) (-573.363) -- 0:00:24
      489500 -- (-575.965) [-571.936] (-571.880) (-578.176) * (-571.543) (-574.070) (-572.586) [-571.158] -- 0:00:23
      490000 -- [-572.028] (-572.167) (-571.981) (-574.526) * (-574.585) (-572.342) [-572.810] (-577.270) -- 0:00:23

      Average standard deviation of split frequencies: 0.015372

      490500 -- (-578.798) [-570.972] (-573.289) (-575.564) * [-572.084] (-571.630) (-573.360) (-578.365) -- 0:00:23
      491000 -- (-575.426) (-577.196) [-572.370] (-571.614) * (-573.573) [-576.277] (-574.211) (-571.248) -- 0:00:23
      491500 -- [-571.526] (-578.998) (-573.173) (-571.994) * [-572.871] (-572.737) (-573.313) (-571.194) -- 0:00:23
      492000 -- (-574.443) (-580.411) [-576.199] (-574.653) * [-574.472] (-572.083) (-572.667) (-571.787) -- 0:00:23
      492500 -- (-573.849) (-578.247) (-573.008) [-571.160] * (-573.161) (-571.632) (-575.973) [-572.716] -- 0:00:23
      493000 -- (-574.775) [-572.841] (-571.948) (-572.306) * [-573.424] (-572.849) (-575.741) (-571.287) -- 0:00:23
      493500 -- [-574.468] (-570.947) (-572.824) (-572.630) * [-572.955] (-572.792) (-571.590) (-572.238) -- 0:00:23
      494000 -- (-574.102) (-573.342) (-573.868) [-571.700] * (-573.409) [-577.068] (-574.535) (-571.216) -- 0:00:23
      494500 -- (-576.872) (-573.998) (-570.899) [-571.611] * (-573.588) (-571.495) [-571.311] (-572.839) -- 0:00:23
      495000 -- (-573.400) [-572.327] (-573.130) (-575.742) * (-572.233) (-573.583) (-574.054) [-572.004] -- 0:00:23

      Average standard deviation of split frequencies: 0.017107

      495500 -- (-571.881) [-573.248] (-577.578) (-572.714) * [-574.190] (-572.759) (-573.910) (-573.457) -- 0:00:23
      496000 -- (-573.442) (-574.172) [-571.711] (-575.016) * (-574.960) [-573.315] (-573.141) (-573.618) -- 0:00:23
      496500 -- (-571.035) (-572.487) (-573.169) [-573.772] * [-574.310] (-574.204) (-571.186) (-571.272) -- 0:00:23
      497000 -- (-574.586) [-571.950] (-572.586) (-575.185) * [-571.550] (-575.692) (-574.015) (-579.716) -- 0:00:23
      497500 -- [-570.979] (-572.088) (-574.718) (-574.281) * (-573.072) (-573.558) (-572.222) [-574.615] -- 0:00:23
      498000 -- (-571.944) [-571.944] (-577.178) (-572.513) * (-577.834) [-571.888] (-572.938) (-573.144) -- 0:00:23
      498500 -- (-575.382) [-571.060] (-574.879) (-572.181) * [-573.932] (-572.205) (-575.661) (-576.818) -- 0:00:23
      499000 -- (-574.971) [-571.305] (-576.404) (-571.656) * (-573.068) [-574.647] (-575.083) (-577.719) -- 0:00:23
      499500 -- (-572.605) (-571.334) [-571.451] (-574.845) * (-573.940) (-571.562) [-572.555] (-574.618) -- 0:00:23
      500000 -- (-571.447) [-572.361] (-575.330) (-571.454) * (-573.123) (-573.805) (-577.396) [-572.720] -- 0:00:23

      Average standard deviation of split frequencies: 0.016948

      500500 -- [-571.541] (-576.678) (-574.386) (-573.443) * [-574.792] (-573.848) (-572.865) (-574.178) -- 0:00:22
      501000 -- (-574.026) [-573.538] (-575.707) (-571.208) * [-572.504] (-573.564) (-575.246) (-571.703) -- 0:00:22
      501500 -- [-573.573] (-574.383) (-573.930) (-572.108) * (-574.762) (-575.508) [-571.874] (-570.762) -- 0:00:22
      502000 -- (-572.294) (-572.703) (-571.812) [-573.384] * (-573.336) (-573.077) (-572.954) [-572.609] -- 0:00:22
      502500 -- (-573.818) (-571.188) [-572.665] (-572.741) * (-571.311) [-571.580] (-573.414) (-571.366) -- 0:00:22
      503000 -- (-573.547) [-572.235] (-571.674) (-574.804) * (-571.862) [-572.332] (-578.243) (-574.554) -- 0:00:22
      503500 -- [-571.297] (-576.832) (-573.488) (-572.181) * (-573.801) (-571.165) [-573.666] (-576.565) -- 0:00:22
      504000 -- (-571.805) (-575.771) (-574.822) [-573.413] * (-576.022) (-572.169) (-572.522) [-573.045] -- 0:00:22
      504500 -- (-571.189) (-579.614) (-571.047) [-572.263] * (-576.581) [-572.192] (-573.141) (-573.174) -- 0:00:22
      505000 -- (-572.558) (-571.571) [-572.885] (-572.538) * (-573.562) [-573.478] (-575.723) (-571.354) -- 0:00:22

      Average standard deviation of split frequencies: 0.015527

      505500 -- (-571.250) (-575.103) (-573.047) [-571.301] * (-577.372) (-574.685) (-576.715) [-571.328] -- 0:00:22
      506000 -- (-571.954) [-573.375] (-572.639) (-571.092) * (-571.424) (-577.571) (-571.612) [-571.753] -- 0:00:22
      506500 -- (-573.670) (-576.668) [-572.155] (-574.192) * (-571.606) [-573.750] (-573.658) (-572.172) -- 0:00:22
      507000 -- (-574.416) [-573.506] (-572.125) (-571.809) * (-575.204) (-572.873) (-571.995) [-572.169] -- 0:00:22
      507500 -- [-573.310] (-571.720) (-573.138) (-571.615) * (-572.394) (-571.461) (-571.452) [-573.219] -- 0:00:22
      508000 -- [-573.400] (-572.492) (-572.998) (-572.985) * (-573.494) (-574.134) (-572.799) [-573.553] -- 0:00:22
      508500 -- (-575.810) [-571.853] (-573.662) (-573.469) * [-571.199] (-573.802) (-575.817) (-571.412) -- 0:00:22
      509000 -- (-572.867) (-572.127) [-574.742] (-576.266) * (-578.249) (-571.418) [-572.535] (-575.946) -- 0:00:23
      509500 -- (-574.238) (-574.048) (-573.865) [-573.662] * (-573.686) (-571.466) [-574.708] (-574.416) -- 0:00:23
      510000 -- (-570.882) (-573.195) [-573.517] (-573.265) * (-573.924) (-571.769) (-573.665) [-575.036] -- 0:00:23

      Average standard deviation of split frequencies: 0.016616

      510500 -- (-572.080) (-578.209) (-572.963) [-573.139] * [-573.511] (-573.761) (-574.523) (-572.043) -- 0:00:23
      511000 -- (-572.639) (-573.366) [-572.783] (-577.248) * (-574.647) (-572.489) (-574.216) [-572.970] -- 0:00:22
      511500 -- [-585.148] (-572.492) (-572.504) (-571.113) * (-571.904) (-572.396) [-573.953] (-572.481) -- 0:00:22
      512000 -- (-571.531) (-573.234) [-578.229] (-572.136) * (-573.396) (-572.943) (-577.527) [-571.296] -- 0:00:22
      512500 -- (-577.807) (-573.924) [-572.906] (-573.003) * (-576.391) [-572.227] (-576.812) (-575.955) -- 0:00:22
      513000 -- [-572.207] (-573.183) (-575.564) (-572.930) * (-572.236) (-571.893) (-574.398) [-572.725] -- 0:00:22
      513500 -- (-573.773) (-573.016) [-574.306] (-574.731) * [-572.114] (-573.722) (-579.505) (-571.656) -- 0:00:22
      514000 -- [-572.460] (-572.793) (-572.347) (-574.061) * (-572.347) (-576.901) (-574.185) [-572.910] -- 0:00:22
      514500 -- (-575.706) (-574.713) (-573.043) [-572.113] * (-574.516) [-573.109] (-579.342) (-573.626) -- 0:00:22
      515000 -- (-573.040) (-573.768) [-573.323] (-571.368) * [-572.994] (-572.667) (-575.344) (-571.884) -- 0:00:22

      Average standard deviation of split frequencies: 0.017053

      515500 -- (-573.848) (-572.713) [-572.536] (-571.117) * [-572.238] (-572.848) (-574.473) (-574.600) -- 0:00:22
      516000 -- [-571.614] (-572.097) (-573.138) (-572.386) * [-572.356] (-574.597) (-573.428) (-577.122) -- 0:00:22
      516500 -- (-571.903) [-573.015] (-577.079) (-574.085) * (-577.707) (-572.477) [-577.094] (-574.266) -- 0:00:22
      517000 -- (-573.094) (-572.511) (-573.912) [-572.637] * (-579.116) [-573.226] (-574.048) (-572.011) -- 0:00:22
      517500 -- (-575.259) (-573.995) (-572.358) [-575.012] * (-577.712) (-572.437) [-573.747] (-571.950) -- 0:00:22
      518000 -- (-573.772) (-572.161) (-573.295) [-577.163] * (-574.489) (-573.006) (-574.168) [-572.458] -- 0:00:22
      518500 -- (-572.436) [-572.465] (-574.081) (-576.957) * (-573.342) [-572.892] (-572.716) (-573.963) -- 0:00:22
      519000 -- (-573.058) (-571.745) [-574.910] (-575.999) * (-571.743) (-575.004) [-574.644] (-572.286) -- 0:00:22
      519500 -- (-571.331) (-572.644) [-572.956] (-572.280) * (-572.631) (-572.508) (-575.114) [-572.066] -- 0:00:22
      520000 -- (-573.540) [-573.427] (-575.982) (-572.907) * [-573.402] (-571.576) (-577.821) (-573.240) -- 0:00:22

      Average standard deviation of split frequencies: 0.016901

      520500 -- (-575.019) [-573.651] (-574.412) (-576.944) * (-573.251) (-573.806) (-576.183) [-574.364] -- 0:00:22
      521000 -- (-576.398) (-571.934) [-577.174] (-577.613) * (-573.030) (-573.173) (-574.960) [-571.965] -- 0:00:22
      521500 -- [-573.363] (-572.758) (-577.769) (-573.120) * (-571.642) [-575.641] (-571.416) (-572.659) -- 0:00:22
      522000 -- (-574.430) (-575.225) (-575.838) [-571.540] * (-573.499) (-574.218) [-572.472] (-577.699) -- 0:00:21
      522500 -- [-571.586] (-572.989) (-570.918) (-572.940) * (-573.959) (-577.943) [-572.733] (-574.646) -- 0:00:21
      523000 -- (-575.754) (-571.811) [-576.869] (-572.298) * [-572.027] (-573.779) (-573.865) (-571.044) -- 0:00:21
      523500 -- (-572.247) (-571.956) (-573.909) [-573.059] * [-572.233] (-573.035) (-576.045) (-571.337) -- 0:00:21
      524000 -- (-572.078) [-572.192] (-576.314) (-571.988) * (-571.356) [-572.951] (-574.742) (-574.825) -- 0:00:21
      524500 -- (-573.510) [-572.913] (-578.841) (-572.635) * (-576.181) (-575.991) (-573.212) [-573.394] -- 0:00:21
      525000 -- (-573.384) (-574.958) (-572.445) [-573.952] * (-574.962) (-574.543) [-578.437] (-573.640) -- 0:00:21

      Average standard deviation of split frequencies: 0.016729

      525500 -- (-576.748) (-571.614) [-575.819] (-571.030) * (-574.275) (-574.385) (-573.567) [-571.201] -- 0:00:21
      526000 -- (-576.313) (-571.390) [-574.313] (-572.332) * (-573.265) [-572.506] (-573.469) (-571.552) -- 0:00:21
      526500 -- [-571.984] (-572.939) (-574.939) (-572.313) * (-573.065) [-574.104] (-574.319) (-571.512) -- 0:00:21
      527000 -- (-571.957) (-573.029) (-582.529) [-575.856] * (-572.262) (-573.279) [-573.514] (-573.592) -- 0:00:21
      527500 -- (-573.960) (-571.160) (-573.142) [-573.503] * [-571.193] (-573.801) (-571.956) (-575.384) -- 0:00:21
      528000 -- [-571.985] (-572.962) (-571.087) (-576.834) * (-573.809) (-572.231) [-572.580] (-574.682) -- 0:00:21
      528500 -- (-571.807) (-576.011) [-571.617] (-571.218) * (-576.786) (-573.685) [-572.008] (-577.508) -- 0:00:21
      529000 -- (-571.514) (-572.361) [-571.073] (-571.697) * (-575.193) (-573.778) (-572.312) [-573.086] -- 0:00:21
      529500 -- (-572.015) (-576.342) (-571.868) [-572.767] * [-575.516] (-574.905) (-573.520) (-575.309) -- 0:00:21
      530000 -- (-573.624) [-573.598] (-573.170) (-571.362) * (-575.001) [-572.074] (-574.477) (-571.891) -- 0:00:21

      Average standard deviation of split frequencies: 0.016582

      530500 -- (-572.313) [-571.897] (-573.560) (-571.830) * (-573.347) (-572.680) [-573.858] (-571.499) -- 0:00:21
      531000 -- (-573.286) (-573.335) [-572.131] (-573.503) * (-573.294) [-572.326] (-573.394) (-573.467) -- 0:00:21
      531500 -- (-574.162) (-573.587) (-572.590) [-571.610] * (-571.757) [-573.470] (-574.955) (-571.345) -- 0:00:22
      532000 -- (-573.121) (-573.693) [-571.994] (-574.811) * (-571.765) [-572.390] (-572.078) (-571.522) -- 0:00:21
      532500 -- (-573.073) [-573.191] (-575.152) (-574.554) * (-571.391) [-573.480] (-571.208) (-572.906) -- 0:00:21
      533000 -- (-571.975) (-572.929) (-579.829) [-573.776] * (-571.563) [-571.340] (-571.485) (-576.808) -- 0:00:21
      533500 -- (-572.370) [-571.567] (-573.699) (-574.144) * (-572.087) [-571.530] (-573.431) (-574.298) -- 0:00:21
      534000 -- [-571.679] (-574.448) (-576.424) (-575.779) * [-572.908] (-574.015) (-574.102) (-572.189) -- 0:00:21
      534500 -- (-571.713) (-574.337) [-573.128] (-573.040) * (-575.814) (-571.497) (-573.706) [-572.025] -- 0:00:21
      535000 -- [-572.866] (-579.769) (-573.268) (-571.642) * (-575.732) [-571.015] (-576.144) (-571.730) -- 0:00:21

      Average standard deviation of split frequencies: 0.015831

      535500 -- (-572.338) [-574.630] (-571.440) (-573.405) * [-572.627] (-573.756) (-575.947) (-571.779) -- 0:00:21
      536000 -- (-571.143) [-574.747] (-578.724) (-572.819) * (-571.782) (-577.237) (-572.175) [-574.973] -- 0:00:21
      536500 -- (-572.978) (-573.107) [-572.442] (-571.825) * (-574.962) [-571.915] (-573.240) (-572.231) -- 0:00:21
      537000 -- [-577.536] (-572.504) (-575.442) (-575.801) * (-574.958) [-571.943] (-571.397) (-575.310) -- 0:00:21
      537500 -- (-575.849) [-572.266] (-574.830) (-574.725) * (-573.707) [-572.197] (-572.525) (-574.238) -- 0:00:21
      538000 -- (-576.211) (-572.295) [-571.350] (-571.437) * (-572.654) (-573.029) [-574.527] (-572.693) -- 0:00:21
      538500 -- [-572.813] (-575.368) (-574.241) (-571.710) * (-571.750) (-572.511) [-572.874] (-574.936) -- 0:00:21
      539000 -- (-572.628) (-574.910) [-577.037] (-573.424) * (-575.592) (-575.357) [-571.998] (-572.094) -- 0:00:21
      539500 -- [-573.888] (-572.245) (-574.716) (-574.677) * (-572.325) (-571.847) (-572.140) [-570.745] -- 0:00:21
      540000 -- [-571.906] (-572.230) (-575.486) (-572.996) * (-573.231) (-574.635) [-573.888] (-572.345) -- 0:00:21

      Average standard deviation of split frequencies: 0.016275

      540500 -- (-571.745) (-576.802) (-574.143) [-573.832] * [-572.334] (-571.481) (-573.147) (-574.974) -- 0:00:21
      541000 -- (-575.310) (-574.292) (-578.078) [-573.425] * [-572.910] (-572.499) (-571.859) (-572.648) -- 0:00:21
      541500 -- [-572.903] (-573.222) (-576.187) (-578.148) * (-573.140) [-572.725] (-573.209) (-571.311) -- 0:00:21
      542000 -- (-575.980) [-571.560] (-573.437) (-571.849) * [-571.507] (-573.473) (-571.155) (-575.164) -- 0:00:21
      542500 -- (-572.748) [-573.037] (-572.884) (-573.194) * (-573.390) (-571.689) (-572.658) [-574.752] -- 0:00:21
      543000 -- (-572.155) [-573.602] (-573.144) (-573.155) * (-572.247) (-571.925) [-573.914] (-573.110) -- 0:00:21
      543500 -- (-574.824) (-571.980) (-577.329) [-570.964] * [-572.047] (-573.299) (-572.464) (-573.077) -- 0:00:20
      544000 -- (-572.048) (-571.892) (-573.881) [-574.018] * [-573.464] (-572.623) (-571.689) (-571.961) -- 0:00:20
      544500 -- (-575.051) [-572.661] (-572.085) (-574.345) * [-571.310] (-571.888) (-574.071) (-579.785) -- 0:00:20
      545000 -- [-573.684] (-572.434) (-575.576) (-576.198) * (-571.292) (-572.183) (-573.874) [-572.289] -- 0:00:20

      Average standard deviation of split frequencies: 0.015541

      545500 -- (-572.429) [-571.259] (-578.245) (-571.710) * (-571.463) [-573.268] (-573.961) (-571.564) -- 0:00:20
      546000 -- [-571.248] (-574.230) (-572.688) (-571.695) * (-571.898) [-572.387] (-571.643) (-574.351) -- 0:00:20
      546500 -- (-571.037) (-573.305) [-573.624] (-573.729) * (-572.423) (-572.743) (-571.272) [-571.604] -- 0:00:20
      547000 -- (-573.430) (-571.743) [-575.714] (-571.749) * (-571.749) (-572.252) (-571.570) [-574.701] -- 0:00:20
      547500 -- [-574.363] (-574.273) (-572.951) (-572.083) * [-572.570] (-575.038) (-575.052) (-573.749) -- 0:00:20
      548000 -- (-572.838) [-572.520] (-572.814) (-575.442) * (-575.814) (-574.612) (-571.638) [-571.759] -- 0:00:20
      548500 -- (-576.735) (-572.157) [-571.266] (-571.213) * (-571.299) (-574.797) [-571.909] (-574.557) -- 0:00:20
      549000 -- (-578.095) (-572.396) [-571.560] (-573.971) * (-572.045) (-571.601) (-573.081) [-574.232] -- 0:00:20
      549500 -- [-573.804] (-572.670) (-574.428) (-572.203) * (-574.805) [-573.416] (-573.254) (-576.411) -- 0:00:20
      550000 -- [-578.300] (-572.065) (-575.573) (-572.308) * (-572.614) (-575.295) [-575.031] (-577.478) -- 0:00:20

      Average standard deviation of split frequencies: 0.015980

      550500 -- (-573.053) [-572.647] (-576.689) (-572.340) * (-572.327) [-571.863] (-574.893) (-575.473) -- 0:00:20
      551000 -- (-574.120) [-572.490] (-573.852) (-571.328) * (-571.393) (-573.494) (-571.970) [-571.772] -- 0:00:20
      551500 -- (-576.096) (-573.980) [-573.576] (-574.603) * (-573.783) (-574.580) (-573.208) [-572.124] -- 0:00:20
      552000 -- (-572.693) (-571.209) (-576.694) [-573.334] * (-572.359) (-572.019) [-571.947] (-572.454) -- 0:00:20
      552500 -- [-572.369] (-571.516) (-573.332) (-575.400) * (-573.101) (-572.174) (-572.330) [-574.045] -- 0:00:20
      553000 -- (-573.338) [-573.598] (-574.580) (-574.550) * (-572.196) [-573.027] (-572.081) (-574.911) -- 0:00:20
      553500 -- (-577.075) [-572.846] (-572.971) (-572.708) * [-571.000] (-571.309) (-577.803) (-574.283) -- 0:00:20
      554000 -- (-571.720) (-573.989) [-573.553] (-573.657) * (-572.742) [-571.795] (-571.366) (-571.895) -- 0:00:20
      554500 -- [-571.765] (-572.709) (-575.109) (-574.955) * (-575.937) [-571.967] (-572.204) (-573.948) -- 0:00:20
      555000 -- (-571.528) (-574.862) [-574.174] (-573.753) * (-574.407) (-578.596) [-571.939] (-573.251) -- 0:00:20

      Average standard deviation of split frequencies: 0.014696

      555500 -- (-571.619) (-575.866) (-574.153) [-572.461] * (-573.336) (-572.079) [-572.784] (-578.493) -- 0:00:20
      556000 -- (-574.786) (-574.817) (-571.927) [-571.495] * (-573.354) [-573.831] (-572.215) (-570.873) -- 0:00:20
      556500 -- (-573.004) [-572.072] (-577.533) (-570.902) * [-575.105] (-575.287) (-572.187) (-572.403) -- 0:00:20
      557000 -- (-572.239) (-572.959) (-573.053) [-572.921] * (-581.833) [-572.875] (-578.142) (-577.392) -- 0:00:20
      557500 -- (-572.816) (-576.243) (-574.281) [-572.284] * (-574.320) (-571.848) [-571.183] (-572.306) -- 0:00:20
      558000 -- (-574.731) (-575.224) [-572.060] (-572.444) * (-572.569) [-574.468] (-574.664) (-573.099) -- 0:00:20
      558500 -- (-576.310) (-571.696) [-572.598] (-576.028) * (-575.178) (-576.690) (-573.710) [-572.569] -- 0:00:20
      559000 -- (-572.243) [-573.691] (-572.546) (-573.367) * (-571.862) (-577.160) (-573.081) [-573.501] -- 0:00:20
      559500 -- (-573.512) [-573.602] (-572.626) (-571.818) * [-571.694] (-577.995) (-576.308) (-572.273) -- 0:00:20
      560000 -- (-570.772) [-572.546] (-571.636) (-571.236) * (-572.642) (-572.084) [-573.407] (-574.201) -- 0:00:20

      Average standard deviation of split frequencies: 0.016816

      560500 -- (-572.928) (-572.281) (-572.580) [-571.675] * [-573.212] (-576.079) (-574.549) (-575.114) -- 0:00:20
      561000 -- (-579.237) (-572.132) (-572.207) [-571.291] * (-576.416) [-574.130] (-573.086) (-573.587) -- 0:00:20
      561500 -- (-578.261) [-573.090] (-571.988) (-573.309) * (-575.593) (-571.345) [-573.763] (-571.403) -- 0:00:20
      562000 -- (-573.115) [-573.867] (-573.369) (-571.674) * (-572.404) (-573.653) (-578.337) [-573.219] -- 0:00:20
      562500 -- (-573.236) (-571.617) [-572.873] (-579.248) * (-573.611) (-570.936) (-571.781) [-574.432] -- 0:00:20
      563000 -- (-572.862) [-572.477] (-572.962) (-579.235) * (-578.654) (-573.524) (-572.415) [-572.648] -- 0:00:20
      563500 -- (-572.949) [-572.738] (-575.490) (-575.560) * (-572.244) [-572.130] (-571.499) (-575.308) -- 0:00:20
      564000 -- (-572.980) [-574.125] (-571.568) (-574.497) * [-571.602] (-572.040) (-574.815) (-572.342) -- 0:00:20
      564500 -- [-577.054] (-571.236) (-571.332) (-575.189) * (-571.898) (-572.901) [-576.750] (-572.218) -- 0:00:20
      565000 -- (-576.915) (-574.525) [-570.761] (-572.766) * [-571.916] (-572.508) (-573.999) (-574.729) -- 0:00:20

