--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:23:23 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML1030/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -920.90 -924.93
2 -920.89 -923.99
--------------------------------------
TOTAL -920.89 -924.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894771 0.088898 0.361350 1.471543 0.860063 1501.00 1501.00 1.000
r(A<->C){all} 0.176307 0.022031 0.000052 0.480513 0.139062 214.32 241.92 1.001
r(A<->G){all} 0.155149 0.017759 0.000139 0.420763 0.117156 194.57 279.31 1.000
r(A<->T){all} 0.167377 0.020931 0.000010 0.459369 0.128008 165.91 245.43 1.003
r(C<->G){all} 0.157962 0.019130 0.000062 0.442071 0.116358 219.58 225.42 1.001
r(C<->T){all} 0.167236 0.019564 0.000022 0.453303 0.132070 148.38 167.41 1.004
r(G<->T){all} 0.175970 0.023102 0.000056 0.489803 0.130335 188.58 197.94 1.000
pi(A){all} 0.154462 0.000185 0.128601 0.181132 0.154464 1243.31 1301.84 1.000
pi(C){all} 0.350868 0.000339 0.317021 0.388595 0.350766 1158.57 1189.86 1.000
pi(G){all} 0.325424 0.000306 0.291762 0.360163 0.325176 1131.64 1169.94 1.000
pi(T){all} 0.169246 0.000197 0.141500 0.195829 0.168893 1417.72 1426.50 1.000
alpha{1,2} 0.409849 0.226189 0.000122 1.364214 0.248427 1099.83 1196.27 1.000
alpha{3} 0.462440 0.268430 0.000154 1.468652 0.290598 1123.76 1136.58 1.000
pinvar{all} 0.997735 0.000007 0.992527 1.000000 0.998599 1199.23 1216.83 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -889.1198
Model 2: PositiveSelection -889.119771
Model 0: one-ratio -889.119771
Model 7: beta -889.119835
Model 8: beta&w>1 -889.119773
Model 0 vs 1 5.800000008093775E-5
Model 2 vs 1 5.800000008093775E-5
Model 8 vs 7 1.2399999991430377E-4
>C1
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C2
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C3
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C4
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C5
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C6
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232
C1 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C2 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C3 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C4 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C5 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C6 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
**************************************************
C1 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C2 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C3 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C4 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C5 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C6 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
**************************************************
C1 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C2 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C3 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C4 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C5 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C6 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
**************************************************
C1 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C2 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C3 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C4 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C5 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C6 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
**************************************************
C1 APHAALQTVTLNQIGTNAAALGTACLAALALT
C2 APHAALQTVTLNQIGTNAAALGTACLAALALT
C3 APHAALQTVTLNQIGTNAAALGTACLAALALT
C4 APHAALQTVTLNQIGTNAAALGTACLAALALT
C5 APHAALQTVTLNQIGTNAAALGTACLAALALT
C6 APHAALQTVTLNQIGTNAAALGTACLAALALT
********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 232 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 232 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6960]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6960]--->[6960]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.489 Mb, Max= 30.781 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C2 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C3 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C4 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C5 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
C6 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
**************************************************
C1 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C2 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C3 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C4 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C5 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