      Average standard deviation of split frequencies: 0.014436

      565500 -- (-574.156) (-578.387) [-574.902] (-573.335) * (-571.147) (-573.128) (-571.833) [-572.885] -- 0:00:19
      566000 -- (-573.227) (-573.136) (-572.895) [-571.709] * (-574.664) (-572.815) [-572.541] (-572.176) -- 0:00:19
      566500 -- (-574.003) (-575.237) [-574.413] (-574.389) * (-572.110) (-574.826) (-572.075) [-571.455] -- 0:00:19
      567000 -- (-573.921) (-573.570) (-578.299) [-570.712] * (-575.456) (-576.127) [-571.246] (-572.028) -- 0:00:19
      567500 -- (-571.278) (-578.101) [-573.433] (-570.874) * (-572.805) (-573.516) (-573.609) [-574.671] -- 0:00:19
      568000 -- [-574.154] (-577.559) (-574.039) (-571.433) * [-576.036] (-575.919) (-576.079) (-572.667) -- 0:00:19
      568500 -- (-572.782) (-572.823) [-572.451] (-573.232) * (-574.797) (-571.787) [-574.941] (-572.114) -- 0:00:19
      569000 -- (-576.450) (-573.545) (-571.879) [-572.923] * (-576.609) [-576.213] (-580.682) (-574.127) -- 0:00:19
      569500 -- (-571.853) [-571.846] (-571.150) (-575.042) * (-571.558) (-576.694) (-574.294) [-572.751] -- 0:00:19
      570000 -- (-577.146) (-577.030) (-571.803) [-575.086] * (-572.181) (-573.264) [-572.087] (-572.476) -- 0:00:19

      Average standard deviation of split frequencies: 0.014869

      570500 -- [-572.264] (-571.536) (-572.158) (-574.129) * (-584.152) (-574.025) [-572.279] (-575.532) -- 0:00:19
      571000 -- (-571.873) [-572.169] (-571.129) (-573.296) * (-572.786) [-576.164] (-571.558) (-571.577) -- 0:00:19
      571500 -- [-571.498] (-572.099) (-573.416) (-575.271) * (-574.691) (-572.766) [-573.075] (-571.478) -- 0:00:19
      572000 -- [-572.347] (-576.070) (-575.678) (-573.009) * [-573.361] (-572.939) (-571.475) (-578.245) -- 0:00:19
      572500 -- [-572.116] (-572.480) (-573.290) (-573.243) * (-573.363) (-571.919) [-574.916] (-572.372) -- 0:00:19
      573000 -- (-571.918) (-572.440) (-578.031) [-576.135] * (-572.376) (-571.781) (-573.494) [-572.298] -- 0:00:19
      573500 -- (-572.055) [-574.880] (-579.881) (-572.514) * (-572.140) (-575.210) (-573.082) [-575.289] -- 0:00:19
      574000 -- (-574.283) (-572.280) (-576.698) [-574.556] * (-571.655) [-575.192] (-571.171) (-573.514) -- 0:00:19
      574500 -- (-574.276) (-572.940) [-573.710] (-573.671) * (-574.563) (-573.015) [-571.186] (-575.094) -- 0:00:19
      575000 -- (-572.045) (-574.377) (-573.273) [-573.506] * (-572.208) [-571.292] (-574.079) (-572.529) -- 0:00:19

      Average standard deviation of split frequencies: 0.018005

      575500 -- [-573.116] (-572.005) (-576.141) (-572.577) * (-572.125) (-571.986) [-571.796] (-576.188) -- 0:00:19
      576000 -- [-573.692] (-576.196) (-572.613) (-577.759) * [-574.078] (-574.599) (-572.233) (-571.491) -- 0:00:19
      576500 -- (-573.415) [-573.218] (-573.982) (-571.667) * (-572.557) (-574.031) (-571.299) [-572.118] -- 0:00:19
      577000 -- (-573.536) (-572.866) [-574.344] (-574.664) * (-572.503) [-575.098] (-571.964) (-573.085) -- 0:00:19
      577500 -- (-572.381) (-573.788) [-576.476] (-577.329) * (-571.709) (-573.267) [-573.069] (-571.144) -- 0:00:19
      578000 -- (-578.580) (-573.238) [-573.748] (-573.966) * (-571.918) (-571.630) [-571.943] (-572.639) -- 0:00:19
      578500 -- [-572.320] (-571.811) (-572.615) (-575.677) * [-572.217] (-576.117) (-573.418) (-571.652) -- 0:00:19
      579000 -- (-573.637) (-574.812) (-575.091) [-573.549] * (-572.190) (-571.987) (-574.251) [-571.829] -- 0:00:19
      579500 -- (-573.305) (-571.754) (-571.875) [-571.235] * [-577.227] (-574.280) (-573.230) (-571.881) -- 0:00:19
      580000 -- (-575.431) (-573.950) [-572.275] (-571.553) * (-575.037) (-576.894) (-576.177) [-574.183] -- 0:00:19

      Average standard deviation of split frequencies: 0.018943

      580500 -- [-574.479] (-575.489) (-571.894) (-571.566) * (-573.589) (-575.871) (-574.670) [-574.313] -- 0:00:19
      581000 -- [-572.590] (-575.654) (-576.268) (-574.712) * (-575.528) [-573.363] (-574.959) (-573.458) -- 0:00:19
      581500 -- (-572.719) [-573.696] (-571.052) (-576.391) * [-574.385] (-572.362) (-576.021) (-571.263) -- 0:00:19
      582000 -- (-572.195) (-573.789) (-579.749) [-571.822] * [-572.487] (-574.570) (-573.251) (-576.889) -- 0:00:19
      582500 -- [-571.714] (-574.269) (-580.157) (-572.350) * [-572.141] (-577.297) (-574.568) (-576.844) -- 0:00:19
      583000 -- (-580.159) (-574.107) (-574.853) [-573.809] * (-576.047) [-575.146] (-571.936) (-574.885) -- 0:00:19
      583500 -- (-572.878) (-573.750) [-572.299] (-572.629) * (-575.305) (-574.215) (-574.694) [-573.060] -- 0:00:19
      584000 -- (-572.344) [-575.118] (-571.545) (-571.920) * (-571.844) (-573.624) (-572.373) [-572.212] -- 0:00:19
      584500 -- (-578.209) (-573.419) [-572.139] (-575.837) * (-575.419) [-572.069] (-577.141) (-573.507) -- 0:00:19
      585000 -- (-572.384) (-573.805) (-574.611) [-573.992] * (-572.066) (-574.326) (-576.756) [-573.400] -- 0:00:19

      Average standard deviation of split frequencies: 0.018234

      585500 -- (-572.555) (-571.946) (-575.597) [-572.028] * (-576.218) (-572.241) (-574.531) [-573.592] -- 0:00:19
      586000 -- (-572.764) (-577.402) [-575.659] (-571.656) * [-576.204] (-571.913) (-574.847) (-572.305) -- 0:00:19
      586500 -- (-573.183) [-572.304] (-579.175) (-571.450) * (-573.726) (-574.714) [-572.220] (-572.292) -- 0:00:19
      587000 -- [-572.086] (-575.037) (-571.665) (-572.221) * (-574.178) (-573.550) [-578.771] (-573.598) -- 0:00:18
      587500 -- (-572.133) (-572.856) (-574.364) [-572.497] * (-570.947) (-576.554) (-575.291) [-577.762] -- 0:00:18
      588000 -- [-572.726] (-573.333) (-573.848) (-574.631) * (-572.820) (-578.113) (-575.531) [-571.825] -- 0:00:18
      588500 -- (-579.576) (-572.203) (-576.586) [-571.411] * [-572.418] (-572.369) (-576.886) (-572.132) -- 0:00:18
      589000 -- (-575.363) (-572.572) [-574.454] (-571.754) * (-573.547) [-571.929] (-574.208) (-573.447) -- 0:00:18
      589500 -- (-573.898) [-575.231] (-570.872) (-571.860) * [-572.196] (-573.633) (-574.130) (-573.814) -- 0:00:18
      590000 -- (-571.859) [-571.132] (-579.921) (-574.267) * (-574.102) [-572.095] (-575.372) (-573.970) -- 0:00:18

      Average standard deviation of split frequencies: 0.018090

      590500 -- (-571.229) (-573.964) (-577.286) [-572.437] * (-572.488) (-571.691) (-571.103) [-573.148] -- 0:00:18
      591000 -- [-572.061] (-576.299) (-572.703) (-574.123) * (-574.126) (-574.030) [-571.655] (-572.978) -- 0:00:18
      591500 -- (-572.632) [-575.833] (-575.718) (-572.750) * (-573.829) [-572.620] (-571.852) (-572.387) -- 0:00:18
      592000 -- (-573.594) (-571.655) [-573.561] (-575.373) * (-573.473) [-575.656] (-573.481) (-576.173) -- 0:00:18
      592500 -- (-574.645) (-574.309) [-571.672] (-573.996) * [-573.023] (-574.388) (-574.801) (-571.776) -- 0:00:18
      593000 -- (-576.385) (-574.349) [-573.170] (-571.688) * (-575.637) [-571.983] (-574.685) (-572.373) -- 0:00:18
      593500 -- (-574.275) [-574.174] (-570.756) (-571.813) * (-573.956) [-574.335] (-572.049) (-574.647) -- 0:00:18
      594000 -- (-572.397) (-573.964) [-571.066] (-573.167) * (-572.382) (-572.276) (-575.895) [-572.308] -- 0:00:18
      594500 -- (-572.240) (-573.465) (-571.747) [-571.212] * (-571.686) (-573.227) [-571.910] (-571.814) -- 0:00:18
      595000 -- (-571.625) [-572.991] (-574.346) (-575.094) * (-577.069) (-571.013) [-573.191] (-573.590) -- 0:00:18

      Average standard deviation of split frequencies: 0.018983

      595500 -- (-572.042) (-572.453) [-572.647] (-577.495) * (-573.535) [-571.834] (-572.201) (-571.908) -- 0:00:19
      596000 -- [-571.424] (-572.854) (-572.722) (-574.158) * (-573.520) [-575.803] (-573.995) (-576.022) -- 0:00:18
      596500 -- (-573.457) [-573.831] (-571.110) (-571.908) * (-571.473) (-571.750) (-574.636) [-572.837] -- 0:00:18
      597000 -- (-570.868) (-571.528) [-571.962] (-572.680) * (-571.545) (-571.369) (-572.717) [-571.811] -- 0:00:18
      597500 -- (-572.272) (-572.498) [-571.478] (-573.497) * (-573.370) [-573.778] (-574.128) (-571.141) -- 0:00:18
      598000 -- [-572.633] (-573.067) (-574.333) (-574.160) * [-572.736] (-573.525) (-572.962) (-572.396) -- 0:00:18
      598500 -- (-571.303) (-573.847) (-571.926) [-571.706] * [-574.734] (-579.615) (-572.108) (-578.516) -- 0:00:18
      599000 -- (-572.142) [-576.309] (-571.486) (-573.059) * (-572.768) (-573.316) [-571.821] (-573.904) -- 0:00:18
      599500 -- (-571.483) (-574.079) (-571.720) [-577.861] * (-572.483) [-571.165] (-571.070) (-576.026) -- 0:00:18
      600000 -- (-572.063) (-575.175) [-571.738] (-572.597) * (-573.545) [-571.101] (-572.773) (-571.229) -- 0:00:18

      Average standard deviation of split frequencies: 0.017789

      600500 -- [-571.088] (-573.997) (-571.898) (-571.596) * [-574.386] (-574.079) (-573.760) (-573.544) -- 0:00:18
      601000 -- (-570.951) [-572.423] (-573.800) (-577.094) * (-572.799) (-572.257) [-574.904] (-572.206) -- 0:00:18
      601500 -- (-571.285) (-573.845) (-574.240) [-571.494] * (-575.089) [-572.288] (-571.689) (-578.154) -- 0:00:18
      602000 -- (-573.345) (-573.307) (-573.547) [-573.159] * (-573.593) (-572.290) (-574.489) [-574.881] -- 0:00:18
      602500 -- (-576.400) [-574.303] (-571.966) (-571.851) * (-571.912) (-574.089) (-578.166) [-572.205] -- 0:00:18
      603000 -- (-576.133) [-572.736] (-571.692) (-575.507) * (-573.616) (-578.357) [-573.647] (-572.717) -- 0:00:18
      603500 -- (-575.319) [-574.467] (-572.197) (-573.817) * (-578.247) (-578.585) [-573.190] (-574.057) -- 0:00:18
      604000 -- (-571.113) (-572.225) [-573.958] (-572.613) * (-572.633) (-573.104) (-577.853) [-572.039] -- 0:00:18
      604500 -- [-571.270] (-572.463) (-573.180) (-576.374) * [-573.755] (-572.819) (-572.526) (-574.186) -- 0:00:18
      605000 -- (-574.338) [-573.204] (-571.105) (-576.231) * [-575.395] (-571.367) (-571.955) (-571.818) -- 0:00:18

      Average standard deviation of split frequencies: 0.019188

      605500 -- (-571.379) [-571.265] (-572.380) (-572.941) * (-579.458) [-571.640] (-574.834) (-575.153) -- 0:00:18
      606000 -- [-571.660] (-571.550) (-573.764) (-572.116) * (-573.483) (-576.023) (-574.004) [-572.027] -- 0:00:18
      606500 -- [-572.861] (-579.219) (-572.463) (-571.338) * (-571.503) (-573.571) (-574.542) [-574.753] -- 0:00:18
      607000 -- (-575.473) [-574.644] (-574.327) (-571.900) * [-571.971] (-572.034) (-572.903) (-572.628) -- 0:00:18
      607500 -- (-571.430) [-574.531] (-572.966) (-571.533) * (-574.596) (-571.278) [-577.270] (-575.492) -- 0:00:18
      608000 -- (-573.440) (-573.254) [-572.962] (-572.662) * [-574.970] (-571.500) (-572.909) (-572.809) -- 0:00:18
      608500 -- (-571.916) (-575.552) (-577.169) [-572.814] * (-571.906) [-572.222] (-572.665) (-572.555) -- 0:00:18
      609000 -- (-572.138) (-573.699) (-571.443) [-574.287] * (-571.086) (-573.620) (-573.035) [-576.402] -- 0:00:17
      609500 -- (-575.331) (-574.437) [-572.843] (-574.916) * (-573.496) (-578.022) (-575.133) [-576.558] -- 0:00:17
      610000 -- [-572.105] (-571.415) (-572.090) (-572.930) * (-572.359) [-573.204] (-572.394) (-571.922) -- 0:00:17

      Average standard deviation of split frequencies: 0.016983

      610500 -- (-573.604) (-572.332) (-573.556) [-573.522] * (-571.882) (-575.658) (-575.260) [-571.828] -- 0:00:17
      611000 -- [-574.157] (-572.940) (-572.515) (-572.009) * (-573.206) [-572.111] (-574.069) (-573.649) -- 0:00:17
      611500 -- [-572.142] (-572.757) (-572.543) (-573.392) * (-575.820) (-574.422) (-574.542) [-571.851] -- 0:00:17
      612000 -- (-571.369) (-572.928) (-578.184) [-572.433] * (-572.170) [-570.879] (-574.973) (-573.378) -- 0:00:17
      612500 -- [-571.908] (-571.889) (-574.957) (-572.510) * (-571.234) (-572.690) (-574.474) [-575.305] -- 0:00:17
      613000 -- [-570.881] (-571.957) (-577.442) (-571.619) * (-571.633) [-571.315] (-576.229) (-575.226) -- 0:00:17
      613500 -- (-578.472) (-576.138) (-578.173) [-571.446] * [-572.145] (-571.918) (-572.589) (-574.359) -- 0:00:17
      614000 -- (-572.570) (-575.822) (-572.902) [-572.623] * (-574.772) (-576.940) (-574.229) [-573.607] -- 0:00:17
      614500 -- [-571.919] (-575.897) (-571.931) (-571.337) * (-575.727) (-573.344) [-574.497] (-572.374) -- 0:00:17
      615000 -- [-573.819] (-575.384) (-572.581) (-573.099) * (-576.961) [-571.573] (-572.403) (-571.389) -- 0:00:17

      Average standard deviation of split frequencies: 0.016836

      615500 -- (-575.441) [-571.736] (-573.332) (-572.641) * [-574.502] (-571.742) (-572.904) (-571.963) -- 0:00:17
      616000 -- (-573.024) [-571.940] (-571.470) (-572.267) * (-579.162) [-571.196] (-571.758) (-572.299) -- 0:00:18
      616500 -- (-572.413) [-572.079] (-574.848) (-577.635) * (-574.415) (-573.969) [-571.876] (-573.441) -- 0:00:18
      617000 -- (-572.702) (-573.581) [-573.882] (-574.754) * (-574.275) (-574.262) [-571.797] (-573.171) -- 0:00:18
      617500 -- (-573.054) (-574.832) (-575.809) [-575.234] * (-578.302) (-574.321) [-571.384] (-573.066) -- 0:00:17
      618000 -- [-573.187] (-575.214) (-574.315) (-575.301) * (-575.007) (-573.484) (-571.333) [-574.184] -- 0:00:17
      618500 -- (-572.818) [-574.100] (-573.711) (-572.403) * [-574.230] (-572.796) (-573.144) (-571.889) -- 0:00:17
      619000 -- (-572.609) [-574.431] (-574.081) (-572.990) * (-572.954) [-572.829] (-571.522) (-572.907) -- 0:00:17
      619500 -- (-575.194) [-572.863] (-572.054) (-572.693) * (-574.459) (-572.837) (-571.912) [-574.435] -- 0:00:17
      620000 -- (-574.420) [-571.454] (-572.453) (-573.184) * (-571.297) [-573.690] (-572.715) (-574.679) -- 0:00:17

      Average standard deviation of split frequencies: 0.017722

      620500 -- (-578.098) (-575.348) [-575.189] (-574.203) * [-574.036] (-572.329) (-574.617) (-572.431) -- 0:00:17
      621000 -- (-576.404) [-573.072] (-572.548) (-578.296) * (-571.288) (-573.784) (-575.027) [-573.299] -- 0:00:17
      621500 -- (-572.669) [-572.675] (-571.755) (-573.915) * (-571.971) (-578.630) (-576.245) [-577.862] -- 0:00:17
      622000 -- (-572.455) (-572.852) [-571.182] (-576.002) * (-571.276) [-572.617] (-573.187) (-575.733) -- 0:00:17
      622500 -- (-574.724) (-576.046) [-571.543] (-571.831) * (-574.538) [-571.450] (-571.127) (-573.028) -- 0:00:17
      623000 -- (-572.357) (-575.302) (-572.614) [-572.702] * (-574.802) (-571.432) (-574.010) [-573.005] -- 0:00:17
      623500 -- (-571.210) (-572.806) [-576.574] (-574.276) * (-576.406) (-573.663) [-571.202] (-571.772) -- 0:00:17
      624000 -- (-571.003) [-571.452] (-572.369) (-571.226) * (-572.678) (-571.253) [-573.107] (-571.591) -- 0:00:17
      624500 -- (-574.768) (-572.028) (-571.899) [-573.012] * (-580.463) [-572.013] (-572.465) (-573.728) -- 0:00:17
      625000 -- (-574.460) [-571.656] (-573.504) (-571.256) * (-575.285) (-572.561) (-573.400) [-572.355] -- 0:00:17

      Average standard deviation of split frequencies: 0.019077

      625500 -- (-573.882) (-573.984) (-572.463) [-571.385] * [-572.194] (-572.387) (-574.185) (-571.401) -- 0:00:17
      626000 -- (-572.311) (-575.513) [-571.906] (-572.459) * (-572.395) [-576.517] (-573.628) (-571.188) -- 0:00:17
      626500 -- (-572.318) (-572.423) [-574.594] (-572.079) * (-572.497) [-570.988] (-572.672) (-571.616) -- 0:00:17
      627000 -- (-578.398) (-574.844) (-573.994) [-571.330] * (-573.392) (-573.450) [-575.002] (-573.045) -- 0:00:17
      627500 -- [-573.218] (-573.136) (-575.025) (-573.257) * (-572.795) (-572.569) [-572.342] (-576.063) -- 0:00:17
      628000 -- (-574.321) (-571.236) [-573.220] (-571.356) * (-580.162) [-572.166] (-572.332) (-576.498) -- 0:00:17
      628500 -- [-572.497] (-571.733) (-576.695) (-577.435) * [-574.047] (-572.859) (-572.117) (-575.556) -- 0:00:17
      629000 -- [-572.818] (-573.136) (-572.532) (-571.610) * [-573.995] (-571.662) (-572.320) (-572.254) -- 0:00:17
      629500 -- (-573.026) (-574.788) [-572.554] (-578.145) * [-578.502] (-572.701) (-572.789) (-572.260) -- 0:00:17
      630000 -- (-571.322) (-576.884) [-572.221] (-573.627) * (-574.651) [-571.686] (-572.067) (-576.838) -- 0:00:17

      Average standard deviation of split frequencies: 0.019933

      630500 -- (-575.017) (-571.161) (-574.119) [-572.403] * (-574.076) (-576.932) (-572.051) [-577.590] -- 0:00:16
      631000 -- (-572.216) (-573.924) [-574.891] (-574.306) * (-572.886) [-572.846] (-573.421) (-574.577) -- 0:00:16
      631500 -- (-574.232) (-573.768) (-575.810) [-574.699] * (-573.552) (-573.574) (-573.612) [-572.508] -- 0:00:16
      632000 -- [-576.930] (-573.463) (-572.624) (-575.393) * (-576.956) (-575.181) [-572.238] (-573.893) -- 0:00:16
      632500 -- (-572.141) (-574.029) (-574.005) [-574.126] * [-572.444] (-573.074) (-576.569) (-575.820) -- 0:00:16
      633000 -- [-574.895] (-574.295) (-573.920) (-576.321) * (-573.907) (-574.734) (-574.273) [-572.387] -- 0:00:16
      633500 -- [-574.001] (-576.344) (-572.652) (-572.219) * (-573.794) (-575.037) [-573.619] (-576.667) -- 0:00:16
      634000 -- (-574.702) (-576.740) (-572.751) [-571.916] * [-571.668] (-576.633) (-572.721) (-572.811) -- 0:00:16
      634500 -- (-574.732) (-579.326) [-571.032] (-573.646) * [-572.927] (-571.742) (-572.621) (-573.146) -- 0:00:16
      635000 -- [-572.411] (-572.293) (-572.509) (-573.249) * (-572.515) [-572.173] (-572.947) (-572.917) -- 0:00:16

      Average standard deviation of split frequencies: 0.018777

      635500 -- [-577.457] (-575.506) (-572.623) (-575.035) * (-570.893) (-572.134) [-572.097] (-572.757) -- 0:00:17
      636000 -- [-574.461] (-574.989) (-571.583) (-570.969) * (-575.530) [-571.981] (-575.421) (-572.152) -- 0:00:17
      636500 -- (-574.913) [-574.324] (-575.047) (-573.219) * (-571.991) [-574.068] (-576.880) (-573.316) -- 0:00:17
      637000 -- (-572.237) (-573.839) [-574.872] (-571.709) * [-573.943] (-579.567) (-572.955) (-574.307) -- 0:00:17
      637500 -- [-574.670] (-574.608) (-573.985) (-572.372) * (-571.380) (-573.269) (-573.419) [-572.699] -- 0:00:17
      638000 -- (-573.135) [-574.136] (-572.523) (-574.585) * (-574.173) [-573.322] (-576.878) (-574.629) -- 0:00:17
      638500 -- (-574.258) (-575.989) [-574.454] (-572.072) * (-574.518) (-571.481) (-575.409) [-574.048] -- 0:00:16
      639000 -- (-572.063) [-574.014] (-574.908) (-573.897) * (-572.245) (-570.838) [-571.361] (-575.476) -- 0:00:16
      639500 -- (-575.356) (-573.178) [-573.179] (-573.138) * (-572.351) (-572.778) (-574.062) [-573.587] -- 0:00:16
      640000 -- (-575.682) (-573.006) (-571.473) [-571.561] * (-578.599) (-572.651) [-574.109] (-573.655) -- 0:00:16

      Average standard deviation of split frequencies: 0.018150

      640500 -- (-572.193) [-572.168] (-574.736) (-572.731) * (-574.607) [-573.437] (-572.094) (-573.112) -- 0:00:16
      641000 -- (-572.982) [-570.943] (-575.241) (-573.815) * [-573.840] (-572.806) (-571.916) (-575.044) -- 0:00:16
      641500 -- (-574.270) (-574.664) (-579.993) [-571.586] * (-572.096) (-574.538) [-574.566] (-573.616) -- 0:00:16
      642000 -- [-573.246] (-577.564) (-572.662) (-573.950) * [-571.428] (-572.667) (-577.741) (-571.704) -- 0:00:16
      642500 -- (-572.779) (-571.551) (-576.249) [-573.009] * [-572.626] (-572.297) (-571.835) (-576.353) -- 0:00:16
      643000 -- [-571.869] (-572.937) (-573.900) (-572.842) * (-573.222) [-571.190] (-573.174) (-575.739) -- 0:00:16
      643500 -- (-577.458) (-572.463) [-573.014] (-574.514) * (-574.795) (-572.219) (-573.336) [-573.687] -- 0:00:16
      644000 -- [-572.100] (-571.239) (-572.856) (-575.080) * (-572.515) [-572.080] (-573.529) (-572.695) -- 0:00:16
      644500 -- (-573.894) (-571.404) (-574.541) [-577.279] * (-571.391) (-573.012) [-571.949] (-572.124) -- 0:00:16
      645000 -- (-573.981) [-572.647] (-572.268) (-572.459) * (-571.790) (-578.560) [-571.383] (-574.031) -- 0:00:16

      Average standard deviation of split frequencies: 0.018486

      645500 -- (-572.426) [-573.035] (-574.648) (-572.308) * (-574.663) (-574.058) (-574.538) [-574.922] -- 0:00:16
      646000 -- (-574.880) (-573.914) [-571.148] (-572.208) * (-573.897) [-575.344] (-573.610) (-573.102) -- 0:00:16
      646500 -- [-572.995] (-575.799) (-572.869) (-572.683) * (-573.139) [-571.434] (-572.628) (-572.823) -- 0:00:16
      647000 -- [-573.346] (-578.081) (-573.314) (-574.559) * (-573.854) (-571.367) (-572.477) [-572.314] -- 0:00:16
      647500 -- (-573.043) (-573.365) [-572.542] (-573.327) * (-575.901) (-573.536) (-571.649) [-575.135] -- 0:00:16
      648000 -- (-573.516) (-574.367) [-575.964] (-572.842) * (-572.022) (-572.907) [-573.874] (-572.907) -- 0:00:16
      648500 -- (-574.482) [-570.991] (-572.758) (-573.115) * (-574.831) (-574.783) (-574.095) [-573.166] -- 0:00:16
      649000 -- (-572.342) (-571.382) (-574.747) [-571.359] * (-572.589) (-571.017) (-572.732) [-573.023] -- 0:00:16
      649500 -- (-572.243) (-574.258) (-573.768) [-571.353] * [-572.442] (-572.100) (-572.465) (-573.375) -- 0:00:16
      650000 -- (-576.991) [-574.486] (-572.544) (-575.905) * (-571.988) (-571.839) (-572.683) [-574.664] -- 0:00:16

      Average standard deviation of split frequencies: 0.019320

      650500 -- [-573.834] (-575.463) (-573.584) (-578.559) * (-572.237) [-574.264] (-571.872) (-571.484) -- 0:00:16
      651000 -- (-573.039) [-574.590] (-572.291) (-574.152) * (-573.488) [-574.820] (-572.044) (-574.127) -- 0:00:16
      651500 -- [-576.380] (-574.031) (-573.148) (-572.002) * [-573.691] (-574.744) (-573.178) (-572.537) -- 0:00:16
      652000 -- (-572.742) (-572.757) (-576.539) [-573.567] * [-572.367] (-574.442) (-572.643) (-573.007) -- 0:00:16
      652500 -- (-573.418) (-573.627) (-572.227) [-572.473] * (-572.357) (-573.985) (-572.037) [-571.172] -- 0:00:15
      653000 -- (-572.513) (-577.144) (-571.194) [-577.179] * (-575.027) (-573.665) [-573.964] (-572.539) -- 0:00:15
      653500 -- (-574.072) (-572.719) [-573.359] (-574.375) * [-576.941] (-573.666) (-575.506) (-573.197) -- 0:00:15
      654000 -- (-574.260) [-577.985] (-571.300) (-572.949) * [-571.350] (-574.713) (-576.117) (-573.782) -- 0:00:15
      654500 -- (-573.673) [-574.820] (-579.749) (-571.927) * (-575.123) [-572.849] (-571.955) (-576.461) -- 0:00:15
      655000 -- [-573.471] (-574.458) (-572.667) (-574.709) * [-573.474] (-572.832) (-573.794) (-574.731) -- 0:00:15

      Average standard deviation of split frequencies: 0.016767

      655500 -- [-574.859] (-573.070) (-576.331) (-572.011) * (-572.682) (-571.843) [-571.976] (-573.618) -- 0:00:15
      656000 -- (-572.023) [-571.564] (-575.326) (-574.220) * (-571.760) [-575.876] (-573.989) (-574.174) -- 0:00:15
      656500 -- [-571.919] (-572.572) (-575.404) (-571.766) * [-574.086] (-572.498) (-572.953) (-572.810) -- 0:00:15
      657000 -- [-572.713] (-572.446) (-577.706) (-572.804) * [-571.368] (-571.984) (-574.569) (-573.093) -- 0:00:15
      657500 -- (-571.835) [-573.388] (-574.927) (-572.969) * (-573.911) (-573.714) [-572.701] (-575.352) -- 0:00:15
      658000 -- [-572.600] (-572.337) (-573.001) (-572.153) * (-573.240) (-573.004) [-572.281] (-575.038) -- 0:00:15
      658500 -- (-579.986) (-574.835) [-572.866] (-571.310) * (-574.998) (-573.118) [-572.419] (-576.090) -- 0:00:16
      659000 -- (-574.568) [-573.396] (-574.459) (-575.947) * (-572.777) (-572.872) [-572.025] (-574.769) -- 0:00:16
      659500 -- (-572.037) (-575.330) (-572.672) [-572.420] * [-573.221] (-571.928) (-573.045) (-573.143) -- 0:00:16
      660000 -- [-573.565] (-572.837) (-574.629) (-573.508) * (-571.130) [-571.880] (-572.678) (-571.266) -- 0:00:15

      Average standard deviation of split frequencies: 0.019027

      660500 -- [-575.463] (-572.006) (-574.157) (-571.440) * (-572.380) (-572.369) (-574.882) [-571.856] -- 0:00:15
      661000 -- (-573.450) (-572.252) [-572.298] (-572.379) * (-572.807) (-572.777) (-572.660) [-574.067] -- 0:00:15
      661500 -- (-575.378) (-571.946) [-573.342] (-573.416) * (-575.517) (-573.515) [-572.489] (-573.914) -- 0:00:15
      662000 -- (-572.914) (-571.788) (-571.650) [-574.267] * (-571.801) (-572.616) [-571.701] (-578.550) -- 0:00:15
      662500 -- (-572.484) (-572.288) (-573.716) [-572.500] * [-574.406] (-573.045) (-571.315) (-576.475) -- 0:00:15
      663000 -- [-573.663] (-572.233) (-572.639) (-571.180) * (-575.980) (-574.064) [-574.802] (-577.511) -- 0:00:15
      663500 -- (-576.862) [-572.602] (-573.722) (-572.399) * (-572.565) (-572.078) (-571.984) [-573.549] -- 0:00:15
      664000 -- (-572.674) (-572.168) (-572.223) [-572.189] * (-572.152) (-572.166) (-573.111) [-572.569] -- 0:00:15
      664500 -- (-571.996) (-576.870) [-571.768] (-574.283) * [-572.747] (-572.488) (-578.778) (-571.274) -- 0:00:15
      665000 -- [-571.184] (-578.573) (-573.663) (-572.787) * (-575.775) (-573.230) (-575.748) [-571.851] -- 0:00:15

      Average standard deviation of split frequencies: 0.018403

      665500 -- (-571.901) (-576.032) (-572.562) [-573.754] * [-574.261] (-573.053) (-574.062) (-580.639) -- 0:00:15
      666000 -- (-572.192) (-574.105) [-572.493] (-574.799) * (-573.228) (-570.893) [-572.942] (-574.249) -- 0:00:15
      666500 -- (-577.040) (-572.888) [-572.347] (-573.258) * (-571.214) [-576.031] (-573.313) (-576.758) -- 0:00:15
      667000 -- (-571.672) (-578.134) [-572.090] (-577.070) * (-571.717) (-574.797) (-573.599) [-575.605] -- 0:00:15
      667500 -- (-575.976) (-573.711) (-572.482) [-571.970] * (-573.581) (-577.141) (-571.432) [-572.182] -- 0:00:15
      668000 -- (-572.291) (-574.403) (-572.950) [-571.877] * [-572.240] (-572.572) (-576.037) (-572.090) -- 0:00:15
      668500 -- (-576.299) (-571.904) (-572.792) [-571.825] * (-573.947) (-576.123) (-570.871) [-575.230] -- 0:00:15
      669000 -- (-572.850) (-571.599) (-576.057) [-573.462] * (-575.196) (-576.127) (-574.695) [-576.931] -- 0:00:15
      669500 -- (-573.137) [-572.959] (-572.999) (-574.063) * [-572.376] (-577.239) (-574.927) (-573.544) -- 0:00:15
      670000 -- (-574.130) (-573.817) (-571.245) [-571.372] * (-573.080) [-572.583] (-574.712) (-575.514) -- 0:00:15

      Average standard deviation of split frequencies: 0.017807

      670500 -- (-571.671) (-576.150) (-571.431) [-572.312] * (-573.997) [-571.297] (-574.135) (-572.494) -- 0:00:15
      671000 -- (-572.821) (-573.796) [-571.469] (-573.316) * (-573.520) [-571.797] (-571.646) (-573.157) -- 0:00:15
      671500 -- (-574.225) (-571.282) [-571.855] (-574.918) * (-572.949) (-572.885) (-573.724) [-578.123] -- 0:00:15
      672000 -- (-573.002) [-577.644] (-571.362) (-572.335) * [-571.737] (-572.005) (-571.934) (-575.146) -- 0:00:15
      672500 -- (-571.446) (-575.136) (-572.415) [-571.512] * [-572.740] (-571.770) (-573.671) (-573.876) -- 0:00:15
      673000 -- (-573.663) (-574.803) (-573.349) [-572.911] * (-570.938) (-572.829) (-572.730) [-574.776] -- 0:00:15
      673500 -- (-572.003) (-572.545) (-573.421) [-572.103] * [-572.051] (-571.164) (-573.063) (-580.421) -- 0:00:15
      674000 -- (-573.020) [-573.735] (-574.536) (-573.112) * (-574.236) [-572.762] (-573.489) (-576.267) -- 0:00:14
      674500 -- (-573.439) (-571.697) [-574.362] (-575.676) * (-572.920) (-572.967) [-571.958] (-575.735) -- 0:00:14
      675000 -- [-572.692] (-573.368) (-573.842) (-577.877) * [-573.359] (-573.942) (-574.367) (-573.592) -- 0:00:14

      Average standard deviation of split frequencies: 0.018131

      675500 -- [-577.236] (-574.092) (-575.060) (-572.963) * (-573.723) (-576.223) (-572.702) [-573.248] -- 0:00:14
      676000 -- (-572.567) [-571.900] (-572.810) (-571.958) * (-571.476) (-576.944) (-572.325) [-572.324] -- 0:00:14
      676500 -- (-574.414) (-573.562) [-571.352] (-574.384) * [-571.538] (-574.143) (-571.374) (-572.617) -- 0:00:14
      677000 -- (-572.870) [-571.964] (-572.981) (-571.873) * [-571.528] (-576.131) (-571.550) (-573.106) -- 0:00:14
      677500 -- (-574.106) [-572.886] (-573.215) (-573.587) * (-572.488) (-574.739) (-573.847) [-572.065] -- 0:00:14
      678000 -- (-573.473) (-575.520) (-571.797) [-573.778] * (-571.684) [-571.296] (-575.204) (-573.800) -- 0:00:14
      678500 -- (-575.181) (-573.467) (-571.502) [-571.804] * (-575.154) [-572.197] (-572.018) (-576.822) -- 0:00:14
      679000 -- (-575.433) (-571.221) [-573.026] (-572.820) * [-579.368] (-577.357) (-573.108) (-573.577) -- 0:00:14
      679500 -- (-572.620) [-575.189] (-572.935) (-571.462) * (-574.754) (-573.425) (-573.552) [-574.067] -- 0:00:14
      680000 -- (-574.582) [-572.637] (-573.700) (-572.766) * (-574.032) (-573.170) [-571.994] (-573.819) -- 0:00:14

      Average standard deviation of split frequencies: 0.018007

      680500 -- (-572.396) (-574.027) (-571.956) [-573.112] * (-572.492) (-573.798) [-571.834] (-573.404) -- 0:00:15
      681000 -- (-574.878) (-574.401) (-578.854) [-572.438] * [-571.979] (-574.723) (-576.304) (-580.259) -- 0:00:14
      681500 -- (-572.443) (-572.990) [-575.015] (-575.756) * (-571.177) [-575.221] (-571.962) (-579.528) -- 0:00:14
      682000 -- (-575.266) (-573.700) [-572.665] (-573.561) * (-571.156) (-571.336) (-571.111) [-574.904] -- 0:00:14
      682500 -- [-573.372] (-574.821) (-574.363) (-573.125) * (-573.829) (-571.142) [-573.769] (-575.501) -- 0:00:14
      683000 -- (-571.711) [-572.557] (-572.595) (-572.297) * (-572.239) (-571.437) [-572.115] (-575.574) -- 0:00:14
      683500 -- [-572.265] (-572.272) (-572.426) (-572.608) * [-574.655] (-574.198) (-577.440) (-572.087) -- 0:00:14
      684000 -- [-572.022] (-573.228) (-571.677) (-575.025) * (-574.490) [-575.612] (-572.031) (-572.084) -- 0:00:14
      684500 -- (-571.901) (-572.493) (-571.984) [-574.030] * (-574.694) (-571.604) (-576.554) [-572.151] -- 0:00:14
      685000 -- (-573.427) [-573.883] (-572.623) (-571.535) * (-572.494) (-572.692) (-573.550) [-571.948] -- 0:00:14

      Average standard deviation of split frequencies: 0.019241

      685500 -- (-571.618) [-572.930] (-575.022) (-572.757) * (-571.862) [-574.196] (-571.201) (-575.209) -- 0:00:14
      686000 -- (-574.072) (-573.857) [-573.549] (-572.098) * [-574.333] (-572.105) (-573.535) (-575.593) -- 0:00:14
      686500 -- (-574.773) (-574.057) (-574.360) [-577.118] * (-572.089) [-572.071] (-576.785) (-570.865) -- 0:00:14
      687000 -- (-573.011) (-574.344) [-572.439] (-573.470) * (-575.665) (-572.510) (-576.548) [-571.987] -- 0:00:14
      687500 -- (-573.341) (-572.851) [-573.341] (-576.339) * (-573.588) (-573.146) [-571.439] (-573.287) -- 0:00:14
      688000 -- (-574.883) [-572.914] (-575.028) (-579.162) * (-573.305) (-571.504) [-574.188] (-574.476) -- 0:00:14
      688500 -- (-572.119) (-572.937) (-572.093) [-572.867] * (-574.657) [-572.779] (-574.471) (-571.845) -- 0:00:14
      689000 -- [-571.839] (-572.388) (-577.530) (-574.524) * (-574.067) [-573.104] (-574.983) (-573.161) -- 0:00:14
      689500 -- [-571.931] (-574.753) (-572.762) (-573.289) * [-572.065] (-572.558) (-575.917) (-572.777) -- 0:00:14
      690000 -- [-572.113] (-572.852) (-577.020) (-576.146) * [-571.652] (-572.879) (-574.834) (-572.255) -- 0:00:14

      Average standard deviation of split frequencies: 0.021386

      690500 -- (-572.039) (-572.522) (-573.369) [-572.869] * (-573.406) (-571.968) [-573.026] (-571.624) -- 0:00:14
      691000 -- (-574.979) [-573.245] (-573.377) (-572.182) * [-573.672] (-572.964) (-572.068) (-573.827) -- 0:00:14
      691500 -- [-573.035] (-575.853) (-574.504) (-571.607) * (-575.397) (-578.319) [-572.577] (-573.883) -- 0:00:14
      692000 -- (-574.646) (-575.168) [-573.257] (-572.236) * (-574.717) (-572.382) [-573.539] (-572.276) -- 0:00:14
      692500 -- (-572.723) [-573.421] (-572.891) (-571.107) * (-574.254) [-573.767] (-575.788) (-572.242) -- 0:00:14
      693000 -- (-573.798) [-576.836] (-572.331) (-571.838) * (-572.975) [-571.047] (-572.492) (-576.511) -- 0:00:14
      693500 -- (-572.450) (-571.402) (-571.838) [-576.662] * (-573.499) (-573.480) (-571.625) [-571.605] -- 0:00:14
      694000 -- (-571.254) (-572.291) (-572.110) [-572.239] * (-574.264) (-571.593) (-573.307) [-571.264] -- 0:00:14
      694500 -- [-571.112] (-572.315) (-571.272) (-571.885) * (-572.634) [-571.706] (-572.885) (-573.991) -- 0:00:14
      695000 -- [-572.598] (-574.836) (-573.707) (-574.228) * (-572.398) [-574.889] (-573.400) (-576.720) -- 0:00:14

      Average standard deviation of split frequencies: 0.021222

      695500 -- (-574.542) [-574.379] (-577.577) (-572.831) * (-571.451) (-571.597) (-574.255) [-572.207] -- 0:00:14
      696000 -- (-573.531) (-575.221) [-573.186] (-573.047) * (-574.720) (-571.406) [-571.272] (-572.767) -- 0:00:13
      696500 -- (-573.606) [-573.533] (-574.814) (-574.721) * (-575.315) (-572.951) (-572.526) [-574.837] -- 0:00:13
      697000 -- [-572.604] (-577.170) (-575.872) (-573.132) * (-572.811) [-573.473] (-571.983) (-571.939) -- 0:00:13
      697500 -- (-572.016) (-573.549) [-571.293] (-573.666) * [-575.286] (-575.440) (-573.476) (-572.416) -- 0:00:13
      698000 -- (-575.222) (-571.429) (-575.338) [-572.274] * (-575.371) (-572.134) [-573.269] (-573.560) -- 0:00:13
      698500 -- (-571.804) (-572.127) [-576.188] (-577.493) * (-573.104) (-572.387) [-571.064] (-572.172) -- 0:00:13
      699000 -- [-573.699] (-572.970) (-572.661) (-573.438) * (-576.274) (-574.060) (-576.813) [-572.948] -- 0:00:13
      699500 -- (-572.096) (-572.660) (-571.964) [-572.816] * (-574.077) [-574.090] (-574.765) (-574.789) -- 0:00:13
      700000 -- (-573.472) (-573.793) [-571.543] (-571.436) * [-575.641] (-573.950) (-571.870) (-573.868) -- 0:00:13

      Average standard deviation of split frequencies: 0.020632

      700500 -- (-576.379) (-575.668) (-571.554) [-571.839] * (-571.746) [-572.128] (-576.595) (-575.463) -- 0:00:13
      701000 -- (-573.223) (-571.395) (-570.998) [-572.914] * (-572.218) [-571.896] (-572.623) (-574.716) -- 0:00:14
      701500 -- (-574.874) (-572.200) (-571.004) [-574.594] * [-574.693] (-577.939) (-573.785) (-571.551) -- 0:00:14
      702000 -- (-572.857) (-571.291) [-570.949] (-574.795) * [-571.747] (-576.247) (-574.146) (-574.054) -- 0:00:14
      702500 -- (-572.938) (-572.588) (-573.613) [-572.949] * [-574.517] (-576.603) (-571.611) (-572.928) -- 0:00:13
      703000 -- (-577.345) (-572.883) (-574.426) [-571.464] * (-574.634) [-581.231] (-576.733) (-572.583) -- 0:00:13
      703500 -- (-575.654) [-571.910] (-573.698) (-575.197) * [-572.603] (-572.974) (-571.877) (-573.220) -- 0:00:13
      704000 -- (-576.695) (-576.949) [-574.074] (-572.618) * (-574.505) (-571.952) (-571.913) [-571.178] -- 0:00:13
      704500 -- (-574.334) (-577.845) [-571.540] (-573.504) * (-573.143) (-574.930) [-572.326] (-571.997) -- 0:00:13
      705000 -- [-573.014] (-571.378) (-573.384) (-572.436) * [-572.042] (-576.098) (-571.893) (-576.172) -- 0:00:13

      Average standard deviation of split frequencies: 0.020922

      705500 -- (-572.806) (-573.520) (-572.562) [-574.421] * (-574.680) [-573.743] (-575.011) (-571.580) -- 0:00:13
      706000 -- (-573.913) (-574.492) [-574.052] (-571.402) * [-575.987] (-571.296) (-577.954) (-573.031) -- 0:00:13
      706500 -- [-573.109] (-578.083) (-571.846) (-574.454) * (-572.424) (-575.548) [-573.377] (-573.422) -- 0:00:13
      707000 -- (-572.391) [-581.543] (-573.002) (-572.411) * (-572.473) [-574.209] (-574.042) (-573.727) -- 0:00:13
      707500 -- [-575.328] (-583.156) (-574.253) (-572.168) * (-572.257) [-571.968] (-574.418) (-572.558) -- 0:00:13
      708000 -- (-574.644) (-573.774) [-574.640] (-571.728) * [-575.189] (-572.706) (-572.785) (-575.638) -- 0:00:13
      708500 -- (-573.459) [-573.796] (-572.311) (-572.601) * (-572.621) (-574.118) (-573.263) [-572.770] -- 0:00:13
      709000 -- (-575.664) (-571.145) (-575.406) [-572.951] * [-572.088] (-573.922) (-572.036) (-573.919) -- 0:00:13
      709500 -- (-574.684) (-571.841) [-572.672] (-573.334) * (-572.142) (-572.883) (-579.683) [-572.076] -- 0:00:13
      710000 -- [-571.527] (-571.884) (-574.747) (-574.645) * (-572.326) (-573.028) (-573.996) [-572.094] -- 0:00:13

      Average standard deviation of split frequencies: 0.019458

      710500 -- (-572.698) (-572.848) [-575.013] (-574.877) * (-572.115) [-573.179] (-572.400) (-572.692) -- 0:00:13
      711000 -- (-571.341) [-571.124] (-571.740) (-575.533) * (-574.081) [-574.598] (-575.496) (-575.459) -- 0:00:13
      711500 -- (-573.038) (-572.071) (-575.224) [-573.504] * (-575.493) (-574.751) (-573.401) [-574.116] -- 0:00:13
      712000 -- (-576.540) (-572.194) (-571.153) [-572.600] * (-572.892) [-577.793] (-572.123) (-571.545) -- 0:00:13
      712500 -- (-576.188) [-571.669] (-572.353) (-575.597) * [-573.721] (-571.991) (-573.319) (-576.477) -- 0:00:13
      713000 -- [-572.961] (-571.509) (-578.893) (-572.230) * [-572.387] (-573.046) (-574.393) (-573.007) -- 0:00:13
      713500 -- (-572.729) [-574.779] (-572.819) (-574.564) * (-574.873) (-571.587) [-574.367] (-574.620) -- 0:00:13
      714000 -- (-571.745) (-572.119) (-574.346) [-574.288] * (-571.592) (-574.845) (-575.231) [-575.629] -- 0:00:13
      714500 -- (-572.945) (-572.466) (-573.995) [-572.355] * (-573.721) (-572.536) (-572.228) [-573.093] -- 0:00:13
      715000 -- (-574.351) (-571.650) [-571.232] (-571.060) * (-571.847) [-572.887] (-571.586) (-574.395) -- 0:00:13