C6 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
**************************************************
C1 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C2 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C3 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C4 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C5 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
C6 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
**************************************************
C1 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C2 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C3 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C4 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C5 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
C6 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
**************************************************
C1 APHAALQTVTLNQIGTNAAALGTACLAALALT
C2 APHAALQTVTLNQIGTNAAALGTACLAALALT
C3 APHAALQTVTLNQIGTNAAALGTACLAALALT
C4 APHAALQTVTLNQIGTNAAALGTACLAALALT
C5 APHAALQTVTLNQIGTNAAALGTACLAALALT
C6 APHAALQTVTLNQIGTNAAALGTACLAALALT
********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
C2 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
C3 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
C4 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
C5 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
C6 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
**************************************************
C1 ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
C2 ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
C3 ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
C4 ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
C5 ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
C6 ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
**************************************************
C1 TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
C2 TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
C3 TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
C4 TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
C5 TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
C6 TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
**************************************************
C1 GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
C2 GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
C3 GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
C4 GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
C5 GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
C6 GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
**************************************************
C1 CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
C2 CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
C3 CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
C4 CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
C5 CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
C6 CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
**************************************************
C1 ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
C2 ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
C3 ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
C4 ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
C5 ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
C6 ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
**************************************************
C1 GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
C2 GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
C3 GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
C4 GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
C5 GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
C6 GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
**************************************************
C1 TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
C2 TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
C3 TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
C4 TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
C5 TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
C6 TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
**************************************************
C1 GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
C2 GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
C3 GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
C4 GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
C5 GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
C6 GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
**************************************************
C1 CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
C2 CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
C3 CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