      Average standard deviation of split frequencies: 0.019752

      715500 -- (-580.069) (-572.086) [-572.092] (-574.589) * (-571.759) [-571.344] (-574.426) (-572.624) -- 0:00:13
      716000 -- (-574.097) (-571.678) [-571.617] (-575.692) * [-572.172] (-572.636) (-574.577) (-571.477) -- 0:00:13
      716500 -- (-572.774) (-577.461) [-572.072] (-573.857) * (-571.597) (-572.591) [-574.699] (-571.875) -- 0:00:13
      717000 -- (-575.682) [-572.757] (-575.745) (-574.735) * [-572.913] (-571.172) (-575.857) (-573.006) -- 0:00:13
      717500 -- (-572.613) (-573.431) (-572.128) [-571.941] * (-575.138) (-571.953) [-571.271] (-572.458) -- 0:00:12
      718000 -- [-572.548] (-576.428) (-571.862) (-572.098) * (-571.430) (-575.162) (-571.405) [-572.422] -- 0:00:12
      718500 -- (-573.317) (-573.968) [-574.221] (-578.897) * (-574.744) (-572.334) [-570.778] (-573.126) -- 0:00:12
      719000 -- (-574.402) (-573.209) (-573.175) [-574.819] * [-571.596] (-571.432) (-573.520) (-571.700) -- 0:00:12
      719500 -- (-572.407) (-571.229) [-571.748] (-571.434) * (-574.264) (-575.534) (-572.539) [-572.857] -- 0:00:12
      720000 -- (-571.396) [-572.301] (-573.027) (-576.673) * (-576.782) [-572.264] (-576.351) (-574.763) -- 0:00:12

      Average standard deviation of split frequencies: 0.020060

      720500 -- (-572.252) (-572.262) (-574.515) [-573.341] * (-571.924) (-572.933) (-573.010) [-572.096] -- 0:00:12
      721000 -- (-574.399) (-573.754) [-573.758] (-573.671) * (-579.865) (-572.850) (-573.764) [-572.002] -- 0:00:12
      721500 -- (-574.634) [-575.149] (-571.913) (-575.358) * [-573.941] (-574.859) (-577.923) (-571.087) -- 0:00:12
      722000 -- [-573.967] (-572.563) (-573.977) (-572.692) * [-572.673] (-573.938) (-573.183) (-575.828) -- 0:00:12
      722500 -- (-574.140) (-573.406) [-574.260] (-571.262) * (-575.873) [-573.527] (-577.508) (-572.878) -- 0:00:12
      723000 -- (-573.229) [-573.989] (-577.075) (-573.680) * (-574.814) [-571.745] (-572.791) (-571.071) -- 0:00:13
      723500 -- [-572.813] (-574.468) (-578.621) (-572.001) * (-575.741) (-574.416) [-575.701] (-573.429) -- 0:00:12
      724000 -- (-572.434) [-571.638] (-573.339) (-571.937) * (-576.335) (-573.770) (-574.292) [-577.256] -- 0:00:12
      724500 -- (-574.195) (-572.942) (-577.753) [-572.864] * (-573.107) [-572.312] (-575.886) (-574.616) -- 0:00:12
      725000 -- (-573.342) (-574.198) (-579.007) [-572.631] * (-576.019) [-571.679] (-574.160) (-571.996) -- 0:00:12

      Average standard deviation of split frequencies: 0.020778

      725500 -- [-574.527] (-571.886) (-571.749) (-575.131) * [-572.750] (-571.695) (-573.032) (-570.740) -- 0:00:12
      726000 -- (-572.275) (-574.364) (-575.850) [-572.295] * [-573.158] (-575.641) (-572.965) (-571.096) -- 0:00:12
      726500 -- (-575.600) (-571.463) (-573.421) [-573.552] * (-572.770) (-578.342) (-572.695) [-574.663] -- 0:00:12
      727000 -- (-572.245) (-573.891) [-573.712] (-572.991) * (-576.055) (-576.231) (-575.599) [-572.832] -- 0:00:12
      727500 -- (-576.488) (-572.593) (-574.025) [-575.387] * [-571.434] (-573.441) (-576.489) (-575.200) -- 0:00:12
      728000 -- (-571.260) (-573.550) [-572.408] (-574.236) * (-573.410) [-572.267] (-573.060) (-575.197) -- 0:00:12
      728500 -- [-573.630] (-571.965) (-572.076) (-574.177) * (-572.170) (-573.910) [-572.210] (-574.326) -- 0:00:12
      729000 -- (-575.355) (-575.150) [-572.844] (-575.423) * (-573.757) (-573.437) (-573.109) [-575.651] -- 0:00:12
      729500 -- (-574.454) (-571.579) [-577.375] (-572.388) * (-571.197) (-575.665) [-573.794] (-572.283) -- 0:00:12
      730000 -- (-573.027) (-574.240) [-573.083] (-573.400) * [-574.292] (-573.776) (-573.233) (-573.140) -- 0:00:12

      Average standard deviation of split frequencies: 0.020215

      730500 -- [-571.473] (-572.106) (-572.512) (-572.398) * [-572.602] (-573.770) (-574.251) (-574.118) -- 0:00:12
      731000 -- (-572.099) (-576.823) (-571.494) [-573.586] * (-576.717) [-572.956] (-571.388) (-573.399) -- 0:00:12
      731500 -- [-572.905] (-580.526) (-573.075) (-575.066) * (-575.127) [-571.976] (-574.231) (-571.382) -- 0:00:12
      732000 -- (-573.376) (-573.172) (-572.686) [-571.495] * (-572.531) (-576.334) (-575.583) [-572.472] -- 0:00:12
      732500 -- (-572.976) (-571.551) (-572.224) [-572.442] * (-573.053) (-572.631) [-573.631] (-573.246) -- 0:00:12
      733000 -- [-573.323] (-571.536) (-573.488) (-574.362) * (-572.930) (-578.555) (-572.598) [-571.322] -- 0:00:12
      733500 -- (-574.952) [-571.691] (-573.914) (-572.062) * [-572.909] (-575.123) (-572.234) (-573.866) -- 0:00:12
      734000 -- (-576.534) (-571.975) [-571.831] (-573.205) * [-572.082] (-577.785) (-574.306) (-574.499) -- 0:00:12
      734500 -- (-576.777) (-575.119) (-572.510) [-574.490] * (-571.363) [-574.074] (-572.875) (-577.190) -- 0:00:12
      735000 -- (-577.324) (-573.114) [-573.599] (-571.653) * (-572.133) (-575.264) [-577.189] (-576.174) -- 0:00:12

      Average standard deviation of split frequencies: 0.020069

      735500 -- (-576.684) [-574.043] (-572.757) (-573.670) * [-574.413] (-571.757) (-572.852) (-572.027) -- 0:00:12
      736000 -- [-571.361] (-572.727) (-573.679) (-573.555) * (-571.585) (-572.732) [-572.767] (-576.072) -- 0:00:12
      736500 -- (-577.731) (-573.512) (-574.357) [-571.131] * [-573.114] (-576.936) (-572.553) (-573.299) -- 0:00:12
      737000 -- (-576.354) (-576.184) (-572.298) [-575.324] * [-571.824] (-575.623) (-572.529) (-574.984) -- 0:00:12
      737500 -- [-572.246] (-574.878) (-573.518) (-572.147) * (-573.485) (-572.815) (-573.431) [-574.720] -- 0:00:12
      738000 -- (-574.098) (-572.836) (-572.063) [-570.850] * [-570.993] (-572.296) (-574.004) (-571.105) -- 0:00:12
      738500 -- [-574.763] (-573.339) (-574.039) (-571.646) * (-572.146) [-574.107] (-575.748) (-570.643) -- 0:00:12
      739000 -- (-571.293) [-574.799] (-575.194) (-572.193) * (-571.472) (-572.169) [-572.139] (-573.915) -- 0:00:12
      739500 -- (-572.122) (-572.892) [-573.917] (-573.220) * (-573.168) [-573.079] (-571.294) (-572.230) -- 0:00:11
      740000 -- (-574.460) [-571.703] (-582.279) (-573.482) * (-573.921) (-571.819) [-571.430] (-573.592) -- 0:00:11

      Average standard deviation of split frequencies: 0.019518

      740500 -- (-573.616) [-573.584] (-570.689) (-580.353) * [-574.280] (-572.834) (-572.028) (-574.609) -- 0:00:11
      741000 -- (-575.354) (-572.294) [-571.108] (-575.806) * (-577.183) [-572.684] (-573.207) (-571.378) -- 0:00:11
      741500 -- (-574.674) (-573.607) (-572.267) [-573.435] * (-573.180) (-571.639) [-573.189] (-572.774) -- 0:00:11
      742000 -- (-577.563) [-571.956] (-574.604) (-572.954) * (-574.250) (-572.185) [-577.254] (-573.884) -- 0:00:11
      742500 -- [-572.250] (-575.857) (-575.207) (-572.783) * (-575.595) [-570.978] (-572.307) (-571.428) -- 0:00:11
      743000 -- (-574.341) (-572.514) (-572.145) [-574.086] * (-574.661) (-571.495) (-574.301) [-572.909] -- 0:00:11
      743500 -- (-572.283) (-575.853) [-572.378] (-576.457) * [-571.521] (-573.583) (-573.914) (-572.238) -- 0:00:11
      744000 -- (-574.369) [-571.985] (-572.514) (-576.632) * [-574.280] (-575.977) (-574.318) (-571.820) -- 0:00:11
      744500 -- [-572.821] (-574.211) (-571.127) (-574.110) * (-570.827) (-573.576) (-572.616) [-571.154] -- 0:00:11
      745000 -- (-573.529) (-572.003) (-573.658) [-573.350] * [-572.001] (-575.414) (-577.584) (-576.318) -- 0:00:11

      Average standard deviation of split frequencies: 0.018957

      745500 -- (-576.902) (-571.198) [-572.434] (-573.568) * [-576.721] (-578.143) (-576.954) (-573.778) -- 0:00:11
      746000 -- (-575.286) (-572.143) [-572.763] (-572.237) * (-571.985) [-575.047] (-573.050) (-578.972) -- 0:00:11
      746500 -- [-573.444] (-577.197) (-572.190) (-572.681) * (-571.987) [-574.212] (-572.647) (-572.419) -- 0:00:11
      747000 -- [-572.784] (-572.171) (-573.510) (-572.156) * (-573.357) [-574.358] (-573.802) (-571.894) -- 0:00:11
      747500 -- (-574.046) [-576.816] (-573.452) (-579.806) * [-572.680] (-571.876) (-574.757) (-574.687) -- 0:00:11
      748000 -- (-579.062) (-576.047) (-578.181) [-572.676] * (-572.178) (-572.516) (-571.544) [-573.269] -- 0:00:11
      748500 -- [-574.249] (-572.666) (-571.113) (-571.858) * [-573.111] (-573.762) (-571.541) (-576.918) -- 0:00:11
      749000 -- (-574.165) (-577.309) [-572.328] (-572.967) * (-572.980) [-573.696] (-572.999) (-573.929) -- 0:00:11
      749500 -- (-572.450) (-572.746) [-573.773] (-572.756) * (-572.862) (-570.844) (-571.811) [-575.003] -- 0:00:11
      750000 -- [-575.236] (-571.932) (-575.951) (-576.634) * (-571.603) (-571.119) [-572.897] (-573.141) -- 0:00:11

      Average standard deviation of split frequencies: 0.017583

      750500 -- (-574.486) [-571.725] (-571.764) (-572.981) * (-572.985) (-572.326) [-573.121] (-571.943) -- 0:00:11
      751000 -- (-571.749) [-573.201] (-577.988) (-572.391) * [-572.526] (-572.218) (-575.689) (-572.062) -- 0:00:11
      751500 -- (-572.716) (-572.106) (-574.381) [-573.037] * (-571.217) (-576.173) [-571.295] (-571.878) -- 0:00:11
      752000 -- (-571.904) [-571.342] (-575.917) (-574.147) * (-571.543) [-572.972] (-572.653) (-575.864) -- 0:00:11
      752500 -- (-573.431) (-572.556) [-573.684] (-574.312) * (-578.181) (-572.239) (-580.496) [-572.702] -- 0:00:11
      753000 -- (-572.002) (-571.584) [-571.735] (-573.525) * (-572.851) [-571.576] (-572.491) (-571.842) -- 0:00:11
      753500 -- (-572.287) (-573.484) (-571.249) [-573.091] * (-572.377) (-571.068) [-574.179] (-572.142) -- 0:00:11
      754000 -- (-571.495) (-570.815) [-572.799] (-571.928) * (-577.499) [-571.530] (-572.734) (-575.424) -- 0:00:11
      754500 -- (-573.241) (-573.326) (-573.597) [-571.255] * (-573.090) (-572.795) [-572.828] (-574.634) -- 0:00:11
      755000 -- (-577.539) (-573.818) (-573.527) [-574.619] * (-571.709) (-575.256) (-573.697) [-577.772] -- 0:00:11

      Average standard deviation of split frequencies: 0.018291

      755500 -- (-572.479) (-572.024) (-572.578) [-573.690] * (-572.309) (-573.983) [-571.631] (-572.902) -- 0:00:11
      756000 -- [-572.880] (-573.052) (-575.321) (-570.942) * (-575.265) (-574.888) (-573.410) [-573.853] -- 0:00:11
      756500 -- (-574.761) [-572.210] (-574.154) (-572.786) * (-571.637) (-573.744) (-574.248) [-572.614] -- 0:00:11
      757000 -- (-573.599) (-572.837) (-575.254) [-570.970] * (-573.257) [-573.483] (-573.386) (-573.340) -- 0:00:11
      757500 -- (-571.570) (-577.052) [-573.052] (-575.286) * (-572.638) (-573.121) (-571.660) [-573.932] -- 0:00:11
      758000 -- [-572.743] (-573.350) (-571.969) (-572.312) * [-571.308] (-573.337) (-571.416) (-576.696) -- 0:00:11
      758500 -- (-575.861) [-572.446] (-574.490) (-575.441) * [-574.644] (-573.043) (-572.547) (-583.598) -- 0:00:11
      759000 -- (-573.287) (-571.783) [-574.028] (-572.310) * (-572.742) [-573.105] (-575.318) (-571.748) -- 0:00:11
      759500 -- (-575.081) [-571.698] (-575.284) (-571.721) * (-578.147) [-575.779] (-574.232) (-574.485) -- 0:00:11
      760000 -- (-573.646) (-571.647) [-573.819] (-572.825) * [-578.269] (-573.303) (-573.479) (-571.882) -- 0:00:11

      Average standard deviation of split frequencies: 0.021484

      760500 -- [-574.168] (-574.134) (-571.887) (-572.186) * (-571.793) (-572.959) (-571.425) [-574.846] -- 0:00:11
      761000 -- [-573.041] (-572.004) (-574.399) (-573.502) * (-572.904) (-575.129) (-571.135) [-572.421] -- 0:00:10
      761500 -- [-574.455] (-571.508) (-577.382) (-571.721) * (-572.796) [-571.658] (-570.869) (-575.745) -- 0:00:10
      762000 -- (-572.359) [-571.978] (-576.708) (-574.066) * (-573.056) (-572.958) [-571.680] (-574.748) -- 0:00:10
      762500 -- [-570.973] (-573.055) (-572.563) (-571.111) * (-572.989) (-571.817) [-572.734] (-576.317) -- 0:00:10
      763000 -- [-571.893] (-572.846) (-571.581) (-572.404) * (-574.795) (-575.075) (-571.879) [-572.619] -- 0:00:10
      763500 -- (-571.719) [-574.383] (-572.538) (-572.543) * (-572.051) (-576.254) [-572.782] (-571.188) -- 0:00:10
      764000 -- (-572.498) (-571.371) [-573.969] (-574.098) * (-572.638) (-571.862) [-572.706] (-572.661) -- 0:00:10
      764500 -- (-572.541) (-574.083) [-571.306] (-572.678) * (-571.536) (-571.936) (-572.854) [-571.947] -- 0:00:10
      765000 -- (-571.564) (-572.678) [-573.183] (-573.206) * (-572.379) (-573.138) (-571.968) [-572.754] -- 0:00:10

      Average standard deviation of split frequencies: 0.021745

      765500 -- (-572.322) (-571.312) [-570.891] (-577.656) * [-571.709] (-574.476) (-574.451) (-571.377) -- 0:00:10
      766000 -- (-573.248) [-577.591] (-573.114) (-573.464) * (-573.694) (-571.683) (-573.862) [-572.566] -- 0:00:10
      766500 -- (-572.610) (-577.377) (-571.596) [-577.005] * [-574.031] (-576.103) (-571.656) (-572.674) -- 0:00:10
      767000 -- (-573.476) (-571.161) [-573.761] (-573.038) * (-574.470) (-572.319) [-570.951] (-571.574) -- 0:00:10
      767500 -- (-572.655) (-571.015) (-572.085) [-577.116] * (-573.326) (-571.638) [-571.822] (-574.642) -- 0:00:10
      768000 -- (-572.920) (-575.515) (-573.019) [-574.044] * [-583.200] (-575.217) (-573.373) (-571.754) -- 0:00:10
      768500 -- (-571.585) (-575.262) [-571.853] (-577.087) * [-575.291] (-575.157) (-572.874) (-572.193) -- 0:00:10
      769000 -- [-573.748] (-575.011) (-570.998) (-575.036) * (-573.990) (-574.166) [-571.455] (-572.647) -- 0:00:10
      769500 -- [-572.615] (-574.261) (-571.560) (-575.753) * (-571.294) [-571.485] (-574.128) (-572.675) -- 0:00:10
      770000 -- (-572.429) [-573.089] (-573.566) (-573.844) * [-571.693] (-572.204) (-571.428) (-576.224) -- 0:00:10

      Average standard deviation of split frequencies: 0.021205

      770500 -- (-571.923) (-574.667) (-575.121) [-571.561] * [-573.354] (-571.821) (-575.644) (-575.245) -- 0:00:10
      771000 -- (-573.294) [-572.550] (-572.910) (-572.195) * (-574.561) (-572.068) (-572.509) [-573.490] -- 0:00:10
      771500 -- (-571.590) (-572.903) [-576.004] (-572.756) * (-573.520) [-573.203] (-573.923) (-571.459) -- 0:00:10
      772000 -- [-575.460] (-572.417) (-572.690) (-572.661) * (-573.393) (-573.259) (-575.344) [-571.300] -- 0:00:10
      772500 -- (-575.537) [-572.992] (-571.199) (-574.995) * (-571.730) (-573.324) [-573.194] (-573.798) -- 0:00:10
      773000 -- (-578.194) (-576.417) (-573.244) [-575.376] * (-575.088) [-573.714] (-574.279) (-575.441) -- 0:00:10
      773500 -- (-573.280) [-573.543] (-575.456) (-574.900) * [-575.317] (-575.784) (-573.864) (-573.608) -- 0:00:10
      774000 -- (-573.830) (-579.946) (-572.685) [-571.276] * (-573.063) (-572.335) (-572.863) [-573.417] -- 0:00:10
      774500 -- (-577.717) (-573.661) (-571.694) [-573.483] * (-570.934) (-573.121) (-573.257) [-572.755] -- 0:00:10
      775000 -- (-579.952) (-572.357) [-573.621] (-574.349) * (-573.243) (-571.493) (-572.651) [-572.305] -- 0:00:10

      Average standard deviation of split frequencies: 0.020654

      775500 -- (-571.144) (-576.516) (-577.948) [-574.503] * (-572.515) (-573.104) (-576.033) [-572.179] -- 0:00:10
      776000 -- [-571.062] (-573.384) (-575.688) (-572.392) * (-574.617) (-571.780) (-572.508) [-575.418] -- 0:00:10
      776500 -- [-571.098] (-573.364) (-571.358) (-573.703) * (-572.377) (-572.249) [-572.917] (-571.883) -- 0:00:10
      777000 -- (-575.966) (-572.151) (-573.063) [-574.425] * (-571.243) [-571.202] (-571.641) (-574.858) -- 0:00:10
      777500 -- (-574.228) (-571.929) [-572.549] (-572.845) * [-571.572] (-575.109) (-575.310) (-571.357) -- 0:00:10
      778000 -- [-579.026] (-574.229) (-572.096) (-572.424) * (-572.348) [-572.999] (-572.793) (-571.178) -- 0:00:10
      778500 -- (-575.834) (-575.489) [-574.121] (-571.506) * (-573.797) (-572.338) (-572.096) [-572.551] -- 0:00:10
      779000 -- (-572.054) (-571.597) [-575.346] (-572.551) * [-572.519] (-573.229) (-570.656) (-572.891) -- 0:00:10
      779500 -- (-575.587) (-571.328) [-574.491] (-573.119) * (-575.637) (-576.702) (-571.185) [-571.564] -- 0:00:10
      780000 -- [-575.830] (-572.259) (-575.375) (-571.305) * (-573.327) [-572.356] (-573.191) (-572.714) -- 0:00:10

      Average standard deviation of split frequencies: 0.020128

      780500 -- (-575.232) (-573.622) (-573.545) [-571.810] * (-573.140) (-577.185) (-574.058) [-572.083] -- 0:00:10
      781000 -- (-570.997) (-572.921) [-573.590] (-571.904) * (-572.912) [-571.329] (-573.785) (-573.800) -- 0:00:10
      781500 -- (-573.890) (-573.686) (-572.963) [-574.881] * (-576.244) (-573.591) (-571.728) [-572.204] -- 0:00:10
      782000 -- (-580.744) (-577.142) [-572.266] (-572.557) * [-572.833] (-573.089) (-573.035) (-574.521) -- 0:00:10
      782500 -- (-574.520) (-575.520) (-571.289) [-575.701] * (-573.148) (-574.404) (-572.929) [-573.011] -- 0:00:10
      783000 -- (-576.249) (-572.280) (-573.469) [-573.100] * (-574.273) (-574.557) (-572.878) [-573.075] -- 0:00:09
      783500 -- (-575.817) (-573.061) [-572.647] (-574.185) * (-571.567) (-573.138) (-573.969) [-572.853] -- 0:00:09
      784000 -- (-575.440) [-572.777] (-572.272) (-574.683) * (-571.585) (-572.467) [-576.579] (-572.292) -- 0:00:09
      784500 -- (-576.863) (-573.096) [-572.806] (-576.779) * (-580.626) (-573.101) [-572.710] (-572.079) -- 0:00:09
      785000 -- (-576.753) (-574.733) (-571.424) [-574.989] * (-573.361) [-571.845] (-574.665) (-575.007) -- 0:00:09

      Average standard deviation of split frequencies: 0.019592

      785500 -- (-573.162) (-573.903) (-572.176) [-574.236] * [-573.450] (-574.453) (-572.403) (-575.448) -- 0:00:09
      786000 -- (-572.910) (-572.195) [-578.499] (-579.369) * (-573.882) [-573.610] (-574.087) (-573.128) -- 0:00:09
      786500 -- (-574.998) (-573.228) (-577.168) [-571.909] * (-572.758) (-571.475) (-577.296) [-572.831] -- 0:00:09
      787000 -- [-578.765] (-574.039) (-573.290) (-577.843) * (-571.295) (-572.226) (-572.968) [-573.242] -- 0:00:09
      787500 -- (-572.692) (-571.456) (-574.583) [-576.559] * [-572.795] (-574.120) (-574.038) (-572.629) -- 0:00:09
      788000 -- (-573.377) (-572.011) (-572.448) [-572.787] * (-571.315) [-572.703] (-572.376) (-576.890) -- 0:00:09
      788500 -- (-573.457) (-572.724) [-573.161] (-572.110) * (-573.429) (-574.249) [-573.984] (-575.986) -- 0:00:09
      789000 -- (-576.364) [-571.542] (-575.520) (-573.305) * [-572.956] (-573.536) (-578.102) (-574.246) -- 0:00:09
      789500 -- (-574.768) [-571.477] (-578.478) (-573.494) * [-572.382] (-574.341) (-571.918) (-573.205) -- 0:00:09
      790000 -- (-574.620) (-574.030) [-571.429] (-573.119) * (-571.904) [-572.243] (-571.588) (-571.199) -- 0:00:09