C4 CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
C5 CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
C6 CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
**************************************************
C1 CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
C2 CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
C3 CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
C4 CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
C5 CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
C6 CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
**************************************************
C1 TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
C2 TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
C3 TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
C4 TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
C5 TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
C6 TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
**************************************************
C1 GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
C2 GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
C3 GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
C4 GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
C5 GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
C6 GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
**************************************************
C1 CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
C2 CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
C3 CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
C4 CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
C5 CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
C6 CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
**********************************************
>C1
GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
>C2
GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
>C3
GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
>C4
GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
>C5
GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
>C6
GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG
ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG
TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC
GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT
CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC
ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG
GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA
TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA
GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG
CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG
CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG
TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC
GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA
CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
>C1
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C2
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C3
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C4
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C5
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
>C6
VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
APHAALQTVTLNQIGTNAAALGTACLAALALT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 696 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579800126
Setting output file names to "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1301400705
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0222716257
Seed = 548943891
Swapseed = 1579800126
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1557.681368 -- -24.965149
Chain 2 -- -1557.681368 -- -24.965149
Chain 3 -- -1557.681279 -- -24.965149
Chain 4 -- -1557.681368 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1557.681131 -- -24.965149
Chain 2 -- -1557.681279 -- -24.965149
Chain 3 -- -1557.681279 -- -24.965149
Chain 4 -- -1557.681279 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1557.681] (-1557.681) (-1557.681) (-1557.681) * [-1557.681] (-1557.681) (-1557.681) (-1557.681)
500 -- (-944.086) [-929.964] (-959.201) (-930.962) * (-951.501) (-962.096) [-942.837] (-959.022) -- 0:33:19
1000 -- (-931.205) (-927.943) (-946.206) [-925.761] * (-937.063) (-944.539) [-939.440] (-931.190) -- 0:16:39
1500 -- [-928.626] (-929.047) (-929.100) (-929.907) * (-935.548) (-939.228) [-934.978] (-935.197) -- 0:11:05
2000 -- [-931.188] (-931.840) (-931.916) (-932.797) * (-933.823) (-936.145) (-931.450) [-940.841] -- 0:08:19
2500 -- [-927.664] (-931.495) (-932.619) (-936.417) * [-931.331] (-930.964) (-933.835) (-931.794) -- 0:06:39
3000 -- [-932.913] (-925.559) (-931.047) (-932.822) * (-931.716) (-924.814) [-937.134] (-935.103) -- 0:05:32