      Average standard deviation of split frequencies: 0.018284

      790500 -- (-572.800) (-573.579) (-577.073) [-570.957] * (-571.964) (-572.323) [-574.985] (-572.013) -- 0:00:09
      791000 -- [-575.682] (-571.160) (-578.660) (-573.444) * (-573.271) (-572.033) (-578.524) [-573.732] -- 0:00:09
      791500 -- [-572.730] (-573.079) (-573.820) (-571.240) * (-571.689) (-574.501) (-573.768) [-574.764] -- 0:00:09
      792000 -- (-573.831) (-572.545) (-571.975) [-573.596] * (-573.104) (-574.304) [-571.562] (-572.305) -- 0:00:09
      792500 -- (-571.882) (-574.623) (-572.382) [-573.669] * (-572.948) (-573.477) [-572.921] (-571.503) -- 0:00:09
      793000 -- [-573.271] (-572.432) (-575.261) (-573.916) * (-574.862) (-571.352) (-573.449) [-571.153] -- 0:00:09
      793500 -- (-574.260) [-571.877] (-574.139) (-572.756) * (-572.218) [-571.080] (-574.163) (-573.445) -- 0:00:09
      794000 -- (-572.935) (-571.065) [-574.788] (-573.776) * [-572.880] (-570.881) (-571.938) (-575.641) -- 0:00:09
      794500 -- (-572.302) [-571.569] (-571.954) (-571.897) * (-575.232) [-574.532] (-573.132) (-575.312) -- 0:00:09
      795000 -- [-571.384] (-571.607) (-573.431) (-577.561) * [-571.453] (-572.868) (-574.405) (-573.110) -- 0:00:09

      Average standard deviation of split frequencies: 0.017767

      795500 -- (-570.894) (-572.236) (-572.564) [-576.865] * (-572.484) (-572.551) (-575.822) [-571.208] -- 0:00:09
      796000 -- (-573.041) (-573.157) (-573.685) [-573.960] * [-571.758] (-574.851) (-575.140) (-571.759) -- 0:00:09
      796500 -- (-577.215) [-573.658] (-572.235) (-574.282) * [-572.664] (-572.385) (-576.417) (-572.542) -- 0:00:09
      797000 -- [-572.525] (-572.351) (-573.743) (-574.238) * (-580.672) (-574.896) (-572.598) [-572.445] -- 0:00:09
      797500 -- [-573.508] (-576.762) (-571.568) (-574.517) * [-572.017] (-571.341) (-575.780) (-571.925) -- 0:00:09
      798000 -- (-574.240) [-575.412] (-574.911) (-574.867) * (-577.488) (-571.189) (-572.567) [-572.783] -- 0:00:09
      798500 -- (-574.735) (-574.028) [-573.184] (-574.999) * (-574.909) (-573.492) [-576.754] (-574.542) -- 0:00:09
      799000 -- (-574.129) (-571.363) (-575.012) [-571.426] * (-572.035) [-571.337] (-580.145) (-573.117) -- 0:00:09
      799500 -- (-574.374) (-571.330) [-572.933] (-572.134) * (-572.702) [-573.869] (-577.135) (-578.471) -- 0:00:09
      800000 -- [-572.431] (-572.774) (-577.007) (-572.969) * [-571.715] (-576.327) (-573.122) (-573.120) -- 0:00:09

      Average standard deviation of split frequencies: 0.018840

      800500 -- (-573.368) (-575.551) [-571.209] (-574.076) * (-571.720) [-574.323] (-575.600) (-572.209) -- 0:00:09
      801000 -- [-571.508] (-574.035) (-573.144) (-571.764) * (-572.415) (-572.990) (-576.121) [-575.592] -- 0:00:09
      801500 -- (-572.549) (-572.001) [-573.865] (-572.131) * [-573.496] (-576.597) (-578.316) (-571.668) -- 0:00:09
      802000 -- (-573.152) [-575.248] (-575.380) (-575.563) * (-572.418) (-575.644) (-572.210) [-573.365] -- 0:00:09
      802500 -- (-573.043) (-574.650) [-573.031] (-576.962) * (-574.205) (-574.161) [-575.657] (-574.998) -- 0:00:09
      803000 -- [-572.372] (-573.090) (-572.148) (-571.540) * (-574.394) (-578.022) [-571.343] (-572.581) -- 0:00:09
      803500 -- (-571.581) (-576.149) [-571.601] (-571.184) * [-573.743] (-573.224) (-572.383) (-572.168) -- 0:00:09
      804000 -- (-571.126) [-576.082] (-570.955) (-574.444) * (-577.491) (-571.686) [-576.054] (-573.626) -- 0:00:09
      804500 -- (-574.498) (-575.140) (-575.654) [-575.347] * (-574.450) (-574.599) [-572.136] (-576.608) -- 0:00:08
      805000 -- (-578.279) [-572.973] (-578.385) (-574.521) * (-572.844) [-574.526] (-572.172) (-572.525) -- 0:00:08

      Average standard deviation of split frequencies: 0.018716

      805500 -- (-572.017) (-574.719) [-572.838] (-572.843) * [-574.462] (-572.370) (-573.433) (-572.931) -- 0:00:08
      806000 -- [-572.190] (-574.410) (-577.186) (-571.679) * (-575.309) (-571.823) [-572.722] (-572.675) -- 0:00:08
      806500 -- [-572.164] (-576.509) (-573.754) (-572.804) * [-575.284] (-572.880) (-571.677) (-574.288) -- 0:00:08
      807000 -- (-571.941) (-576.448) (-573.223) [-574.317] * (-576.192) (-571.679) [-572.749] (-574.521) -- 0:00:08
      807500 -- (-571.714) (-572.619) [-574.293] (-576.625) * (-574.441) [-574.165] (-576.957) (-577.026) -- 0:00:08
      808000 -- (-573.130) (-571.438) (-570.928) [-572.911] * (-572.147) (-573.330) [-573.399] (-572.976) -- 0:00:08
      808500 -- (-573.990) [-571.626] (-571.836) (-574.343) * (-572.290) (-571.219) (-574.705) [-571.725] -- 0:00:08
      809000 -- (-575.801) (-572.301) (-573.864) [-573.038] * (-572.754) (-573.532) (-574.676) [-573.015] -- 0:00:08
      809500 -- (-574.131) (-578.748) (-575.137) [-574.329] * [-571.294] (-572.904) (-573.561) (-571.259) -- 0:00:08
      810000 -- (-573.973) [-570.976] (-572.548) (-578.497) * [-574.054] (-579.031) (-572.066) (-575.575) -- 0:00:08

      Average standard deviation of split frequencies: 0.018608

      810500 -- [-573.162] (-574.497) (-572.592) (-582.504) * (-574.732) (-572.651) [-578.030] (-578.368) -- 0:00:08
      811000 -- [-572.014] (-571.079) (-573.336) (-574.901) * (-573.396) (-571.522) (-572.664) [-573.253] -- 0:00:08
      811500 -- [-570.846] (-570.667) (-575.150) (-573.900) * (-572.512) (-572.021) [-572.769] (-575.374) -- 0:00:08
      812000 -- [-573.444] (-571.441) (-571.574) (-572.303) * (-572.885) [-572.518] (-572.346) (-574.510) -- 0:00:08
      812500 -- (-572.274) (-572.688) [-571.810] (-571.802) * (-572.422) [-573.439] (-575.964) (-572.751) -- 0:00:08
      813000 -- (-572.213) [-575.916] (-571.181) (-573.281) * (-571.325) (-571.948) (-574.493) [-572.422] -- 0:00:08
      813500 -- (-574.095) [-572.352] (-572.179) (-572.635) * (-574.695) (-571.547) (-574.059) [-574.628] -- 0:00:08
      814000 -- (-572.074) (-572.593) (-577.744) [-573.404] * (-572.606) (-573.768) [-571.820] (-572.964) -- 0:00:08
      814500 -- (-571.313) (-571.845) [-579.067] (-571.271) * (-572.609) [-571.487] (-573.099) (-572.456) -- 0:00:08
      815000 -- (-572.145) [-571.056] (-573.113) (-571.433) * (-572.652) (-572.448) (-572.786) [-573.397] -- 0:00:08

      Average standard deviation of split frequencies: 0.018486

      815500 -- (-575.166) [-572.427] (-572.432) (-576.672) * [-571.670] (-571.372) (-574.344) (-572.344) -- 0:00:08
      816000 -- [-572.064] (-572.971) (-572.673) (-579.954) * [-571.985] (-572.445) (-575.209) (-574.771) -- 0:00:08
      816500 -- [-572.406] (-570.843) (-574.206) (-574.431) * (-576.449) (-571.614) (-578.473) [-574.408] -- 0:00:08
      817000 -- (-572.017) (-572.466) [-571.107] (-576.266) * (-573.336) (-572.713) (-577.757) [-573.368] -- 0:00:08
      817500 -- (-572.195) (-572.344) [-574.028] (-572.306) * (-576.815) (-574.917) [-573.258] (-571.987) -- 0:00:08
      818000 -- (-574.143) (-572.935) (-572.553) [-571.406] * [-575.264] (-574.525) (-571.628) (-572.091) -- 0:00:08
      818500 -- (-571.816) (-574.370) [-574.957] (-572.531) * (-572.772) (-572.659) (-575.472) [-572.019] -- 0:00:08
      819000 -- [-573.115] (-571.880) (-573.261) (-571.509) * [-571.391] (-573.051) (-578.372) (-572.894) -- 0:00:08
      819500 -- (-573.417) (-572.578) (-571.348) [-572.748] * [-572.764] (-572.696) (-577.462) (-574.598) -- 0:00:08
      820000 -- (-575.551) [-571.710] (-571.555) (-572.907) * (-571.654) (-573.612) [-573.444] (-572.710) -- 0:00:08

      Average standard deviation of split frequencies: 0.018764

      820500 -- (-572.733) [-572.131] (-573.281) (-571.248) * [-571.201] (-572.493) (-575.047) (-572.850) -- 0:00:08
      821000 -- (-571.114) [-573.983] (-572.173) (-572.819) * [-571.513] (-571.753) (-575.073) (-573.382) -- 0:00:08
      821500 -- (-573.170) (-573.508) (-573.289) [-573.659] * (-573.784) [-573.821] (-575.640) (-572.184) -- 0:00:08
      822000 -- (-571.707) [-572.865] (-574.841) (-572.728) * (-573.532) (-575.844) (-573.088) [-573.063] -- 0:00:08
      822500 -- (-571.309) (-571.552) (-576.340) [-572.445] * (-576.731) [-572.319] (-572.900) (-574.465) -- 0:00:08
      823000 -- [-571.429] (-571.422) (-578.175) (-573.271) * (-573.388) (-573.644) [-571.664] (-574.176) -- 0:00:08
      823500 -- (-572.777) (-572.174) (-572.651) [-573.743] * (-573.397) [-573.515] (-573.267) (-573.787) -- 0:00:08
      824000 -- (-572.321) (-573.087) (-574.323) [-572.171] * (-572.412) [-571.564] (-577.684) (-572.178) -- 0:00:08
      824500 -- [-573.299] (-571.257) (-575.613) (-570.871) * [-571.804] (-573.815) (-573.987) (-571.307) -- 0:00:08
      825000 -- (-572.031) (-573.808) (-574.400) [-570.925] * (-576.236) (-571.367) [-571.856] (-571.715) -- 0:00:08

      Average standard deviation of split frequencies: 0.020165

      825500 -- (-572.881) (-579.128) [-578.333] (-574.712) * (-572.329) (-571.524) [-572.196] (-571.695) -- 0:00:08
      826000 -- [-573.580] (-571.676) (-571.596) (-573.298) * (-572.108) (-572.711) [-571.093] (-574.589) -- 0:00:08
      826500 -- [-571.295] (-573.850) (-573.294) (-571.137) * (-573.174) [-573.250] (-577.021) (-574.965) -- 0:00:07
      827000 -- (-574.178) (-577.283) (-572.186) [-571.543] * (-575.589) (-572.454) [-575.269] (-574.808) -- 0:00:07
      827500 -- (-574.185) (-573.994) [-571.115] (-571.122) * [-575.504] (-572.070) (-576.760) (-571.019) -- 0:00:07
      828000 -- (-573.252) (-574.996) [-571.653] (-576.776) * (-575.023) [-573.241] (-576.732) (-572.578) -- 0:00:07
      828500 -- (-576.970) (-572.005) (-571.803) [-571.852] * [-572.207] (-572.643) (-577.303) (-571.664) -- 0:00:07
      829000 -- (-571.874) (-572.884) (-573.085) [-572.317] * (-572.392) [-571.417] (-571.636) (-574.531) -- 0:00:07
      829500 -- [-572.349] (-573.398) (-574.247) (-574.669) * (-571.416) [-572.275] (-572.234) (-573.335) -- 0:00:07
      830000 -- (-572.025) (-575.415) [-572.360] (-574.554) * (-573.650) (-572.298) (-571.429) [-573.955] -- 0:00:07

      Average standard deviation of split frequencies: 0.019673

      830500 -- (-573.631) (-579.283) (-573.041) [-571.668] * (-571.371) [-574.349] (-572.971) (-574.539) -- 0:00:07
      831000 -- [-574.318] (-572.056) (-574.642) (-572.349) * (-572.165) [-573.182] (-573.389) (-574.104) -- 0:00:07
      831500 -- (-572.560) (-571.284) [-574.786] (-577.781) * (-572.417) (-574.577) (-573.127) [-574.828] -- 0:00:07
      832000 -- (-576.783) [-572.268] (-573.125) (-576.486) * (-574.201) (-572.552) (-573.513) [-574.088] -- 0:00:07
      832500 -- (-575.769) (-570.992) [-571.291] (-575.354) * (-573.782) (-571.921) (-574.196) [-573.039] -- 0:00:07
      833000 -- [-571.599] (-575.622) (-570.856) (-575.172) * [-575.049] (-573.301) (-572.019) (-573.746) -- 0:00:07
      833500 -- (-571.314) [-571.836] (-576.859) (-572.435) * (-575.540) (-573.561) [-572.619] (-574.248) -- 0:00:07
      834000 -- (-571.807) [-571.058] (-573.707) (-574.176) * [-573.932] (-572.678) (-573.321) (-574.063) -- 0:00:07
      834500 -- [-572.387] (-572.930) (-572.170) (-571.551) * [-573.440] (-572.964) (-573.522) (-572.523) -- 0:00:07
      835000 -- (-574.724) (-574.085) [-575.698] (-571.732) * (-572.258) (-573.147) (-571.595) [-573.794] -- 0:00:07

      Average standard deviation of split frequencies: 0.018420

      835500 -- [-571.144] (-572.229) (-576.886) (-573.510) * (-571.977) (-581.106) [-572.452] (-571.489) -- 0:00:07
      836000 -- [-572.954] (-576.096) (-573.340) (-572.259) * (-573.228) (-574.247) [-571.737] (-571.147) -- 0:00:07
      836500 -- (-575.370) [-574.592] (-571.373) (-571.758) * (-574.107) (-573.296) (-571.374) [-575.702] -- 0:00:07
      837000 -- (-571.745) (-572.938) [-571.153] (-573.830) * (-574.658) (-572.059) (-571.979) [-572.178] -- 0:00:07
      837500 -- (-572.825) (-577.078) [-572.800] (-574.466) * [-571.645] (-573.505) (-572.794) (-572.737) -- 0:00:07
      838000 -- (-572.761) [-573.138] (-573.081) (-572.200) * (-572.099) (-572.708) (-571.822) [-571.925] -- 0:00:07
      838500 -- (-573.672) (-574.896) [-572.766] (-571.393) * (-573.557) (-573.648) [-573.778] (-573.066) -- 0:00:07
      839000 -- (-572.137) [-572.172] (-571.720) (-573.283) * (-572.416) (-572.164) (-573.934) [-574.467] -- 0:00:07
      839500 -- (-573.022) (-574.357) (-571.693) [-570.826] * (-573.765) (-574.348) (-574.270) [-574.436] -- 0:00:07
      840000 -- [-577.539] (-577.288) (-572.021) (-574.099) * (-573.112) (-572.949) [-574.936] (-572.856) -- 0:00:07

      Average standard deviation of split frequencies: 0.017570

      840500 -- (-578.467) (-573.617) (-571.022) [-576.678] * (-573.678) [-572.623] (-571.624) (-571.768) -- 0:00:07
      841000 -- (-572.117) [-573.773] (-573.842) (-572.077) * [-573.477] (-571.456) (-579.888) (-574.494) -- 0:00:07
      841500 -- (-571.015) (-572.763) [-573.568] (-570.754) * (-572.031) (-574.086) (-573.400) [-577.083] -- 0:00:07
      842000 -- (-577.416) [-575.509] (-573.725) (-572.972) * [-573.030] (-576.845) (-571.467) (-577.396) -- 0:00:07
      842500 -- (-573.790) [-573.256] (-573.711) (-572.306) * (-571.712) (-571.098) (-571.743) [-574.962] -- 0:00:07
      843000 -- (-580.543) [-572.901] (-572.924) (-575.100) * (-576.569) (-572.286) (-575.237) [-571.875] -- 0:00:07
      843500 -- [-573.247] (-571.947) (-571.285) (-573.157) * (-573.686) [-572.170] (-572.691) (-573.191) -- 0:00:07
      844000 -- (-571.070) (-574.093) (-572.597) [-571.542] * (-577.064) (-571.542) (-572.386) [-575.357] -- 0:00:07
      844500 -- (-571.006) (-575.968) [-571.619] (-571.315) * (-574.637) (-574.387) (-572.675) [-572.641] -- 0:00:07
      845000 -- (-574.153) (-572.253) [-574.766] (-573.234) * (-572.858) [-575.803] (-573.502) (-573.267) -- 0:00:07

      Average standard deviation of split frequencies: 0.017831

      845500 -- (-574.340) (-571.732) [-571.279] (-572.882) * (-575.076) (-574.614) [-571.987] (-573.571) -- 0:00:07
      846000 -- (-572.890) [-577.414] (-571.905) (-573.660) * (-574.522) (-575.222) [-572.365] (-573.249) -- 0:00:07
      846500 -- (-572.880) (-572.969) (-574.714) [-572.290] * (-575.191) (-577.943) (-572.944) [-573.194] -- 0:00:07
      847000 -- [-571.140] (-572.169) (-571.980) (-575.074) * (-571.688) (-575.344) (-572.564) [-573.435] -- 0:00:07
      847500 -- (-573.322) (-573.127) (-573.630) [-574.715] * (-573.543) (-573.666) [-580.452] (-574.191) -- 0:00:07
      848000 -- (-572.503) [-571.415] (-579.921) (-574.700) * [-571.959] (-574.810) (-573.622) (-571.159) -- 0:00:06
      848500 -- [-573.218] (-571.120) (-571.731) (-572.304) * [-573.840] (-572.599) (-576.952) (-573.838) -- 0:00:06
      849000 -- [-572.215] (-572.662) (-573.951) (-572.230) * (-574.345) [-575.277] (-574.860) (-571.122) -- 0:00:06
      849500 -- (-574.102) (-573.034) [-572.106] (-574.775) * (-573.000) (-572.523) [-575.128] (-571.724) -- 0:00:06
      850000 -- (-573.860) (-571.413) [-572.821] (-573.090) * (-574.447) (-575.153) [-574.347] (-573.004) -- 0:00:06

      Average standard deviation of split frequencies: 0.016994

      850500 -- (-572.902) (-575.028) (-571.304) [-574.013] * (-571.944) (-573.257) (-573.497) [-573.330] -- 0:00:06
      851000 -- [-572.260] (-572.667) (-570.986) (-574.262) * (-572.622) (-571.400) (-572.838) [-573.342] -- 0:00:06
      851500 -- (-572.666) (-573.429) [-572.929] (-571.564) * [-573.216] (-571.937) (-573.097) (-573.126) -- 0:00:06
      852000 -- [-571.765] (-571.815) (-571.964) (-572.484) * (-576.285) [-572.187] (-573.724) (-574.993) -- 0:00:06
      852500 -- [-572.611] (-571.386) (-571.246) (-573.014) * (-574.486) (-579.760) [-571.770] (-577.287) -- 0:00:06
      853000 -- (-576.858) [-572.707] (-571.022) (-574.254) * (-573.368) (-576.649) [-573.592] (-573.381) -- 0:00:06
      853500 -- (-574.776) [-571.685] (-574.358) (-573.529) * (-573.900) (-574.833) (-573.293) [-572.888] -- 0:00:06
      854000 -- [-573.987] (-572.124) (-572.375) (-572.010) * (-572.135) (-574.645) (-573.513) [-571.337] -- 0:00:06
      854500 -- (-572.671) [-571.053] (-573.396) (-571.066) * [-573.354] (-571.823) (-574.664) (-572.574) -- 0:00:06
      855000 -- [-570.733] (-571.343) (-573.273) (-571.179) * (-575.576) (-571.640) [-575.012] (-571.621) -- 0:00:06

      Average standard deviation of split frequencies: 0.016888

      855500 -- [-571.251] (-573.466) (-571.896) (-571.514) * (-573.209) [-572.401] (-575.865) (-571.168) -- 0:00:06
      856000 -- [-571.014] (-576.369) (-573.782) (-572.442) * (-573.394) [-572.057] (-573.304) (-577.589) -- 0:00:06
      856500 -- (-573.124) (-573.019) (-573.588) [-573.857] * (-573.938) (-571.476) [-572.624] (-576.712) -- 0:00:06
      857000 -- (-572.087) [-575.076] (-578.864) (-574.333) * (-574.260) (-574.288) [-571.479] (-574.617) -- 0:00:06
      857500 -- (-572.315) [-571.363] (-575.543) (-579.133) * (-571.689) (-573.065) [-574.211] (-572.192) -- 0:00:06
      858000 -- (-575.298) (-576.152) (-572.978) [-571.769] * (-573.701) (-577.619) (-574.720) [-572.538] -- 0:00:06
      858500 -- (-576.644) (-571.750) (-574.122) [-572.974] * [-573.529] (-571.782) (-573.476) (-576.221) -- 0:00:06
      859000 -- (-575.192) (-575.147) [-574.338] (-571.637) * [-572.057] (-572.850) (-571.842) (-575.431) -- 0:00:06
      859500 -- (-573.954) [-576.110] (-573.641) (-573.026) * (-571.307) [-571.745] (-571.645) (-581.698) -- 0:00:06
      860000 -- [-572.871] (-571.816) (-571.302) (-573.065) * [-571.022] (-573.738) (-576.446) (-574.828) -- 0:00:06

      Average standard deviation of split frequencies: 0.018622

      860500 -- (-572.885) (-571.839) (-577.300) [-572.768] * (-573.578) (-581.338) [-571.775] (-572.452) -- 0:00:06
      861000 -- [-572.087] (-571.686) (-574.933) (-572.801) * (-576.101) [-572.556] (-572.198) (-571.746) -- 0:00:06
      861500 -- (-574.070) (-572.915) [-573.166] (-572.866) * (-575.053) (-572.555) (-571.944) [-572.018] -- 0:00:06
      862000 -- (-572.548) (-572.593) (-571.041) [-571.473] * (-571.303) (-574.389) (-573.978) [-570.973] -- 0:00:06
      862500 -- (-572.009) [-572.730] (-575.564) (-573.342) * (-570.789) [-572.016] (-574.291) (-571.900) -- 0:00:06
      863000 -- [-573.858] (-573.560) (-575.691) (-572.400) * [-570.941] (-571.022) (-572.805) (-574.354) -- 0:00:06
      863500 -- [-573.803] (-572.039) (-570.982) (-573.962) * (-574.523) (-572.192) (-571.503) [-575.718] -- 0:00:06
      864000 -- (-572.519) (-571.506) [-571.956] (-572.428) * [-573.790] (-574.555) (-573.170) (-574.699) -- 0:00:06
      864500 -- (-572.433) (-572.080) (-573.047) [-573.069] * (-572.662) [-572.637] (-571.545) (-573.122) -- 0:00:06
      865000 -- (-575.803) (-572.432) (-573.802) [-574.838] * [-571.483] (-572.537) (-572.024) (-571.267) -- 0:00:06

      Average standard deviation of split frequencies: 0.018508

      865500 -- (-572.198) (-572.565) (-571.418) [-574.167] * (-571.711) (-571.316) (-573.155) [-574.578] -- 0:00:06
      866000 -- (-575.289) (-577.143) (-571.229) [-574.074] * (-573.561) (-573.773) [-572.755] (-576.373) -- 0:00:06
      866500 -- (-577.782) (-572.357) (-571.210) [-576.650] * (-573.457) (-575.827) (-571.201) [-578.613] -- 0:00:06
      867000 -- (-574.655) (-574.283) (-574.549) [-574.463] * [-571.824] (-571.770) (-572.611) (-575.011) -- 0:00:06
      867500 -- (-574.230) [-574.274] (-571.051) (-576.051) * (-573.271) (-577.794) (-571.727) [-572.818] -- 0:00:06
      868000 -- (-572.320) (-572.648) (-572.637) [-571.662] * [-575.006] (-571.586) (-570.830) (-572.033) -- 0:00:06
      868500 -- [-572.823] (-573.363) (-574.228) (-574.718) * (-571.371) [-572.960] (-574.280) (-575.750) -- 0:00:06
      869000 -- (-575.932) [-572.963] (-572.807) (-572.003) * [-573.632] (-572.425) (-575.648) (-572.512) -- 0:00:06
      869500 -- (-574.298) [-572.324] (-571.535) (-573.907) * [-574.961] (-572.644) (-574.444) (-574.682) -- 0:00:06
      870000 -- (-575.691) (-572.797) [-573.467] (-572.947) * (-579.709) [-572.413] (-571.960) (-571.836) -- 0:00:05

      Average standard deviation of split frequencies: 0.018409

      870500 -- (-573.395) [-572.108] (-576.077) (-573.476) * [-572.070] (-583.768) (-572.657) (-571.902) -- 0:00:05
      871000 -- [-571.441] (-574.791) (-572.590) (-572.973) * (-578.167) (-572.869) (-571.790) [-573.298] -- 0:00:05
      871500 -- [-576.179] (-572.950) (-572.839) (-573.090) * (-579.617) [-570.766] (-573.769) (-573.291) -- 0:00:05
      872000 -- (-572.369) (-571.004) [-572.381] (-574.764) * [-576.269] (-571.414) (-572.907) (-572.090) -- 0:00:05
      872500 -- [-572.120] (-573.827) (-573.227) (-573.169) * (-574.263) [-574.575] (-572.919) (-573.031) -- 0:00:05
      873000 -- (-574.862) [-571.913] (-571.702) (-574.053) * [-571.946] (-575.699) (-575.284) (-573.460) -- 0:00:05
      873500 -- (-572.086) (-571.225) (-572.878) [-573.048] * (-571.902) (-574.462) (-573.101) [-573.359] -- 0:00:05
      874000 -- (-574.003) [-572.903] (-572.275) (-572.934) * (-571.754) (-577.586) [-573.966] (-571.163) -- 0:00:05
      874500 -- (-573.918) (-572.534) [-572.820] (-572.189) * (-574.008) (-573.173) [-573.585] (-572.632) -- 0:00:05
      875000 -- [-577.679] (-574.611) (-572.449) (-573.843) * (-571.038) [-574.901] (-572.060) (-572.394) -- 0:00:05

      Average standard deviation of split frequencies: 0.017220

      875500 -- (-575.972) (-571.317) (-571.786) [-572.236] * (-571.977) (-574.522) [-574.098] (-572.030) -- 0:00:05
      876000 -- (-573.008) (-572.205) [-571.521] (-574.679) * (-575.427) (-576.067) (-571.298) [-571.762] -- 0:00:05
      876500 -- [-572.932] (-575.540) (-577.985) (-572.709) * [-573.187] (-571.450) (-575.186) (-573.612) -- 0:00:05
      877000 -- (-572.746) (-574.181) (-572.577) [-572.182] * (-574.194) (-572.753) [-570.901] (-573.377) -- 0:00:05
      877500 -- (-575.068) [-575.099] (-575.559) (-573.813) * (-571.549) (-574.643) [-571.233] (-572.657) -- 0:00:05
      878000 -- (-574.563) (-573.955) [-575.687] (-574.933) * [-572.085] (-575.636) (-571.414) (-572.884) -- 0:00:05
      878500 -- [-571.945] (-572.221) (-574.222) (-572.783) * [-572.247] (-573.454) (-571.073) (-572.802) -- 0:00:05
      879000 -- (-571.682) (-573.102) [-572.556] (-572.338) * (-572.136) (-573.443) [-572.743] (-573.029) -- 0:00:05
      879500 -- [-573.414] (-577.547) (-573.029) (-572.000) * [-572.637] (-572.314) (-574.992) (-572.085) -- 0:00:05
      880000 -- (-571.218) (-571.698) [-573.739] (-574.422) * [-572.966] (-571.290) (-573.785) (-572.690) -- 0:00:05

      Average standard deviation of split frequencies: 0.017843

      880500 -- (-572.595) [-571.209] (-574.343) (-572.106) * (-572.948) (-572.353) [-572.036] (-573.380) -- 0:00:05
      881000 -- (-572.262) (-576.487) [-573.355] (-572.316) * (-571.649) (-575.544) [-571.963] (-572.780) -- 0:00:05
      881500 -- (-573.138) [-576.425] (-572.029) (-571.709) * (-572.625) [-571.176] (-571.147) (-577.577) -- 0:00:05
      882000 -- (-575.557) (-573.615) (-571.203) [-572.580] * (-576.312) [-571.328] (-574.712) (-571.821) -- 0:00:05
      882500 -- [-571.703] (-572.689) (-572.449) (-572.316) * (-573.540) [-572.050] (-573.464) (-575.794) -- 0:00:05
      883000 -- (-572.545) (-571.571) (-573.698) [-571.628] * (-573.608) (-574.047) [-573.302] (-575.688) -- 0:00:05
      883500 -- (-571.999) (-573.549) [-578.110] (-571.321) * (-573.398) (-571.647) [-572.470] (-574.714) -- 0:00:05
      884000 -- (-572.532) (-574.064) [-571.848] (-574.719) * (-572.997) (-573.221) (-574.864) [-572.424] -- 0:00:05
      884500 -- (-577.022) [-572.355] (-574.009) (-574.721) * [-575.233] (-573.528) (-572.256) (-579.611) -- 0:00:05
      885000 -- (-573.434) (-573.888) [-573.064] (-574.001) * (-575.948) (-572.182) (-575.066) [-573.119] -- 0:00:05

      Average standard deviation of split frequencies: 0.018445

      885500 -- (-571.954) (-575.140) [-573.321] (-573.418) * (-573.252) [-571.782] (-573.141) (-573.279) -- 0:00:05
      886000 -- (-574.389) (-573.198) [-573.652] (-572.352) * (-572.299) (-573.444) [-574.362] (-571.198) -- 0:00:05
      886500 -- (-571.278) (-573.990) (-574.076) [-574.598] * (-570.924) (-573.303) [-573.405] (-575.373) -- 0:00:05
      887000 -- [-571.471] (-573.238) (-574.921) (-583.555) * (-577.985) (-573.235) [-572.293] (-574.175) -- 0:00:05
      887500 -- (-574.015) (-574.458) [-572.892] (-575.048) * (-574.344) (-573.370) (-573.821) [-573.163] -- 0:00:05
      888000 -- (-571.757) (-572.226) [-573.214] (-572.150) * (-574.488) (-572.315) (-574.553) [-574.096] -- 0:00:05
      888500 -- [-577.909] (-574.265) (-573.171) (-571.512) * (-576.348) (-572.115) [-573.512] (-571.886) -- 0:00:05
      889000 -- [-575.445] (-574.307) (-573.004) (-574.623) * (-573.650) (-575.668) [-571.986] (-572.614) -- 0:00:05
      889500 -- [-575.154] (-577.700) (-572.254) (-571.676) * (-577.270) (-574.017) [-572.739] (-576.422) -- 0:00:05
      890000 -- (-572.942) (-575.158) [-571.648] (-575.837) * (-571.284) [-572.695] (-574.557) (-571.696) -- 0:00:05

      Average standard deviation of split frequencies: 0.019054

      890500 -- [-571.706] (-572.987) (-571.425) (-573.433) * [-572.675] (-572.212) (-574.223) (-571.775) -- 0:00:05
      891000 -- (-572.910) (-573.950) (-573.614) [-576.667] * (-576.098) (-577.102) (-571.680) [-573.007] -- 0:00:05
      891500 -- [-572.736] (-575.616) (-571.802) (-571.875) * (-572.083) [-576.139] (-575.632) (-571.818) -- 0:00:04
      892000 -- (-571.509) [-572.579] (-573.837) (-572.043) * [-573.109] (-574.383) (-576.089) (-572.123) -- 0:00:04
      892500 -- [-572.685] (-572.272) (-573.819) (-581.011) * (-572.500) (-573.788) [-572.955] (-573.497) -- 0:00:04
      893000 -- (-575.242) [-571.982] (-574.748) (-573.765) * (-574.528) (-573.370) (-572.714) [-575.437] -- 0:00:04
      893500 -- (-571.843) (-572.736) [-573.215] (-580.175) * (-576.678) (-573.915) [-571.374] (-574.129) -- 0:00:04
      894000 -- (-573.286) (-571.504) (-572.812) [-571.915] * [-574.730] (-571.834) (-574.793) (-571.765) -- 0:00:04
      894500 -- [-573.107] (-578.564) (-576.687) (-572.253) * (-572.075) (-574.313) [-573.625] (-571.737) -- 0:00:04
      895000 -- (-572.155) (-572.372) (-573.811) [-571.239] * (-573.889) (-573.026) [-572.504] (-571.428) -- 0:00:04

      Average standard deviation of split frequencies: 0.018940

      895500 -- (-572.351) (-575.125) (-573.318) [-574.271] * (-576.868) [-571.500] (-579.004) (-572.391) -- 0:00:04
      896000 -- (-572.620) (-573.116) (-573.805) [-572.694] * (-573.318) [-573.815] (-572.403) (-575.272) -- 0:00:04
      896500 -- (-573.873) (-573.213) [-571.257] (-572.048) * (-572.217) (-571.063) [-571.612] (-575.007) -- 0:00:04
      897000 -- [-573.477] (-575.442) (-573.918) (-572.494) * (-571.535) (-575.401) [-571.398] (-575.815) -- 0:00:04
      897500 -- (-574.149) (-573.073) [-571.657] (-575.525) * [-573.831] (-572.420) (-572.732) (-573.551) -- 0:00:04
      898000 -- [-571.641] (-572.944) (-571.081) (-572.629) * (-573.438) (-572.272) (-574.701) [-572.133] -- 0:00:04
      898500 -- [-571.085] (-572.408) (-573.491) (-574.959) * [-572.562] (-575.521) (-572.533) (-572.235) -- 0:00:04
      899000 -- (-572.826) (-571.969) [-574.149] (-573.845) * (-572.302) (-572.046) [-572.572] (-574.122) -- 0:00:04
      899500 -- (-573.377) (-572.304) [-572.608] (-573.813) * [-571.518] (-572.485) (-580.539) (-574.058) -- 0:00:04
      900000 -- (-574.196) (-572.644) (-573.489) [-572.446] * (-571.500) (-574.132) [-573.587] (-575.371) -- 0:00:04

      Average standard deviation of split frequencies: 0.018493

      900500 -- (-572.203) (-573.068) [-573.421] (-572.500) * (-571.459) (-574.012) (-575.997) [-573.874] -- 0:00:04
      901000 -- (-575.352) [-575.003] (-573.485) (-572.937) * (-576.217) (-571.964) (-573.451) [-573.212] -- 0:00:04
      901500 -- (-572.146) [-575.930] (-575.764) (-572.945) * (-576.324) (-571.263) [-573.298] (-575.697) -- 0:00:04
      902000 -- (-571.445) [-573.423] (-574.561) (-575.684) * (-574.794) (-571.266) [-571.938] (-573.016) -- 0:00:04
      902500 -- (-573.211) (-572.308) (-573.637) [-571.879] * [-578.744] (-572.262) (-574.495) (-572.788) -- 0:00:04
      903000 -- (-571.831) [-571.169] (-574.735) (-576.763) * (-573.951) (-572.160) (-573.611) [-572.181] -- 0:00:04
      903500 -- [-571.075] (-572.403) (-574.481) (-573.948) * (-571.938) (-575.310) (-572.715) [-574.450] -- 0:00:04
      904000 -- [-572.076] (-573.058) (-572.494) (-573.375) * (-577.346) [-572.529] (-570.731) (-572.264) -- 0:00:04
      904500 -- (-572.237) [-578.399] (-571.572) (-576.724) * (-572.028) (-572.607) [-573.620] (-571.866) -- 0:00:04
      905000 -- (-572.460) (-574.472) [-574.918] (-571.953) * (-577.079) [-570.830] (-573.585) (-576.512) -- 0:00:04

      Average standard deviation of split frequencies: 0.018038

      905500 -- (-574.674) (-577.008) [-575.196] (-572.327) * (-571.513) [-571.510] (-572.728) (-572.932) -- 0:00:04
      906000 -- (-575.377) (-571.671) [-573.335] (-572.097) * (-572.346) (-573.986) [-573.439] (-573.055) -- 0:00:04
      906500 -- (-574.219) (-571.166) (-571.945) [-574.300] * [-572.818] (-575.213) (-573.025) (-572.412) -- 0:00:04
      907000 -- [-576.578] (-573.265) (-572.542) (-573.138) * (-572.380) (-571.111) (-572.520) [-573.799] -- 0:00:04
      907500 -- (-576.177) (-573.951) [-573.120] (-573.456) * (-573.821) (-572.006) [-574.116] (-574.158) -- 0:00:04
      908000 -- (-571.750) (-579.893) [-571.847] (-577.332) * (-574.682) (-572.072) [-574.689] (-574.117) -- 0:00:04
      908500 -- (-572.854) (-576.727) [-572.459] (-571.686) * [-571.317] (-572.603) (-572.227) (-573.631) -- 0:00:04
      909000 -- (-572.291) [-571.072] (-571.148) (-571.106) * (-571.127) (-577.341) (-571.451) [-571.566] -- 0:00:04
      909500 -- (-572.381) [-573.664] (-571.126) (-574.822) * (-573.026) [-575.517] (-577.352) (-573.839) -- 0:00:04
      910000 -- (-578.651) [-573.011] (-571.044) (-570.882) * (-574.395) (-572.059) [-572.954] (-571.770) -- 0:00:04

      Average standard deviation of split frequencies: 0.016910

      910500 -- (-573.801) (-571.940) [-574.806] (-575.490) * (-575.527) (-574.277) (-573.260) [-573.668] -- 0:00:04
      911000 -- [-572.377] (-572.910) (-577.103) (-575.557) * (-576.117) [-575.373] (-575.000) (-573.370) -- 0:00:04
      911500 -- [-574.238] (-573.707) (-572.639) (-573.998) * (-571.012) (-575.491) [-574.161] (-571.668) -- 0:00:04
      912000 -- [-571.699] (-571.837) (-573.404) (-574.836) * (-572.448) [-573.190] (-572.422) (-571.218) -- 0:00:04
      912500 -- (-572.926) (-572.231) (-571.774) [-573.586] * [-575.074] (-572.316) (-573.449) (-571.850) -- 0:00:04
      913000 -- (-572.732) (-572.173) [-571.440] (-579.880) * (-571.103) (-576.326) (-573.262) [-572.421] -- 0:00:04
      913500 -- (-572.447) (-572.227) [-574.357] (-575.148) * (-571.016) [-575.680] (-575.415) (-578.396) -- 0:00:03
      914000 -- (-573.404) (-572.823) (-572.559) [-575.729] * (-571.601) (-570.999) (-573.144) [-580.889] -- 0:00:03
      914500 -- (-574.211) [-572.446] (-575.108) (-574.478) * (-573.829) (-572.976) [-574.031] (-576.362) -- 0:00:03
      915000 -- (-572.757) (-571.601) (-573.510) [-576.513] * (-577.308) (-574.649) [-574.922] (-572.818) -- 0:00:03

      Average standard deviation of split frequencies: 0.016125

      915500 -- (-573.035) (-572.813) [-575.310] (-582.643) * (-571.702) [-572.456] (-573.051) (-572.338) -- 0:00:03
      916000 -- [-575.598] (-573.936) (-574.437) (-572.748) * [-572.156] (-572.188) (-573.883) (-571.092) -- 0:00:03
      916500 -- (-572.310) (-578.022) (-573.349) [-575.624] * (-573.451) (-572.380) (-572.131) [-572.926] -- 0:00:03
      917000 -- (-573.971) (-572.760) (-572.273) [-574.134] * (-571.218) (-572.602) [-572.138] (-580.346) -- 0:00:03
      917500 -- (-571.608) (-571.593) (-574.754) [-573.271] * (-572.175) [-572.299] (-574.797) (-576.663) -- 0:00:03
      918000 -- (-572.716) (-570.765) [-573.505] (-574.952) * (-574.504) (-573.223) (-572.533) [-575.623] -- 0:00:03
      918500 -- (-573.258) [-573.535] (-574.760) (-575.416) * (-573.372) (-574.741) [-574.031] (-576.355) -- 0:00:03
      919000 -- [-572.217] (-572.170) (-572.719) (-575.095) * (-571.859) (-574.033) [-574.571] (-577.987) -- 0:00:03
      919500 -- (-572.069) (-572.243) (-572.670) [-575.044] * (-572.008) [-571.538] (-581.646) (-573.556) -- 0:00:03
      920000 -- [-574.246] (-572.231) (-578.517) (-570.935) * (-571.762) (-572.334) (-573.919) [-575.109] -- 0:00:03

      Average standard deviation of split frequencies: 0.016385

      920500 -- (-579.196) [-576.128] (-572.040) (-572.944) * [-573.335] (-575.721) (-573.700) (-573.178) -- 0:00:03
      921000 -- (-574.050) [-578.780] (-573.096) (-572.119) * (-572.838) (-575.307) (-573.267) [-571.980] -- 0:00:03
      921500 -- (-579.755) [-578.041] (-572.332) (-575.548) * (-574.049) (-576.633) [-574.626] (-574.656) -- 0:00:03
      922000 -- [-573.577] (-574.300) (-577.020) (-572.526) * (-571.410) [-572.083] (-573.693) (-575.334) -- 0:00:03
      922500 -- (-577.695) [-571.631] (-573.382) (-574.754) * [-571.484] (-571.874) (-576.851) (-571.989) -- 0:00:03
      923000 -- (-572.676) [-572.789] (-571.928) (-576.167) * [-572.257] (-573.611) (-570.952) (-571.603) -- 0:00:03
      923500 -- (-573.829) [-572.228] (-572.398) (-574.544) * (-573.594) (-572.634) (-571.708) [-573.863] -- 0:00:03
      924000 -- (-573.662) (-574.151) (-576.432) [-573.689] * [-574.041] (-572.037) (-571.935) (-573.853) -- 0:00:03
      924500 -- (-575.489) (-575.485) [-573.372] (-577.545) * (-576.612) (-574.803) (-571.783) [-571.466] -- 0:00:03
      925000 -- (-573.411) [-572.976] (-574.648) (-574.012) * (-571.272) (-573.120) [-574.371] (-572.442) -- 0:00:03

      Average standard deviation of split frequencies: 0.014933

      925500 -- (-571.924) (-574.913) (-574.221) [-571.615] * (-574.461) (-573.681) [-575.303] (-572.759) -- 0:00:03
      926000 -- (-571.857) (-577.203) [-574.207] (-573.475) * (-572.128) (-572.301) [-575.182] (-575.511) -- 0:00:03
      926500 -- [-573.391] (-575.907) (-576.854) (-572.188) * (-571.809) [-571.922] (-574.602) (-574.434) -- 0:00:03
      927000 -- (-572.781) (-571.475) [-572.236] (-571.526) * [-572.270] (-571.462) (-574.027) (-574.140) -- 0:00:03
      927500 -- (-573.080) [-571.499] (-574.095) (-571.460) * (-573.784) (-572.337) [-571.732] (-572.501) -- 0:00:03
      928000 -- (-574.563) [-575.076] (-571.246) (-571.455) * [-576.015] (-574.386) (-573.434) (-575.994) -- 0:00:03
      928500 -- (-573.874) [-573.863] (-573.500) (-572.905) * (-575.713) (-573.752) [-573.765] (-574.381) -- 0:00:03
      929000 -- (-571.933) (-573.935) [-571.325] (-573.625) * (-576.666) (-574.370) (-571.388) [-572.067] -- 0:00:03
      929500 -- (-573.637) [-573.684] (-572.992) (-575.412) * (-571.723) (-571.104) (-571.381) [-571.348] -- 0:00:03
      930000 -- (-571.582) (-572.948) [-571.587] (-573.646) * (-571.574) [-571.379] (-572.774) (-572.452) -- 0:00:03

      Average standard deviation of split frequencies: 0.014183

      930500 -- [-571.212] (-576.270) (-573.426) (-574.687) * [-578.671] (-575.145) (-575.650) (-572.378) -- 0:00:03
      931000 -- (-574.125) (-574.853) (-573.285) [-571.881] * (-575.195) (-572.103) [-572.428] (-571.991) -- 0:00:03
      931500 -- (-571.733) (-572.347) [-574.403] (-572.416) * (-585.305) (-571.444) (-574.537) [-572.033] -- 0:00:03
      932000 -- (-573.734) [-573.961] (-573.076) (-572.989) * (-575.498) (-572.145) (-575.336) [-575.253] -- 0:00:03
      932500 -- (-572.893) (-572.338) (-572.202) [-571.814] * (-572.681) (-571.373) [-572.688] (-573.245) -- 0:00:03
      933000 -- (-574.134) [-572.076] (-573.327) (-571.918) * (-572.595) (-576.990) (-572.110) [-575.104] -- 0:00:03
      933500 -- (-574.870) (-571.695) [-572.453] (-574.088) * (-574.723) (-572.420) [-577.992] (-579.371) -- 0:00:03
      934000 -- (-572.281) (-572.951) [-571.638] (-574.153) * [-574.360] (-571.660) (-578.016) (-572.340) -- 0:00:03
      934500 -- (-578.492) (-575.348) (-572.067) [-573.563] * (-574.389) (-571.215) (-573.183) [-572.310] -- 0:00:03
      935000 -- (-578.281) [-573.544] (-573.314) (-573.524) * (-574.328) [-571.275] (-575.453) (-571.957) -- 0:00:02