3500 -- [-926.742] (-932.166) (-933.748) (-932.666) * (-934.869) [-931.878] (-932.451) (-940.639) -- 0:04:44
4000 -- [-927.199] (-928.908) (-930.000) (-931.842) * [-934.243] (-936.059) (-933.212) (-928.833) -- 0:04:09
4500 -- (-926.721) [-927.567] (-929.910) (-926.781) * (-930.255) (-932.546) [-931.043] (-939.400) -- 0:03:41
5000 -- (-929.139) (-928.461) (-930.362) [-932.349] * (-930.523) (-936.234) (-938.552) [-927.590] -- 0:03:19
Average standard deviation of split frequencies: 0.078567
5500 -- (-928.621) (-939.095) [-930.464] (-925.192) * [-931.731] (-927.504) (-928.942) (-927.176) -- 0:03:00
6000 -- (-929.191) (-937.771) (-923.970) [-930.341] * [-931.007] (-930.664) (-930.147) (-928.196) -- 0:02:45
6500 -- (-925.836) (-935.129) (-936.746) [-929.480] * (-939.202) (-927.574) [-932.403] (-937.883) -- 0:02:32
7000 -- [-923.063] (-929.521) (-934.413) (-932.749) * (-925.642) (-934.036) [-927.610] (-930.436) -- 0:02:21
7500 -- (-928.739) (-929.710) [-925.669] (-938.763) * (-932.470) [-929.253] (-928.839) (-932.980) -- 0:02:12
8000 -- (-934.971) (-928.066) (-933.684) [-938.840] * (-928.470) (-932.126) (-933.202) [-932.058] -- 0:02:04
8500 -- (-935.408) [-929.547] (-936.658) (-926.500) * [-929.345] (-933.705) (-931.306) (-929.062) -- 0:01:56
9000 -- (-928.709) (-932.574) (-930.727) [-925.467] * [-933.721] (-924.848) (-930.930) (-933.094) -- 0:01:50
9500 -- (-929.663) (-930.532) (-934.003) [-929.258] * (-931.886) (-936.321) (-930.751) [-927.391] -- 0:01:44
10000 -- (-924.359) (-935.843) [-928.760] (-931.996) * [-927.818] (-927.684) (-930.235) (-927.254) -- 0:01:39
Average standard deviation of split frequencies: 0.053033
10500 -- (-935.961) [-933.539] (-932.038) (-933.203) * (-933.467) [-929.421] (-935.695) (-928.239) -- 0:01:34
11000 -- [-932.970] (-931.457) (-931.324) (-930.320) * (-930.409) (-934.098) [-932.474] (-928.005) -- 0:01:29
11500 -- [-935.762] (-938.776) (-932.437) (-937.483) * (-930.146) (-934.397) (-928.119) [-934.098] -- 0:01:25
12000 -- (-928.766) (-932.908) (-936.928) [-932.041] * (-930.833) (-942.143) (-930.763) [-933.606] -- 0:01:22
12500 -- (-933.822) (-931.426) [-933.270] (-932.521) * [-930.003] (-929.843) (-928.696) (-936.039) -- 0:01:19
13000 -- (-929.059) (-931.189) (-931.030) [-925.849] * (-931.778) (-930.423) [-928.742] (-937.239) -- 0:01:15
13500 -- [-926.818] (-930.658) (-925.024) (-935.884) * [-933.202] (-932.767) (-928.795) (-933.025) -- 0:01:13
14000 -- [-929.524] (-931.429) (-933.687) (-928.318) * (-931.194) [-936.845] (-925.271) (-925.715) -- 0:01:10
14500 -- (-924.019) (-933.466) (-938.176) [-922.769] * [-926.036] (-928.859) (-922.459) (-926.509) -- 0:01:07
15000 -- [-929.969] (-931.261) (-932.907) (-926.141) * (-928.179) [-928.446] (-922.892) (-931.021) -- 0:01:05
Average standard deviation of split frequencies: 0.050508
15500 -- (-932.820) (-929.380) [-932.461] (-932.605) * (-938.483) [-926.662] (-920.888) (-930.456) -- 0:01:03
16000 -- [-926.308] (-931.797) (-933.042) (-931.350) * (-925.691) (-929.086) [-921.152] (-927.284) -- 0:02:03
16500 -- (-927.152) [-932.336] (-936.841) (-936.023) * [-928.058] (-929.977) (-922.777) (-940.109) -- 0:01:59
17000 -- (-926.314) [-927.651] (-926.564) (-931.155) * (-929.230) [-931.530] (-925.876) (-927.785) -- 0:01:55
17500 -- (-927.662) [-928.410] (-924.318) (-934.895) * [-930.269] (-925.430) (-925.868) (-931.067) -- 0:01:52
18000 -- (-928.925) (-928.046) [-926.894] (-940.779) * (-932.704) [-927.133] (-923.982) (-927.855) -- 0:01:49
18500 -- (-929.308) [-927.585] (-934.555) (-936.696) * [-928.125] (-928.400) (-921.727) (-934.050) -- 0:01:46
19000 -- [-926.257] (-931.173) (-939.145) (-936.691) * (-931.078) (-932.342) (-923.282) [-924.559] -- 0:01:43
19500 -- (-929.756) (-922.065) [-928.666] (-944.041) * (-934.914) [-936.040] (-924.576) (-934.116) -- 0:01:40
20000 -- [-931.790] (-929.232) (-933.453) (-931.317) * (-929.279) [-927.518] (-923.128) (-931.110) -- 0:01:38
Average standard deviation of split frequencies: 0.041058
20500 -- (-930.616) (-935.452) [-932.949] (-934.873) * (-929.677) (-925.168) (-923.924) [-926.453] -- 0:01:35
21000 -- (-935.144) (-926.317) (-934.807) [-930.750] * [-933.535] (-930.188) (-922.604) (-936.722) -- 0:01:33
21500 -- (-932.581) [-930.777] (-932.665) (-937.131) * [-928.831] (-939.911) (-921.758) (-931.145) -- 0:01:31
22000 -- (-933.446) [-936.387] (-938.078) (-933.484) * [-930.867] (-932.295) (-922.057) (-933.407) -- 0:01:28
22500 -- [-931.604] (-928.424) (-924.624) (-932.917) * (-925.884) (-934.742) (-921.497) [-931.507] -- 0:01:26
23000 -- (-921.894) (-936.602) [-931.728] (-929.493) * (-927.392) [-932.331] (-922.338) (-929.919) -- 0:01:24
23500 -- [-922.919] (-936.984) (-932.634) (-931.546) * (-935.114) (-929.382) (-922.603) [-930.072] -- 0:01:23
24000 -- (-919.817) (-931.449) [-928.205] (-937.927) * (-924.262) (-930.120) (-921.595) [-926.034] -- 0:01:21