      Average standard deviation of split frequencies: 0.013766

      935500 -- (-579.031) [-571.291] (-572.610) (-574.249) * (-572.507) [-574.411] (-575.126) (-572.436) -- 0:00:02
      936000 -- [-572.261] (-571.522) (-571.418) (-578.139) * [-572.367] (-573.118) (-575.023) (-571.930) -- 0:00:02
      936500 -- (-577.950) [-573.380] (-572.529) (-571.809) * (-571.240) (-574.223) [-572.424] (-571.549) -- 0:00:02
      937000 -- [-571.761] (-574.248) (-574.627) (-575.959) * [-575.600] (-576.132) (-571.992) (-574.288) -- 0:00:02
      937500 -- (-572.730) (-571.789) [-573.306] (-572.678) * [-577.177] (-572.274) (-571.760) (-571.841) -- 0:00:02
      938000 -- (-571.209) (-573.882) (-573.014) [-574.190] * (-574.123) (-572.810) (-573.547) [-571.276] -- 0:00:02
      938500 -- (-576.630) (-572.294) [-571.669] (-573.868) * (-575.516) (-574.594) [-572.458] (-572.388) -- 0:00:02
      939000 -- (-574.427) (-573.067) (-575.175) [-573.250] * (-573.706) (-572.151) [-577.700] (-572.850) -- 0:00:02
      939500 -- (-573.459) (-577.620) [-574.351] (-572.393) * [-576.539] (-571.380) (-571.832) (-574.548) -- 0:00:02
      940000 -- (-574.072) [-574.811] (-574.447) (-572.397) * (-577.504) [-573.242] (-571.497) (-573.308) -- 0:00:02

      Average standard deviation of split frequencies: 0.014032

      940500 -- (-573.311) [-572.234] (-572.664) (-575.090) * (-573.418) (-571.158) (-573.374) [-572.127] -- 0:00:02
      941000 -- (-573.434) [-573.098] (-571.065) (-575.635) * (-579.456) (-575.643) (-573.362) [-575.814] -- 0:00:02
      941500 -- (-571.935) (-571.975) [-571.596] (-575.278) * [-572.469] (-574.508) (-572.597) (-575.214) -- 0:00:02
      942000 -- (-573.751) (-574.202) (-573.791) [-574.246] * (-573.635) (-573.083) [-574.227] (-574.520) -- 0:00:02
      942500 -- (-572.105) (-571.379) (-572.600) [-572.401] * (-576.139) [-577.590] (-571.986) (-573.489) -- 0:00:02
      943000 -- (-572.212) (-572.695) [-572.426] (-571.532) * (-573.520) (-575.226) (-572.963) [-574.839] -- 0:00:02
      943500 -- (-573.929) [-574.459] (-572.142) (-575.296) * (-573.171) [-572.724] (-571.197) (-572.764) -- 0:00:02
      944000 -- [-571.170] (-571.465) (-576.337) (-572.507) * (-573.589) (-575.116) (-573.677) [-571.055] -- 0:00:02
      944500 -- (-571.925) (-571.057) (-574.276) [-571.322] * (-574.842) (-574.146) [-572.677] (-571.963) -- 0:00:02
      945000 -- (-575.972) [-574.809] (-574.267) (-573.564) * (-572.524) (-573.741) [-571.962] (-572.728) -- 0:00:02

      Average standard deviation of split frequencies: 0.014285

      945500 -- [-573.168] (-574.253) (-575.634) (-572.512) * [-571.848] (-573.993) (-573.296) (-572.426) -- 0:00:02
      946000 -- [-571.750] (-574.305) (-574.747) (-574.312) * (-572.829) (-572.598) (-574.047) [-571.910] -- 0:00:02
      946500 -- (-574.139) (-573.857) [-573.912] (-572.595) * (-573.734) (-572.429) [-571.809] (-573.277) -- 0:00:02
      947000 -- (-572.096) (-572.701) (-574.315) [-574.105] * (-573.044) (-583.879) (-571.043) [-574.675] -- 0:00:02
      947500 -- (-572.741) [-572.629] (-572.372) (-575.292) * [-574.041] (-578.699) (-571.100) (-574.794) -- 0:00:02
      948000 -- (-571.846) (-575.938) (-572.893) [-573.287] * (-574.301) (-571.562) (-575.035) [-571.769] -- 0:00:02
      948500 -- [-572.028] (-572.513) (-572.739) (-571.599) * (-575.655) (-576.215) [-573.736] (-571.937) -- 0:00:02
      949000 -- (-573.162) (-572.744) (-572.372) [-573.662] * (-573.496) (-571.857) [-572.338] (-575.051) -- 0:00:02
      949500 -- (-573.478) [-572.598] (-573.944) (-577.459) * (-574.089) (-572.921) [-572.925] (-574.059) -- 0:00:02
      950000 -- [-573.325] (-571.225) (-573.998) (-577.068) * [-573.062] (-572.336) (-573.294) (-572.363) -- 0:00:02

      Average standard deviation of split frequencies: 0.013223

      950500 -- (-572.761) (-572.631) [-573.598] (-575.082) * (-573.567) (-573.211) [-572.653] (-574.444) -- 0:00:02
      951000 -- [-572.943] (-575.972) (-571.100) (-573.518) * (-572.749) [-574.131] (-573.371) (-575.781) -- 0:00:02
      951500 -- (-572.452) (-577.109) (-572.771) [-572.694] * (-574.849) [-571.107] (-573.798) (-575.038) -- 0:00:02
      952000 -- (-572.258) [-572.897] (-572.832) (-574.097) * (-573.330) [-571.167] (-573.939) (-574.901) -- 0:00:02
      952500 -- (-572.116) (-573.522) (-574.253) [-571.860] * (-573.742) (-572.242) (-572.419) [-576.740] -- 0:00:02
      953000 -- (-572.111) [-571.748] (-573.542) (-572.608) * (-576.689) (-576.535) [-573.008] (-572.447) -- 0:00:02
      953500 -- (-572.227) [-571.462] (-574.494) (-572.868) * [-571.770] (-573.431) (-573.198) (-579.477) -- 0:00:02
      954000 -- (-575.156) (-571.930) [-571.562] (-576.705) * (-573.725) (-572.003) [-572.131] (-572.200) -- 0:00:02
      954500 -- (-577.305) (-575.480) [-572.982] (-576.118) * (-574.801) (-572.745) (-572.995) [-571.735] -- 0:00:02
      955000 -- (-575.501) (-574.964) [-572.240] (-573.871) * (-571.629) [-572.118] (-571.714) (-571.695) -- 0:00:02

      Average standard deviation of split frequencies: 0.012821

      955500 -- (-575.812) (-576.573) (-573.433) [-572.816] * (-571.685) (-576.161) [-572.076] (-571.038) -- 0:00:02
      956000 -- [-576.929] (-571.739) (-574.869) (-573.462) * [-572.389] (-572.279) (-573.912) (-571.612) -- 0:00:02
      956500 -- (-572.228) (-572.840) [-572.083] (-572.558) * (-573.449) (-571.207) (-571.994) [-572.156] -- 0:00:02
      957000 -- (-576.093) (-571.221) [-573.032] (-572.220) * [-572.374] (-573.758) (-572.150) (-574.679) -- 0:00:01
      957500 -- (-571.498) (-572.156) (-574.891) [-571.479] * [-572.963] (-572.048) (-576.837) (-573.396) -- 0:00:01
      958000 -- (-572.357) [-571.667] (-577.024) (-571.097) * (-571.658) (-572.154) [-572.792] (-572.241) -- 0:00:01
      958500 -- (-571.421) (-574.173) [-577.871] (-573.383) * [-571.975] (-574.569) (-571.832) (-573.411) -- 0:00:01
      959000 -- [-571.929] (-571.872) (-574.201) (-572.100) * (-574.995) (-574.862) (-574.399) [-572.720] -- 0:00:01
      959500 -- (-572.070) (-572.355) (-572.979) [-573.660] * (-571.877) [-571.737] (-577.594) (-577.367) -- 0:00:01
      960000 -- (-571.391) (-576.858) (-575.079) [-571.896] * (-571.248) [-570.943] (-572.732) (-572.765) -- 0:00:01

      Average standard deviation of split frequencies: 0.012431

      960500 -- (-572.615) [-578.457] (-574.692) (-573.021) * [-571.830] (-574.154) (-574.021) (-572.275) -- 0:00:01
      961000 -- (-572.301) [-572.889] (-573.803) (-576.509) * (-573.520) (-574.766) [-571.012] (-571.758) -- 0:00:01
      961500 -- (-571.367) (-573.675) [-572.809] (-574.933) * (-573.965) (-575.503) [-571.304] (-573.321) -- 0:00:01
      962000 -- (-572.113) (-574.179) (-575.957) [-572.400] * (-573.657) (-572.954) [-571.691] (-573.909) -- 0:00:01
      962500 -- (-573.317) [-571.351] (-573.787) (-574.312) * (-573.123) (-573.396) (-571.452) [-575.025] -- 0:00:01
      963000 -- (-572.663) (-574.651) [-572.628] (-571.973) * (-574.859) (-574.966) (-571.374) [-575.874] -- 0:00:01
      963500 -- (-575.829) (-573.668) [-572.903] (-573.863) * (-570.957) [-572.179] (-572.406) (-573.124) -- 0:00:01
      964000 -- (-573.358) [-573.220] (-576.554) (-574.928) * (-571.341) (-570.841) [-577.809] (-573.222) -- 0:00:01
      964500 -- (-571.714) (-574.072) (-574.867) [-574.732] * (-572.143) (-574.278) (-577.226) [-576.698] -- 0:00:01
      965000 -- [-573.903] (-577.486) (-575.119) (-576.450) * (-572.301) [-573.715] (-573.984) (-572.509) -- 0:00:01

      Average standard deviation of split frequencies: 0.013339

      965500 -- [-572.234] (-571.879) (-573.908) (-573.817) * (-573.378) (-574.821) (-576.303) [-576.019] -- 0:00:01
      966000 -- (-571.574) (-573.520) [-572.186] (-576.242) * [-571.318] (-577.709) (-573.586) (-571.911) -- 0:00:01
      966500 -- (-573.767) [-571.373] (-571.668) (-572.310) * (-573.656) (-573.348) [-573.434] (-575.144) -- 0:00:01
      967000 -- (-575.717) (-574.980) (-572.255) [-572.182] * (-573.647) (-571.959) (-571.819) [-574.688] -- 0:00:01
      967500 -- [-572.535] (-572.677) (-573.051) (-573.556) * (-574.834) [-571.954] (-573.902) (-571.615) -- 0:00:01
      968000 -- (-576.656) [-572.241] (-575.343) (-574.251) * [-572.105] (-576.373) (-573.630) (-573.355) -- 0:00:01
      968500 -- (-571.944) (-573.740) [-572.455] (-576.494) * [-571.804] (-574.157) (-573.216) (-579.086) -- 0:00:01
      969000 -- (-572.270) [-570.907] (-572.842) (-576.052) * (-572.628) [-574.962] (-570.960) (-577.285) -- 0:00:01
      969500 -- (-571.772) [-573.532] (-574.681) (-576.191) * [-574.074] (-571.633) (-571.448) (-572.648) -- 0:00:01
      970000 -- [-571.250] (-573.533) (-575.995) (-579.144) * (-571.477) [-573.324] (-572.875) (-571.859) -- 0:00:01

      Average standard deviation of split frequencies: 0.012951

      970500 -- (-572.774) [-571.570] (-571.952) (-573.430) * [-573.908] (-574.101) (-571.503) (-579.838) -- 0:00:01
      971000 -- (-573.322) (-577.549) (-576.031) [-573.162] * (-573.456) (-575.070) (-577.694) [-573.196] -- 0:00:01
      971500 -- (-574.038) [-570.994] (-572.820) (-575.098) * (-576.643) (-572.103) [-571.362] (-572.487) -- 0:00:01
      972000 -- (-573.393) [-571.498] (-574.128) (-572.578) * (-575.914) (-573.147) [-572.835] (-571.927) -- 0:00:01
      972500 -- (-576.634) [-571.856] (-572.956) (-573.036) * [-572.388] (-572.753) (-576.151) (-574.399) -- 0:00:01
      973000 -- (-573.142) [-572.234] (-573.599) (-578.369) * (-572.629) (-573.270) (-572.741) [-571.812] -- 0:00:01
      973500 -- (-575.823) (-571.611) [-573.341] (-571.366) * (-574.536) (-571.633) (-571.032) [-574.126] -- 0:00:01
      974000 -- (-580.644) (-575.762) [-571.807] (-571.361) * (-577.599) [-571.482] (-577.580) (-573.813) -- 0:00:01
      974500 -- (-572.638) (-574.083) [-572.689] (-573.738) * (-574.950) (-572.549) (-574.480) [-571.474] -- 0:00:01
      975000 -- (-572.377) [-571.909] (-573.636) (-573.827) * [-573.625] (-572.083) (-572.831) (-572.084) -- 0:00:01

      Average standard deviation of split frequencies: 0.013202

      975500 -- (-581.111) (-574.551) (-572.987) [-573.968] * [-570.993] (-580.436) (-571.544) (-572.160) -- 0:00:01
      976000 -- (-575.370) [-573.191] (-573.726) (-573.323) * [-571.015] (-582.475) (-572.116) (-573.953) -- 0:00:01
      976500 -- (-574.464) (-571.573) [-574.213] (-573.106) * (-571.140) (-576.750) (-570.970) [-574.030] -- 0:00:01
      977000 -- [-573.147] (-572.938) (-572.040) (-578.414) * [-572.304] (-571.891) (-573.212) (-573.772) -- 0:00:01
      977500 -- (-573.020) (-571.124) [-571.147] (-574.071) * (-571.563) (-575.540) [-571.808] (-574.320) -- 0:00:01
      978000 -- (-573.836) (-571.634) [-571.103] (-576.043) * (-573.072) (-574.479) (-573.484) [-572.692] -- 0:00:01
      978500 -- (-574.125) (-572.789) [-572.710] (-575.246) * (-572.265) [-573.705] (-571.521) (-573.816) -- 0:00:00
      979000 -- [-572.640] (-573.954) (-575.650) (-573.083) * (-571.577) (-574.925) [-578.189] (-572.130) -- 0:00:00
      979500 -- (-572.816) (-578.405) (-572.772) [-571.718] * [-572.685] (-571.603) (-574.611) (-572.229) -- 0:00:00
      980000 -- (-576.527) (-574.597) [-572.008] (-572.851) * (-573.418) (-572.381) (-576.667) [-574.329] -- 0:00:00

      Average standard deviation of split frequencies: 0.013780

      980500 -- [-571.099] (-574.799) (-571.666) (-577.607) * (-574.153) (-571.669) [-575.616] (-572.540) -- 0:00:00
      981000 -- [-574.897] (-573.067) (-572.479) (-571.579) * [-572.911] (-573.063) (-574.134) (-575.414) -- 0:00:00
      981500 -- (-572.585) (-572.311) [-575.094] (-573.319) * (-573.221) [-574.344] (-573.244) (-575.325) -- 0:00:00
      982000 -- (-572.499) [-572.300] (-573.801) (-572.829) * (-574.377) [-573.457] (-574.313) (-573.888) -- 0:00:00
      982500 -- [-571.284] (-572.216) (-572.128) (-574.610) * [-574.171] (-573.740) (-573.780) (-572.433) -- 0:00:00
      983000 -- (-573.351) [-572.197] (-576.129) (-575.206) * (-575.462) (-575.117) [-572.399] (-572.791) -- 0:00:00
      983500 -- (-573.099) [-571.654] (-574.332) (-571.416) * (-573.440) (-578.338) [-572.962] (-572.262) -- 0:00:00
      984000 -- (-572.278) (-571.253) (-577.173) [-573.525] * [-572.619] (-573.912) (-573.074) (-573.016) -- 0:00:00
      984500 -- (-572.149) (-573.169) [-574.797] (-575.730) * [-571.613] (-573.731) (-571.886) (-574.678) -- 0:00:00
      985000 -- (-572.205) (-571.917) [-572.833] (-575.259) * (-571.894) (-574.929) [-571.463] (-572.599) -- 0:00:00

      Average standard deviation of split frequencies: 0.013387

      985500 -- [-574.602] (-575.584) (-573.418) (-572.992) * (-572.662) (-572.457) [-575.370] (-576.924) -- 0:00:00
      986000 -- (-574.293) (-576.310) [-572.250] (-576.194) * (-574.843) (-574.640) (-571.748) [-573.552] -- 0:00:00
      986500 -- [-577.706] (-571.664) (-573.995) (-571.363) * (-573.848) (-571.682) [-574.271] (-571.974) -- 0:00:00
      987000 -- [-573.670] (-572.634) (-572.881) (-572.797) * (-572.529) (-576.867) (-573.530) [-572.574] -- 0:00:00
      987500 -- (-571.274) (-572.553) [-572.045] (-574.319) * (-572.182) (-573.533) [-573.388] (-572.980) -- 0:00:00
      988000 -- [-572.147] (-575.397) (-573.218) (-574.199) * [-572.038] (-575.181) (-574.036) (-572.681) -- 0:00:00
      988500 -- [-573.205] (-578.716) (-571.484) (-574.952) * (-571.623) [-571.931] (-575.584) (-572.311) -- 0:00:00
      989000 -- (-572.298) (-573.298) (-571.570) [-572.923] * (-572.202) (-571.976) (-572.654) [-575.287] -- 0:00:00
      989500 -- [-572.766] (-576.489) (-571.429) (-571.049) * (-572.370) (-572.166) [-572.132] (-575.033) -- 0:00:00
      990000 -- (-572.314) (-574.123) (-573.259) [-572.490] * (-571.837) (-571.900) [-571.222] (-572.279) -- 0:00:00

      Average standard deviation of split frequencies: 0.014910

      990500 -- (-574.270) (-571.958) (-572.766) [-573.236] * [-571.779] (-571.094) (-571.472) (-571.744) -- 0:00:00
      991000 -- (-573.989) (-572.417) [-572.086] (-573.467) * (-573.308) (-575.169) [-575.973] (-573.605) -- 0:00:00
      991500 -- (-573.667) (-572.146) [-572.223] (-572.347) * (-573.365) (-576.973) (-576.626) [-571.553] -- 0:00:00
      992000 -- (-573.976) [-572.716] (-573.223) (-574.888) * (-573.334) (-574.029) (-577.056) [-574.062] -- 0:00:00
      992500 -- (-578.045) (-574.611) [-573.134] (-571.443) * (-573.558) (-574.607) (-572.932) [-573.927] -- 0:00:00
      993000 -- (-578.615) (-573.964) (-576.464) [-572.520] * (-571.831) (-578.610) (-573.094) [-574.054] -- 0:00:00
      993500 -- (-575.862) (-571.664) (-574.287) [-573.493] * (-571.414) (-575.076) (-576.343) [-571.466] -- 0:00:00
      994000 -- (-574.593) [-570.986] (-575.487) (-573.601) * (-573.678) (-577.489) [-571.857] (-572.850) -- 0:00:00
      994500 -- [-572.929] (-573.144) (-573.160) (-573.445) * (-573.474) [-574.717] (-573.786) (-572.738) -- 0:00:00
      995000 -- [-573.016] (-574.526) (-575.168) (-571.556) * [-571.643] (-575.270) (-573.303) (-577.602) -- 0:00:00

      Average standard deviation of split frequencies: 0.013568

      995500 -- (-577.971) [-571.446] (-574.005) (-572.977) * (-573.545) (-573.802) [-571.413] (-572.464) -- 0:00:00
      996000 -- (-576.227) (-573.245) (-573.248) [-571.891] * (-572.363) (-573.894) (-571.876) [-574.876] -- 0:00:00
      996500 -- (-571.808) (-573.910) [-572.139] (-574.939) * (-574.290) [-573.398] (-572.845) (-573.692) -- 0:00:00
      997000 -- [-571.781] (-572.039) (-571.607) (-571.609) * [-573.945] (-572.087) (-573.306) (-572.596) -- 0:00:00
      997500 -- (-576.999) (-574.845) (-573.678) [-573.702] * (-575.615) (-577.888) (-575.057) [-571.504] -- 0:00:00
      998000 -- (-573.890) (-576.405) [-572.241] (-574.889) * (-574.900) (-574.848) (-573.956) [-572.999] -- 0:00:00
      998500 -- [-573.221] (-573.386) (-576.288) (-572.827) * (-572.865) (-572.675) (-577.658) [-574.371] -- 0:00:00
      999000 -- [-571.245] (-577.469) (-572.092) (-572.452) * (-572.550) (-573.507) (-573.296) [-573.109] -- 0:00:00
      999500 -- [-571.778] (-573.765) (-576.579) (-574.473) * (-571.614) (-573.465) [-572.359] (-575.249) -- 0:00:00
      1000000 -- (-571.567) [-572.143] (-573.455) (-571.643) * [-572.084] (-572.457) (-574.092) (-573.733) -- 0:00:00

      Average standard deviation of split frequencies: 0.013191

      Analysis completed in 46 seconds
      Analysis used 44.78 seconds of CPU time
      Likelihood of best state for "cold" chain of run 1 was -570.65
      Likelihood of best state for "cold" chain of run 2 was -570.65

      Acceptance rates for the moves in the "cold" chain of run 1:
         With prob.   (last 100)   chain accepted proposals by move
            72.6 %     ( 68 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            32.4 %     ( 30 %)     Dirichlet(Pi{all})
            32.6 %     ( 26 %)     Slider(Pi{all})
            71.0 %     ( 39 %)     Multiplier(Alpha{1,2})
            70.0 %     ( 28 %)     Multiplier(Alpha{3})
            26.9 %     ( 29 %)     Slider(Pinvar{all})
            99.9 %     (100 %)     NNI(Tau{all},V{all})
            73.6 %     ( 79 %)     ParsSPR(Tau{all},V{all})
            27.5 %     ( 20 %)     Multiplier(V{all})
            97.5 %     ( 97 %)     Nodeslider(V{all})
            31.9 %     ( 33 %)     TLMultiplier(V{all})

      Acceptance rates for the moves in the "cold" chain of run 2:
         With prob.   (last 100)   chain accepted proposals by move
            73.4 %     ( 77 %)     Dirichlet(Revmat{all})
            99.9 %     (100 %)     Slider(Revmat{all})
            32.4 %     ( 21 %)     Dirichlet(Pi{all})
            32.2 %     ( 30 %)     Slider(Pi{all})
            71.3 %     ( 37 %)     Multiplier(Alpha{1,2})
            70.5 %     ( 29 %)     Multiplier(Alpha{3})
            24.9 %     ( 33 %)     Slider(Pinvar{all})
            99.9 %     (100 %)     NNI(Tau{all},V{all})
            73.5 %     ( 72 %)     ParsSPR(Tau{all},V{all})
            27.6 %     ( 23 %)     Multiplier(V{all})
            97.4 %     ( 99 %)     Nodeslider(V{all})
            31.5 %     ( 24 %)     TLMultiplier(V{all})

      Chain swap information for run 1:

                   1       2       3       4 
           ----------------------------------
         1 |            0.84    0.69    0.57 
         2 |  166718            0.85    0.72 
         3 |  166195  166801            0.86 
         4 |  166772  166819  166695         

      Chain swap information for run 2:

                   1       2       3       4 
           ----------------------------------
         1 |            0.84    0.70    0.57 
         2 |  167371            0.85    0.72 
         3 |  165902  167135            0.86 
         4 |  166834  166517  166241         

      Upper diagonal: Proportion of successful state exchanges between chains
      Lower diagonal: Number of attempted state exchanges between chains

      Chain information:

        ID -- Heat 
       -----------
         1 -- 1.00  (cold chain)
         2 -- 0.91 
         3 -- 0.83 
         4 -- 0.77 

      Heat = 1 / (1 + T * (ID - 1))
         (where T = 0.10 is the temperature and ID is the chain number)

      Setting burn-in to 2500
      Summarizing parameters in files /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
      Writing summary statistics to file /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
      Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples

      Below are rough plots of the generation (x-axis) versus the log   
      probability of observing the data (y-axis). You can use these     
      graphs to determine what the burn in for your analysis should be. 
      When the log probability starts to plateau you may be at station- 
      arity. Sample trees and parameters after the log probability      
      plateaus. Of course, this is not a guarantee that you are at sta- 
      tionarity. Also examine the convergence diagnostics provided by   
      the 'sump' and 'sumt' commands for all the parameters in your     
      model. Remember that the burn in is the number of samples to dis- 
      card. There are a total of ngen / samplefreq samples taken during 
      a MCMC analysis.                                                  

      Overlay plot for both runs:
      (1 = Run number 1; 2 = Run number 2; * = Both runs)

      +------------------------------------------------------------+ -572.30
      |                                                        21  |
      |     1             1                          1            1|
      |                                 1           2  * 2   1     |
      |    2   2 1     2      2                  2                 |
      |  2                 2 2 2   11 1   2    1  21               |
      |2  *1 221   * 22 1     11  * 2 2     * 1     1     *   11 12|
      |  1  2       2   21  21         2 21  *  2 1                |
      |12    1  2   11          11   2   1 1   2     21 1        2 |
      | 1     1 1      1 22 1      2 1        2         21 2       |
      |           *   1    1    22      2       1          1  2 2  |
      |                                    2       2        22     |
      |                                1                           |
      |                                               2            |
      |          2                                                 |
      |                                          1          1      |
      +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -574.27
      ^                                                            ^
      250000                                                       1000000


      Estimated marginal likelihoods for runs sampled in files
         "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         (Use the harmonic mean for Bayes factor comparisons of models)

         (Values are saved to the file /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

      Run   Arithmetic mean   Harmonic mean
      --------------------------------------
        1       -572.35          -577.99
        2       -572.40          -576.44
      --------------------------------------
      TOTAL     -572.38          -577.49
      --------------------------------------


      Model parameter summaries over the runs sampled in files
         "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
         Summaries are based on a total of 3002 samples from 2 runs.
         Each run produced 2001 samples of which 1501 samples were included.
         Parameter summaries saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

                                                95% HPD Interval
                                              --------------------
      Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+ 
      ------------------------------------------------------------------------------------------------------
      TL{all}         0.500358    0.052995    0.101083    0.939600    0.464469   1323.41   1374.87    1.001
      r(A<->C){all}   0.171380    0.021580    0.000314    0.464049    0.131056    211.28    322.36    1.000
      r(A<->G){all}   0.168695    0.019535    0.000047    0.446833    0.134341    405.36    444.87    1.000
      r(A<->T){all}   0.165111    0.021227    0.000046    0.457472    0.120420    256.89    263.98    1.000
      r(C<->G){all}   0.156776    0.018980    0.000022    0.445604    0.118673    308.32    358.82    1.000
      r(C<->T){all}   0.164102    0.018621    0.000081    0.440362    0.129142    320.91    334.69    1.000
      r(G<->T){all}   0.173937    0.021991    0.000153    0.476540    0.135229    225.51    283.30    1.000
      pi(A){all}      0.221622    0.000400    0.182973    0.259115    0.221046   1241.55   1338.82    1.001
      pi(C){all}      0.335744    0.000515    0.291515    0.379624    0.335665   1073.45   1287.23    1.000
      pi(G){all}      0.266044    0.000470    0.223316    0.308852    0.265816   1449.98   1475.49    1.000
      pi(T){all}      0.176590    0.000345    0.141115    0.212391    0.176358   1306.76   1378.30    1.000
      alpha{1,2}      0.402452    0.221782    0.000328    1.344947    0.233305   1103.49   1159.58    1.000
      alpha{3}        0.455662    0.246486    0.000261    1.439950    0.287867   1317.27   1402.50    1.000
      pinvar{all}     0.995925    0.000026    0.986550    0.999999    0.997590   1144.47   1183.45    1.000
      ------------------------------------------------------------------------------------------------------
      * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
        correspond to minimal and average ESS among runs. 
        ESS value below 100 may indicate that the parameter is undersampled. 
      + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
        and Rubin, 1992) should approach 1.0 as runs converge.