24500 -- [-922.348] (-929.107) (-937.490) (-937.247) * (-934.278) [-933.104] (-920.777) (-940.136) -- 0:01:19
25000 -- (-921.375) (-927.937) [-927.705] (-931.118) * (-929.412) [-931.192] (-920.305) (-932.542) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- (-930.226) (-927.608) (-934.555) [-931.689] * (-926.794) (-937.754) (-920.500) [-930.792] -- 0:01:16
26000 -- (-926.486) (-930.368) (-929.678) [-928.895] * (-932.703) [-932.076] (-924.047) (-927.963) -- 0:01:14
26500 -- (-921.883) (-929.369) (-928.131) [-928.464] * (-930.870) (-927.563) (-922.282) [-929.970] -- 0:01:13
27000 -- (-920.340) (-928.552) [-926.398] (-938.357) * (-926.576) [-932.629] (-922.471) (-930.856) -- 0:01:12
27500 -- [-921.620] (-928.553) (-929.203) (-934.077) * (-928.823) [-929.639] (-920.364) (-928.125) -- 0:01:10
28000 -- (-921.283) (-927.700) (-931.876) [-927.840] * [-929.601] (-928.925) (-922.174) (-932.035) -- 0:01:09
28500 -- (-924.964) (-953.253) (-929.952) [-926.227] * (-932.741) (-935.981) (-919.622) [-932.817] -- 0:01:08
29000 -- (-920.991) [-920.336] (-931.047) (-929.263) * (-937.722) (-927.742) (-919.745) [-924.449] -- 0:01:06
29500 -- (-924.867) (-920.347) [-928.731] (-931.945) * (-931.364) [-932.310] (-922.054) (-929.574) -- 0:01:05
30000 -- (-925.320) (-923.218) [-929.582] (-932.023) * (-931.650) [-930.571] (-922.209) (-931.790) -- 0:01:04
Average standard deviation of split frequencies: 0.037332
30500 -- (-921.935) (-922.928) (-934.436) [-929.246] * (-928.968) (-934.066) (-921.771) [-937.788] -- 0:01:03
31000 -- (-921.132) (-921.881) [-927.462] (-936.037) * (-926.989) (-928.160) (-920.957) [-924.133] -- 0:01:02
31500 -- (-922.596) (-920.684) [-929.033] (-931.501) * (-938.901) (-926.607) [-920.445] (-924.024) -- 0:01:01
32000 -- (-920.347) (-920.658) [-928.048] (-930.539) * [-936.177] (-929.526) (-919.779) (-922.064) -- 0:01:30
32500 -- (-929.265) (-925.752) (-931.069) [-927.674] * (-929.924) [-926.736] (-919.813) (-923.260) -- 0:01:29
33000 -- (-920.450) (-926.604) (-926.843) [-932.125] * (-926.495) (-929.521) (-920.589) [-922.823] -- 0:01:27
33500 -- (-921.134) (-920.783) [-929.497] (-931.313) * (-933.880) (-930.724) (-920.835) [-921.900] -- 0:01:26
34000 -- [-921.438] (-920.187) (-935.822) (-929.264) * (-930.278) [-928.705] (-922.772) (-922.586) -- 0:01:25
34500 -- (-923.397) (-920.458) [-930.337] (-940.085) * [-933.362] (-926.976) (-921.000) (-922.313) -- 0:01:23
35000 -- (-923.612) (-920.832) (-934.013) [-930.390] * (-931.452) (-930.664) [-922.278] (-920.277) -- 0:01:22
Average standard deviation of split frequencies: 0.038629
35500 -- (-920.487) [-920.125] (-932.665) (-929.786) * (-929.396) [-925.872] (-921.243) (-922.450) -- 0:01:21
36000 -- [-920.506] (-924.289) (-930.656) (-926.060) * (-930.164) (-927.939) (-921.896) [-922.110] -- 0:01:20
36500 -- (-919.366) [-920.252] (-928.721) (-932.317) * (-932.691) (-939.472) (-921.456) [-919.965] -- 0:01:19
37000 -- [-920.702] (-922.578) (-927.695) (-931.191) * (-931.312) (-929.511) (-922.678) [-921.566] -- 0:01:18
37500 -- (-919.807) [-921.916] (-929.620) (-926.849) * [-926.053] (-939.655) (-920.399) (-920.991) -- 0:01:17
38000 -- (-921.109) (-921.840) [-924.771] (-930.891) * (-935.441) [-929.872] (-920.620) (-920.767) -- 0:01:15
38500 -- [-920.952] (-923.395) (-932.955) (-932.931) * (-929.730) (-940.921) [-921.250] (-924.846) -- 0:01:14
39000 -- (-920.929) (-921.486) [-933.542] (-931.617) * (-929.277) [-931.324] (-922.221) (-922.853) -- 0:01:13
39500 -- (-924.372) (-920.884) (-931.570) [-930.769] * (-934.531) (-927.118) (-920.342) [-922.759] -- 0:01:12
40000 -- [-925.381] (-920.488) (-934.631) (-933.088) * (-931.037) (-929.904) (-920.298) [-924.114] -- 0:01:12
Average standard deviation of split frequencies: 0.037503
40500 -- (-922.842) (-923.976) (-925.953) [-928.604] * [-930.134] (-923.312) (-920.351) (-924.190) -- 0:01:11
41000 -- (-921.597) (-930.810) (-931.507) [-926.169] * (-936.805) (-937.476) [-920.469] (-920.462) -- 0:01:10
41500 -- (-921.061) [-923.224] (-931.924) (-929.746) * (-927.051) (-927.638) [-920.381] (-920.506) -- 0:01:09
42000 -- (-921.186) [-921.044] (-930.724) (-930.970) * (-928.268) [-934.299] (-921.818) (-921.523) -- 0:01:08
42500 -- (-923.988) (-921.009) (-935.209) [-927.103] * [-929.735] (-929.686) (-923.255) (-921.047) -- 0:01:07
43000 -- (-921.413) (-921.302) (-936.596) [-929.741] * [-928.393] (-926.904) (-923.038) (-922.829) -- 0:01:06
43500 -- (-919.968) (-921.622) [-927.098] (-946.971) * (-928.116) (-931.950) (-922.603) [-923.509] -- 0:01:05
44000 -- [-920.502] (-921.691) (-936.097) (-937.943) * [-923.829] (-934.817) (-920.939) (-924.340) -- 0:01:05
44500 -- (-919.882) (-921.388) (-924.965) [-930.106] * [-929.195] (-935.489) (-925.422) (-921.293) -- 0:01:04
45000 -- (-920.191) [-923.938] (-921.947) (-930.245) * (-934.034) (-927.652) (-923.107) [-925.532] -- 0:01:03