   Setting sumt conformat to Simple
   Setting urn-in to 2500
   Summarizing trees in files "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
   Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
   Writing statistics to files /data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
   Examining first file ...
   Found one tree block in file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
   Expecting the same number of trees in the last tree block of all files

   Tree reading status:

   0      10      20      30      40      50      60      70      80      90     100
   v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
   *********************************************************************************

   Read a total of 4002 trees in 2 files (sampling 3002 of them)
      (Each file contained 2001 trees of which 1501 were sampled)
                                                                                   
   General explanation:                                                          
                                                                                   
   In an unrooted tree, a taxon bipartition (split) is specified by removing a   
   branch, thereby dividing the species into those to the left and those to the  
   right of the branch. Here, taxa to one side of the removed branch are denoted 
   '.' and those to the other side are denoted '*'. Specifically, the '.' symbol 
   is used for the taxa on the same side as the outgroup.                        
                                                                                   
   In a rooted or clock tree, the tree is rooted using the model and not by      
   reference to an outgroup. Each bipartition therefore corresponds to a clade,  
   that is, a group that includes all the descendants of a particular branch in  
   the tree.  Taxa that are included in each clade are denoted using '*', and    
   taxa that are not included are denoted using the '.' symbol.                  
                                                                                   
   The output first includes a key to all the bipartitions with frequency larger 
   or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to 
   sumt command and currently it is set to 0.10.  This is followed by a table  
   with statistics for the informative bipartitions (those including at least    
   two taxa), sorted from highest to lowest probability. For each bipartition,   
   the table gives the number of times the partition or split was observed in all
   runs (#obs) and the posterior probability of the bipartition (Probab.), which 
   is the same as the split frequency. If several runs are summarized, this is   
   followed by the minimum split frequency (Min(s)), the maximum frequency       
   (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.  
   The latter value should approach 0 for all bipartitions as MCMC runs converge.
                                                                                   
   This is followed by a table summarizing branch lengths, node heights (if a    
   clock model was used) and relaxed clock parameters (if a relaxed clock model  
   was used). The mean, variance, and 95 % credible interval are given for each 
   of these parameters. If several runs are summarized, the potential scale      
   reduction factor (PSRF) is also given; it should approach 1 as runs converge. 
   Node heights will take calibration points into account, if such points were   
   used in the analysis.                                                         
                                                                                 
   Note that Stddev may be unreliable if the partition is not present in all     
   runs (the last column indicates the number of runs that sampled the partition 
   if more than one run is summarized). The PSRF is not calculated at all if     
   the partition is not present in all runs.The PSRF is also sensitive to small  
   sample sizes and it should only be considered a rough guide to convergence    
   since some of the assumptions allowing one to interpret it as a true potential
   scale reduction factor are violated in MrBayes.                               
                                                                                 
   List of taxa in bipartitions:                                                 
                                                                                   
      1 -- C1
      2 -- C2
      3 -- C3
      4 -- C4

   Key to taxon bipartitions (saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):

   ID -- Partition
   ----------
    1 -- .***
    2 -- .*..
    3 -- ..*.
    4 -- ...*
    5 -- ..**
    6 -- .**.
    7 -- .*.*
   ----------

   Summary statistics for informative taxon bipartitions
      (saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):

   ID   #obs    Probab.     Sd(s)+      Min(s)      Max(s)   Nruns 
   ----------------------------------------------------------------
    5  1037    0.345436    0.003298    0.343105    0.347768    2
    6   985    0.328115    0.016488    0.316456    0.339773    2
    7   980    0.326449    0.019786    0.312458    0.340440    2
   ----------------------------------------------------------------
   + Convergence diagnostic (standard deviation of split frequencies)
     should approach 0.0 as runs converge.


   Summary statistics for branch and node parameters
      (saved to file "/data/5res/ML1011/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):

                                               95% HPD Interval
                                             --------------------
   Parameter          Mean       Variance     Lower       Upper       Median     PSRF+  Nruns
   ------------------------------------------------------------------------------------------
   length{all}[1]    0.104136    0.010923    0.000031    0.314366    0.070321    1.000    2
   length{all}[2]    0.096717    0.009901    0.000013    0.296610    0.065581    1.000    2
   length{all}[3]    0.100480    0.010515    0.000032    0.316140    0.069934    1.001    2
   length{all}[4]    0.099546    0.010362    0.000017    0.298308    0.069090    1.000    2
   length{all}[5]    0.101933    0.010446    0.000030    0.327541    0.071222    0.999    2
   length{all}[6]    0.094631    0.009139    0.000324    0.283346    0.063401    0.999    2
   length{all}[7]    0.101754    0.009852    0.000034    0.286623    0.073462    0.999    2
   ------------------------------------------------------------------------------------------
   + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
     and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
     deviation of parameter values within all runs is 0 or when a parameter
     value (a branch length, for instance) is not sampled in all runs.


   Summary statistics for partitions with frequency >= 0.10 in at least one run:
       Average standard deviation of split frequencies = 0.013191
       Maximum standard deviation of split frequencies = 0.019786
       Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
       Maximum PSRF for parameter values = 1.001


   Clade credibility values:

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------------------------------------------------------------------ C2 (2)
   +                                                                               
   |------------------------------------------------------------------------ C3 (3)
   |                                                                               
   \------------------------------------------------------------------------ C4 (4)
                                                                                   

   Phylogram (based on average branch lengths):

   /------------------------------------------------------------------------ C1 (1)
   |                                                                               
   |------------------------------------------------------------------- C2 (2)
   +                                                                               
   |------------------------------------------------------------------------ C3 (3)
   |                                                                               
   \----------------------------------------------------------------------- C4 (4)
                                                                                   
   |---------| 0.010 expected changes per site

   Calculating tree probabilities...

   Credible sets of trees (3 trees sampled):
      50 % credible set contains 2 trees
      90 % credible set contains 3 trees
      95 % credible set contains 3 trees
      99 % credible set contains 3 trees

   Exiting mrbayes block
   Reached end of file

   Tasks completed, exiting program because mode is noninteractive
   To return control to the command line after completion of file processing, 
   set mode to interactive with 'mb -i <filename>' (i is for interactive)
   or use 'set mode=interactive'

MrBayes output code: 0

CODONML in paml version 4.9h, March 2018

----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
      TTC |       TCC |       TAC |       TGC
Leu L TTA |       TCA | *** * TAA | *** * TGA
      TTG |       TCG |       TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
      CTC |       CCC |       CAC |       CGC
      CTA |       CCA | Gln Q CAA |       CGA
      CTG |       CCG |       CAG |       CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
      ATC |       ACC |       AAC |       AGC
      ATA |       ACA | Lys K AAA | Arg R AGA
Met M ATG |       ACG |       AAG |       AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
      GTC |       GCC |       GAC |       GGC
      GTA |       GCA | Glu E GAA |       GGA
      GTG |       GCG |       GAG |       GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000):   0  1  2  7  8

seq file is not paml/phylip format.  Trying nexus format.ns = 4  	ls = 420
Reading sequences, sequential format..
Reading seq # 1: C1       
Reading seq # 2: C2       
Reading seq # 3: C3       
Reading seq # 4: C4       
Sequences read..
Counting site patterns..  0:00

Compressing,     52 patterns at    140 /    140 sites (100.0%),  0:00

Collecting fpatt[] & pose[],     52 patterns at    140 /    140 sites (100.0%),  0:00
Counting codons..

       48 bytes for distance
    50752 bytes for conP
     4576 bytes for fhK
  5000000 bytes for space


Model 0: one-ratio

TREE #  1
(1, 2, 3, 4);   MP score: 0
    0.090163    0.055693    0.057098    0.017084    0.300000    1.300000

ntime & nrate & np:     4     2     6

Bounds (np=6):
   0.000004   0.000004   0.000004   0.000004   0.000100   0.000100
  50.000000  50.000000  50.000000  50.000000 999.000000 999.000000

np =     6
lnL0 =  -593.597517

Iterating by ming2
Initial: fx=   593.597517
x=  0.09016  0.05569  0.05710  0.01708  0.30000  1.30000

  1 h-m-p  0.0000 0.0001 275.6505 ++      584.226445  m 0.0001    11 | 1/6
  2 h-m-p  0.0014 0.0230  20.5905 -----------..  | 1/6
  3 h-m-p  0.0000 0.0003 238.8890 +++     568.187843  m 0.0003    39 | 2/6
  4 h-m-p  0.0038 0.0472  14.3473 ------------..  | 2/6
  5 h-m-p  0.0000 0.0000 196.0918 ++      567.795599  m 0.0000    67 | 3/6
  6 h-m-p  0.0003 0.1460   9.2092 ----------..  | 3/6
  7 h-m-p  0.0000 0.0002 138.3140 +++     563.166838  m 0.0002    94 | 4/6
  8 h-m-p  1.3764 8.0000   0.0000 ++      563.166838  m 8.0000   103 | 4/6
  9 h-m-p  0.0202 8.0000   0.0013 +++++   563.166838  m 8.0000   117 | 4/6
 10 h-m-p  0.0046 2.0055   2.3551 +++++   563.166813  m 2.0055   131 | 5/6
 11 h-m-p  0.3283 1.6413   2.9562 ++      563.166781  m 1.6413   140 | 6/6
 12 h-m-p  0.0160 8.0000   0.0000 Y       563.166781  0 0.0160   149 | 6/6
 13 h-m-p  0.0160 8.0000   0.0000 Y       563.166781  0 0.0160   158
Out..
lnL  =  -563.166781
159 lfun, 159 eigenQcodon, 636 P(t)

Time used:  0:00


Model 1: NearlyNeutral

TREE #  1
(1, 2, 3, 4);   MP score: 0
    0.081947    0.088180    0.044958    0.090223    0.000100    0.539137    0.535483

ntime & nrate & np:     4     2     7

Bounds (np=7):
   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.000001
  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990   1.000000
Qfactor_NS = 11.247234

np =     7
lnL0 =  -604.811680

Iterating by ming2
Initial: fx=   604.811680
x=  0.08195  0.08818  0.04496  0.09022  0.00011  0.53914  0.53548

  1 h-m-p  0.0000 0.0000 268.8454 ++      603.999521  m 0.0000    12 | 1/7
  2 h-m-p  0.0000 0.0020 122.2198 ++++    580.161612  m 0.0020    24 | 2/7
  3 h-m-p  0.0001 0.0005 162.0403 ++      565.622475  m 0.0005    34 | 3/7
  4 h-m-p  0.0004 0.0021  44.7022 ++      563.305015  m 0.0021    44 | 4/7
  5 h-m-p  0.0000 0.0000 37936.7353 ++      563.166821  m 0.0000    54 | 5/7
  6 h-m-p  1.6000 8.0000   0.0002 ++      563.166821  m 8.0000    64 | 5/7
  7 h-m-p  0.0018 0.2135   0.8299 ++++    563.166811  m 0.2135    78 | 6/7
  8 h-m-p  0.4839 3.9470   0.1846 ------------C   563.166811  0 0.0000   102 | 6/7
  9 h-m-p  0.0160 8.0000   0.0001 +++++   563.166811  m 8.0000   116 | 6/7
 10 h-m-p  0.0044 2.1816   0.3342 ---------C   563.166811  0 0.0000   136 | 6/7
 11 h-m-p  0.0002 0.1050   2.5807 +++++   563.166781  m 0.1050   150 | 7/7
 12 h-m-p  0.0160 8.0000   0.0000 Y       563.166781  0 0.0160   160 | 7/7
 13 h-m-p  0.0160 8.0000   0.0000 Y       563.166781  0 0.0160   170
Out..
lnL  =  -563.166781
171 lfun, 513 eigenQcodon, 1368 P(t)

Time used:  0:00


Model 2: PositiveSelection

TREE #  1
(1, 2, 3, 4);   MP score: 0
initial w for M2:NSpselection reset.

    0.084089    0.089122    0.100137    0.072641    0.000100    1.169023    0.117875    0.170851    2.591270

ntime & nrate & np:     4     3     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000100 -99.000000 -99.000000   0.000001   1.000000
  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000   1.000000 999.000000
Qfactor_NS = 10.787184

np =     9
lnL0 =  -605.859593

Iterating by ming2
Initial: fx=   605.859593
x=  0.08409  0.08912  0.10014  0.07264  0.00011  1.16902  0.11787  0.17085  2.59127

  1 h-m-p  0.0000 0.0000 221.2326 ++      605.650452  m 0.0000    14 | 1/9
  2 h-m-p  0.0000 0.0018 106.2674 ++++    589.332845  m 0.0018    28 | 2/9
  3 h-m-p  0.0009 0.0043  80.0013 ++      571.700204  m 0.0043    40 | 3/9
  4 h-m-p  0.0010 0.0051 167.4286 ++      563.845605  m 0.0051    52 | 4/9
  5 h-m-p  0.0000 0.0000 4663.1196 ++      563.431185  m 0.0000    64 | 5/9
  6 h-m-p  0.0001 0.0010 2920.6994 ++      563.166833  m 0.0010    76 | 6/9
  7 h-m-p  1.6000 8.0000   0.0518 --------Y   563.166833  0 0.0000    96 | 6/9
  8 h-m-p  0.0160 8.0000   0.0002 +++++   563.166833  m 8.0000   114 | 6/9
  9 h-m-p  0.0160 8.0000   8.7735 ----------Y   563.166833  0 0.0000   139 | 6/9
 10 h-m-p  0.0160 8.0000   0.0000 +++++   563.166833  m 8.0000   154 | 6/9
 11 h-m-p  0.0160 8.0000   0.1226 +++++   563.166833  m 8.0000   172 | 6/9
 12 h-m-p  0.5210 3.6096   1.8826 -----------Y   563.166833  0 0.0000   198 | 6/9
 13 h-m-p  0.0400 8.0000   0.0000 ---Y    563.166833  0 0.0002   213 | 6/9
 14 h-m-p  0.0160 8.0000   0.0001 ----Y   563.166833  0 0.0000   232
Out..
lnL  =  -563.166833
233 lfun, 932 eigenQcodon, 2796 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -563.169520  S =  -563.165348    -0.001594
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  52 patterns   0:01
	did  20 /  52 patterns   0:01
	did  30 /  52 patterns   0:01
	did  40 /  52 patterns   0:01
	did  50 /  52 patterns   0:01
	did  52 /  52 patterns   0:01
Time used:  0:01


Model 7: beta

TREE #  1
(1, 2, 3, 4);   MP score: 0
    0.055238    0.036433    0.013940    0.037530    0.000100    0.998611    1.288146

ntime & nrate & np:     4     1     7

Bounds (np=7):
   0.000004   0.000004   0.000004   0.000004   0.000100   0.005000   0.005000
  50.000000  50.000000  50.000000  50.000000 999.000000  99.000000  99.000000
Qfactor_NS = 15.492311

np =     7
lnL0 =  -582.633933

Iterating by ming2
Initial: fx=   582.633933
x=  0.05524  0.03643  0.01394  0.03753  0.00011  0.99861  1.28815

  1 h-m-p  0.0000 0.0000 268.6280 ++      580.844137  m 0.0000    12 | 1/7
  2 h-m-p  0.0004 0.0681  15.3361 -----------..  | 1/7
  3 h-m-p  0.0000 0.0001 269.2995 ++      575.154697  m 0.0001    41 | 2/7
  4 h-m-p  0.0014 0.0802  13.1244 -----------..  | 2/7
  5 h-m-p  0.0000 0.0002 234.5753 +++     565.931102  m 0.0002    71 | 3/7
  6 h-m-p  0.0039 0.1358   8.1985 ------------..  | 3/7
  7 h-m-p  0.0000 0.0000 194.1030 ++      565.627470  m 0.0000   101 | 4/7
  8 h-m-p  0.0005 0.2548   4.8519 -----------..  | 4/7
  9 h-m-p  0.0000 0.0001 136.9784 ++      563.166820  m 0.0001   130 | 5/7
 10 h-m-p  1.6000 8.0000   0.0000 ++      563.166820  m 8.0000   140 | 5/7
 11 h-m-p  0.1546 8.0000   0.0001 +++     563.166820  m 8.0000   153 | 5/7
 12 h-m-p  0.0025 1.2419   1.2372 ----------N   563.166820  0 0.0000   175 | 5/7
 13 h-m-p  0.0719 8.0000   0.0000 C       563.166820  0 0.0719   185 | 5/7
 14 h-m-p  0.0573 8.0000   0.0000 N       563.166820  0 0.0143   197
Out..
lnL  =  -563.166820
198 lfun, 2178 eigenQcodon, 7920 P(t)

Time used:  0:04


Model 8: beta&w>1

TREE #  1
(1, 2, 3, 4);   MP score: 0
initial w for M8:NSbetaw>1 reset.

    0.104449    0.092764    0.047547    0.045960    0.000100    0.900000    1.143429    1.670422    2.369712

ntime & nrate & np:     4     2     9

Bounds (np=9):
   0.000004   0.000004   0.000004   0.000004   0.000100   0.000010   0.005000   0.005000   1.000000
  50.000000  50.000000  50.000000  50.000000 999.000000   0.999990  99.000000  99.000000 999.000000
Qfactor_NS = 12.915199

np =     9
lnL0 =  -600.694733

Iterating by ming2
Initial: fx=   600.694733
x=  0.10445  0.09276  0.04755  0.04596  0.00011  0.90000  1.14343  1.67042  2.36971

  1 h-m-p  0.0000 0.0000 243.2238 ++      600.336448  m 0.0000    14 | 1/9
  2 h-m-p  0.0000 0.0009 194.4765 ++++    577.199492  m 0.0009    28 | 2/9
  3 h-m-p  0.0000 0.0000 5619074.5797 ++      576.583538  m 0.0000    40 | 3/9
  4 h-m-p  0.0005 0.0820  10.3754 -----------..  | 3/9
  5 h-m-p  0.0000 0.0003 183.6563 +++     564.768973  m 0.0003    74 | 4/9
  6 h-m-p  0.0051 0.0355   8.6478 ------------..  | 4/9
  7 h-m-p  0.0000 0.0001 137.3950 ++      563.166833  m 0.0001   108 | 5/9
  8 h-m-p  0.4584 8.0000   0.0000 +++     563.166833  m 8.0000   121 | 5/9
  9 h-m-p  0.0160 8.0000   0.0667 +++++   563.166830  m 8.0000   140 | 5/9
 10 h-m-p  0.1051 0.5253   2.2826 +C      563.166827  0 0.4273   157 | 5/9
 11 h-m-p  1.6000 8.0000   0.0149 Y       563.166827  0 0.2528   169 | 5/9
 12 h-m-p  1.6000 8.0000   0.0000 ++      563.166827  m 8.0000   185 | 5/9
 13 h-m-p  0.0160 8.0000   0.0272 ++++Y   563.166827  0 3.3509   205 | 5/9
 14 h-m-p  1.6000 8.0000   0.0025 ++      563.166827  m 8.0000   221 | 5/9
 15 h-m-p  0.0163 0.8798   1.2147 ----------Y   563.166827  0 0.0000   247 | 5/9
 16 h-m-p  0.0000 0.0023 115.8281 ++++    563.166826  m 0.0023   261 | 6/9
 17 h-m-p  0.1793 1.0096   0.8055 -------------Y   563.166826  0 0.0000   286 | 6/9
 18 h-m-p  0.0160 8.0000   0.0000 Y       563.166826  0 0.0160   301
Out..
lnL  =  -563.166826
302 lfun, 3624 eigenQcodon, 13288 P(t)

BEBing (dim = 4).  This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
	log(fX) =  -563.172681  S =  -563.165573    -0.003116
Calculating f(w|X), posterior probabilities of site classes.

	did  10 /  52 patterns   0:09
	did  20 /  52 patterns   0:09
	did  30 /  52 patterns   0:09
	did  40 /  52 patterns   0:10
	did  50 /  52 patterns   0:10
	did  52 /  52 patterns   0:10
Time used:  0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=140 

NC_011896_1_WP_010908072_1_1047_MLBR_RS16100         LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
NC_002677_1_NP_301748_1_620_ML1011                   LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235   LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600   LCAPAAARCVHRTMPSTTCSARTHHLGDHQTNPMTADPLTHGAPLVPLTS
                                                     **************************************************

NC_011896_1_WP_010908072_1_1047_MLBR_RS16100         PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NC_002677_1_NP_301748_1_620_ML1011                   PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235   PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600   PSHANKGNPLAVIPVLASQPIGMLPWAGAVPSESAEPTCDSTAPPPANSG
                                                     **************************************************

NC_011896_1_WP_010908072_1_1047_MLBR_RS16100         NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
NC_002677_1_NP_301748_1_620_ML1011                   NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
NZ_LVXE01000017_1_WP_010908072_1_641_A3216_RS15235   NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
NZ_LYPH01000015_1_WP_010908072_1_491_A8144_RS14600   NHLVGTRILYGNPTWIYGNPTWIEVELVDLPQVGGRSIIG
                                                     ****************************************