Average standard deviation of split frequencies: 0.029207
45500 -- [-924.534] (-920.047) (-922.377) (-936.421) * [-930.289] (-937.329) (-923.742) (-922.531) -- 0:01:02
46000 -- (-923.100) (-921.941) (-921.251) [-931.065] * (-926.760) (-929.310) [-922.063] (-926.045) -- 0:01:02
46500 -- (-921.788) (-920.051) (-924.668) [-926.397] * (-928.710) (-930.512) [-919.502] (-923.448) -- 0:01:01
47000 -- (-920.408) (-922.812) (-923.934) [-925.128] * (-928.678) (-928.073) [-919.182] (-923.163) -- 0:01:00
47500 -- (-922.451) (-921.213) (-923.550) [-929.151] * (-931.849) [-923.836] (-919.322) (-921.971) -- 0:01:00
48000 -- (-922.408) (-920.765) (-922.787) [-934.071] * [-924.134] (-930.287) (-921.373) (-922.050) -- 0:01:19
48500 -- [-920.890] (-920.862) (-923.181) (-934.921) * (-931.145) (-937.122) [-920.011] (-920.063) -- 0:01:18
49000 -- (-922.165) (-922.240) (-922.326) [-928.780] * (-936.898) (-934.825) [-920.219] (-920.813) -- 0:01:17
49500 -- (-921.246) (-925.041) [-921.805] (-928.120) * (-928.851) (-936.870) [-920.941] (-919.952) -- 0:01:16
50000 -- [-919.557] (-921.180) (-921.195) (-935.342) * [-927.048] (-935.295) (-920.373) (-921.397) -- 0:01:16
Average standard deviation of split frequencies: 0.023260
50500 -- (-921.794) (-922.065) [-920.324] (-921.144) * [-935.285] (-938.633) (-921.267) (-919.942) -- 0:01:15
51000 -- (-921.960) (-921.567) (-920.310) [-923.119] * (-927.020) [-924.193] (-921.389) (-921.705) -- 0:01:14
51500 -- (-920.953) (-922.874) [-922.581] (-924.115) * (-932.280) (-922.324) (-920.695) [-921.067] -- 0:01:13
52000 -- [-922.188] (-921.671) (-921.700) (-922.152) * (-928.559) [-921.640] (-920.423) (-921.455) -- 0:01:12
52500 -- (-922.461) [-923.017] (-921.840) (-922.508) * (-927.587) (-920.826) (-920.490) [-920.615] -- 0:01:12
53000 -- (-921.303) (-921.542) [-923.454] (-923.185) * (-931.225) (-920.397) (-922.502) [-919.660] -- 0:01:11
53500 -- (-920.396) (-921.274) [-921.359] (-925.756) * (-933.085) (-923.081) [-919.549] (-921.396) -- 0:01:10
54000 -- (-920.868) (-921.535) [-921.957] (-924.551) * [-927.689] (-920.426) (-922.001) (-922.626) -- 0:01:10
54500 -- (-921.836) (-923.816) (-920.168) [-923.553] * (-929.087) [-921.062] (-920.454) (-920.509) -- 0:01:09
55000 -- (-921.134) [-923.714] (-921.937) (-922.897) * (-932.020) [-920.522] (-920.682) (-923.098) -- 0:01:08
Average standard deviation of split frequencies: 0.025697
55500 -- [-919.964] (-921.352) (-920.836) (-923.636) * (-931.604) (-921.069) (-920.941) [-920.876] -- 0:01:08
56000 -- (-919.554) (-922.747) (-920.750) [-921.169] * (-924.494) (-920.816) (-920.804) [-921.062] -- 0:01:07
56500 -- (-922.838) [-923.038] (-921.008) (-920.257) * (-938.306) (-919.597) [-921.589] (-923.204) -- 0:01:06
57000 -- (-920.196) [-928.201] (-921.568) (-920.424) * [-935.822] (-920.147) (-921.725) (-922.704) -- 0:01:06
57500 -- (-920.127) (-921.538) [-922.117] (-923.472) * [-928.436] (-920.168) (-923.185) (-920.396) -- 0:01:05
58000 -- [-920.564] (-926.636) (-921.599) (-923.043) * (-927.053) (-920.954) (-923.331) [-920.827] -- 0:01:04
58500 -- (-922.196) [-919.949] (-922.625) (-922.704) * (-936.660) (-925.705) [-923.954] (-921.949) -- 0:01:04
59000 -- (-925.996) (-921.325) (-921.801) [-920.689] * (-923.785) [-922.337] (-925.043) (-922.570) -- 0:01:03
59500 -- (-923.665) [-921.107] (-920.855) (-921.420) * [-920.912] (-922.522) (-923.259) (-924.814) -- 0:01:03
60000 -- (-922.834) (-921.531) [-922.964] (-921.372) * [-921.498] (-921.817) (-922.109) (-923.291) -- 0:01:02
Average standard deviation of split frequencies: 0.028628
60500 -- (-924.072) (-923.562) (-921.392) [-923.398] * (-924.720) (-921.887) [-922.040] (-924.695) -- 0:01:02
61000 -- (-922.352) (-921.948) [-925.002] (-925.480) * (-924.722) (-922.144) [-922.696] (-922.671) -- 0:01:01
61500 -- (-921.121) [-919.827] (-921.386) (-922.741) * (-924.595) (-919.864) (-922.419) [-921.334] -- 0:01:01
62000 -- (-921.414) [-919.309] (-920.272) (-920.147) * [-920.990] (-919.586) (-920.970) (-923.445) -- 0:01:00
62500 -- [-919.783] (-919.305) (-924.198) (-920.931) * (-921.578) (-919.285) [-921.052] (-922.987) -- 0:01:00
63000 -- (-925.803) [-919.213] (-921.315) (-920.707) * (-920.867) (-921.603) (-923.020) [-925.559] -- 0:00:59
63500 -- (-927.251) [-919.185] (-929.880) (-924.733) * [-921.921] (-924.026) (-925.408) (-927.131) -- 0:01:13
64000 -- (-923.287) (-920.341) [-923.073] (-925.400) * (-919.737) [-923.010] (-925.647) (-920.975) -- 0:01:13
64500 -- [-920.298] (-922.874) (-921.920) (-922.420) * [-921.361] (-919.479) (-931.217) (-921.807) -- 0:01:12
65000 -- (-921.690) [-921.110] (-920.993) (-921.833) * (-921.072) (-920.320) (-927.210) [-923.616] -- 0:01:11
Average standard deviation of split frequencies: 0.026070
65500 -- (-922.091) [-919.551] (-921.726) (-922.297) * [-921.244] (-920.388) (-924.022) (-920.880) -- 0:01:11
66000 -- (-921.389) (-922.197) [-919.985] (-924.041) * (-922.233) (-920.125) [-923.299] (-921.856) -- 0:01:10
66500 -- (-925.285) (-926.150) (-919.365) [-923.812] * [-922.028] (-920.190) (-920.366) (-922.964) -- 0:01:10
67000 -- (-923.170) (-923.582) (-920.467) [-920.775] * (-921.500) [-924.288] (-921.862) (-922.270) -- 0:01:09
67500 -- (-926.767) (-923.787) (-922.195) [-920.602] * (-922.043) (-921.955) (-922.384) [-923.470] -- 0:01:09
68000 -- (-922.080) (-921.463) (-922.195) [-923.002] * [-921.018] (-921.432) (-922.600) (-926.375) -- 0:01:08
68500 -- [-923.545] (-925.982) (-921.578) (-921.069) * (-921.065) (-924.593) [-927.213] (-921.409) -- 0:01:07
69000 -- (-920.491) (-925.333) [-921.496] (-919.758) * (-920.761) (-921.156) [-919.733] (-920.873) -- 0:01:07
69500 -- (-919.551) (-920.987) [-922.711] (-921.749) * (-923.010) [-920.860] (-923.947) (-920.190) -- 0:01:06
70000 -- (-921.418) [-919.930] (-927.419) (-920.443) * [-921.665] (-920.267) (-924.343) (-922.381) -- 0:01:06
Average standard deviation of split frequencies: 0.022681
70500 -- (-919.747) [-919.414] (-919.329) (-922.169) * (-926.366) (-920.122) [-920.839] (-921.595) -- 0:01:05
71000 -- [-921.210] (-919.889) (-921.976) (-921.273) * (-921.276) [-920.121] (-921.762) (-919.829) -- 0:01:05
71500 -- (-924.229) (-922.387) (-921.033) [-922.290] * (-922.292) (-920.018) (-922.012) [-922.923] -- 0:01:04
72000 -- (-921.762) (-922.706) [-920.233] (-921.824) * (-921.132) (-923.094) (-921.822) [-921.659] -- 0:01:04
72500 -- (-921.120) [-922.780] (-919.864) (-920.192) * [-922.018] (-920.543) (-922.169) (-920.957) -- 0:01:03
73000 -- [-921.611] (-923.564) (-923.936) (-922.239) * (-921.038) [-920.120] (-922.128) (-921.556) -- 0:01:03
73500 -- (-924.886) [-922.528] (-921.782) (-922.966) * [-921.554] (-920.283) (-924.098) (-921.417) -- 0:01:03
74000 -- (-923.533) [-919.903] (-920.767) (-921.613) * (-922.341) [-920.561] (-923.674) (-923.752) -- 0:01:02
74500 -- [-922.264] (-920.838) (-921.338) (-919.903) * (-924.317) [-920.792] (-923.717) (-919.679) -- 0:01:02
75000 -- (-921.917) (-920.008) (-920.971) [-923.456] * [-923.027] (-920.560) (-923.712) (-919.704) -- 0:01:01
Average standard deviation of split frequencies: 0.018608
75500 -- (-921.081) (-922.230) [-920.910] (-922.020) * [-920.939] (-921.347) (-930.000) (-920.885) -- 0:01:01
76000 -- (-922.650) [-919.523] (-920.413) (-924.801) * (-921.379) (-923.114) (-926.132) [-922.456] -- 0:01:00
76500 -- (-921.829) (-920.581) [-920.475] (-921.764) * (-921.804) [-920.883] (-926.172) (-922.456) -- 0:01:00
77000 -- [-922.251] (-922.180) (-921.313) (-919.749) * (-920.376) [-920.773] (-921.945) (-921.369) -- 0:00:59
77500 -- [-921.169] (-919.979) (-921.110) (-923.951) * (-922.663) [-925.408] (-920.088) (-919.498) -- 0:00:59
78000 -- (-921.114) (-920.980) [-920.019] (-922.724) * (-922.868) (-925.361) (-921.735) [-922.858] -- 0:00:59
78500 -- [-921.120] (-921.758) (-921.188) (-921.403) * (-920.129) (-923.239) [-920.909] (-922.253) -- 0:00:58
79000 -- [-920.932] (-922.427) (-923.889) (-920.926) * (-919.816) (-922.492) (-920.872) [-921.333] -- 0:00:58
79500 -- [-920.994] (-927.763) (-921.265) (-922.359) * [-919.803] (-921.341) (-924.589) (-922.459) -- 0:00:57
80000 -- [-921.399] (-920.552) (-922.391) (-919.429) * (-921.391) (-920.034) (-922.620) [-921.264] -- 0:00:57
Average standard deviation of split frequencies: 0.018830
80500 -- (-921.510) (-919.918) (-920.669) [-921.436] * (-926.596) [-920.570] (-921.910) (-919.902) -- 0:01:08
81000 -- [-922.577] (-919.891) (-922.378) (-920.792) * (-920.642) [-920.082] (-926.900) (-920.512) -- 0:01:08
81500 -- [-923.355] (-920.894) (-920.216) (-923.037) * (-921.647) [-920.199] (-923.413) (-920.370) -- 0:01:07
82000 -- [-921.015] (-922.857) (-919.943) (-921.454) * (-920.164) (-921.457) (-920.463) [-921.183] -- 0:01:07
82500 -- (-922.804) (-922.255) [-923.181] (-923.293) * (-923.986) (-921.656) (-924.235) [-922.071] -- 0:01:06
83000 -- (-924.822) (-919.492) [-922.535] (-920.817) * [-921.612] (-922.078) (-922.799) (-920.273) -- 0:01:06
83500 -- [-920.307] (-921.841) (-922.186) (-920.720) * (-923.416) [-924.469] (-924.835) (-923.043) -- 0:01:05
84000 -- (-922.274) [-920.656] (-921.141) (-921.834) * (-921.594) (-923.105) (-928.409) [-925.616] -- 0:01:05
84500 -- (-922.266) (-921.277) (-922.273) [-921.723] * (-922.532) (-921.917) [-924.214] (-925.502) -- 0:01:05
85000 -- (-920.320) [-924.895] (-921.969) (-923.138) * (-920.423) [-920.837] (-920.808) (-923.160) -- 0:01:04
Average standard deviation of split frequencies: 0.016444
85500 -- (-923.911) (-919.702) [-920.512] (-924.485) * (-923.195) [-922.260] (-921.397) (-921.907) -- 0:01:04
86000 -- (-920.453) [-919.922] (-920.487) (-923.101) * (-923.522) (-920.314) [-922.935] (-922.359) -- 0:01:03
86500 -- (-920.031) (-920.893) [-920.037] (-922.215) * (-921.619) [-920.297] (-922.749) (-921.628) -- 0:01:03
87000 -- [-919.971] (-919.819) (-925.721) (-920.888) * (-924.948) (-920.550) [-922.740] (-925.616) -- 0:01:02
87500 -- [-920.370] (-922.213) (-924.672) (-923.119) * [-919.614] (-920.359) (-920.245) (-923.108) -- 0:01:02
88000 -- (-922.140) [-920.925] (-922.308) (-931.122) * (-924.020) (-921.280) [-922.428] (-923.719) -- 0:01:02
88500 -- [-921.699] (-926.148) (-921.073) (-923.289) * (-922.288) [-921.749] (-920.667) (-920.694) -- 0:01:01
89000 -- (-922.011) [-925.421] (-920.478) (-924.962) * [-921.359] (-919.332) (-921.873) (-921.856) -- 0:01:01
89500 -- (-921.645) [-923.638] (-921.819) (-921.937) * (-923.188) (-925.854) [-922.061] (-922.383) -- 0:01:01
90000 -- [-921.501] (-924.951) (-920.875) (-920.274) * (-923.350) (-923.636) [-920.589] (-920.988) -- 0:01:00
Average standard deviation of split frequencies: 0.015309
90500 -- [-921.942] (-924.049) (-922.333) (-922.450) * [-924.866] (-923.235) (-922.945) (-921.266) -- 0:01:00
91000 -- (-922.988) [-924.787] (-922.783) (-927.837) * (-922.587) [-921.368] (-920.343) (-921.513) -- 0:00:59
91500 -- [-923.453] (-920.823) (-923.575) (-922.537) * (-919.551) (-920.524) (-924.376) [-921.109] -- 0:00:59
92000 -- (-924.193) [-924.648] (-923.992) (-923.019) * [-919.867] (-920.522) (-922.008) (-921.027) -- 0:00:59
92500 -- (-921.497) (-920.964) [-923.147] (-919.368) * (-929.358) (-920.449) (-919.542) [-922.539] -- 0:00:58
93000 -- (-922.222) (-924.467) (-922.522) [-919.394] * [-920.165] (-921.727) (-924.587) (-922.002) -- 0:00:58
93500 -- (-921.947) [-921.812] (-923.523) (-921.662) * (-920.377) [-920.555] (-925.293) (-921.517) -- 0:00:58
94000 -- (-922.051) (-921.193) (-921.067) [-919.833] * (-924.144) (-920.303) [-921.209] (-926.684) -- 0:00:57
94500 -- (-920.403) (-922.266) (-921.442) [-920.877] * [-921.442] (-924.112) (-924.802) (-920.726) -- 0:00:57
95000 -- (-922.682) (-921.262) [-921.583] (-925.713) * (-921.055) [-921.267] (-922.187) (-920.268) -- 0:00:57
Average standard deviation of split frequencies: 0.018091
95500 -- (-921.325) [-923.033] (-921.862) (-922.841) * (-920.155) (-920.139) (-921.315) [-921.069] -- 0:00:56
96000 -- [-920.329] (-926.100) (-921.696) (-923.831) * [-920.226] (-922.534) (-921.550) (-923.175) -- 0:00:56
96500 -- (-924.434) (-920.990) (-921.238) [-922.223] * (-921.055) (-920.952) (-919.655) [-921.111] -- 0:00:56
97000 -- (-924.731) [-921.217] (-920.820) (-922.235) * (-920.006) (-922.864) (-920.848) [-920.430] -- 0:01:05
97500 -- (-922.515) (-921.439) [-919.879] (-921.781) * (-920.427) [-923.486] (-921.474) (-923.373) -- 0:01:04
98000 -- [-921.385] (-923.860) (-923.213) (-926.455) * (-922.674) (-923.386) (-925.272) [-920.324] -- 0:01:04
98500 -- (-923.681) [-921.233] (-922.959) (-922.236) * (-920.458) (-923.974) (-923.509) [-919.602] -- 0:01:04
99000 -- (-922.946) (-923.328) (-924.157) [-922.696] * (-921.621) (-920.614) (-922.569) [-919.304] -- 0:01:03
99500 -- (-922.094) (-922.298) (-924.518) [-921.469] * (-921.277) [-920.898] (-922.368) (-925.245) -- 0:01:03
100000 -- (-924.505) (-922.992) (-928.173) [-921.111] * (-922.172) [-919.981] (-921.207) (-919.632) -- 0:01:02
Average standard deviation of split frequencies: 0.016130
100500 -- (-925.703) [-925.976] (-931.855) (-921.210) * [-920.859] (-920.043) (-923.003) (-919.573) -- 0:01:02
101000 -- (-920.066) (-923.148) [-924.498] (-922.804) * [-919.951] (-919.541) (-920.980) (-921.139) -- 0:01:02
101500 -- [-920.070] (-921.139) (-923.181) (-920.881) * (-920.072) (-920.694) (-924.639) [-919.867] -- 0:01:01
102000 -- (-920.721) [-919.434] (-922.556) (-919.761) * (-924.235) [-921.342] (-920.339) (-921.128) -- 0:01:01
102500 -- (-921.816) [-919.877] (-923.598) (-920.919) * (-924.290) [-921.200] (-920.296) (-919.690) -- 0:01:01
103000 -- (-921.112) [-919.750] (-921.764) (-919.874) * (-920.085) (-927.578) [-920.896] (-919.725) -- 0:01:00
103500 -- [-920.139] (-923.335) (-922.990) (-921.504) * (-919.959) [-925.241] (-919.776) (-919.910) -- 0:01:00
104000 -- (-921.260) (-921.864) [-919.696] (-921.140) * (-919.776) [-920.802] (-923.042) (-920.355) -- 0:01:00
104500 -- (-920.933) (-921.324) (-921.651) [-920.232] * [-923.941] (-926.623) (-920.234) (-920.973) -- 0:00:59
105000 -- [-922.069] (-921.089) (-924.046) (-921.770) * (-922.440) (-921.155) (-920.094) [-921.313] -- 0:00:59
Average standard deviation of split frequencies: 0.018023
105500 -- (-922.649) [-922.116] (-920.786) (-920.056) * (-924.166) [-921.191] (-922.067) (-920.096) -- 0:00:59
106000 -- (-930.311) (-920.718) (-923.274) [-921.370] * (-920.593) [-920.337] (-922.234) (-921.681) -- 0:00:59
106500 -- (-933.223) [-921.010] (-920.165) (-924.594) * (-923.473) [-920.745] (-925.484) (-923.586) -- 0:00:58
107000 -- [-925.981] (-920.573) (-925.391) (-920.101) * (-922.636) (-922.498) [-921.235] (-919.696) -- 0:00:58
107500 -- [-924.146] (-922.068) (-923.897) (-920.023) * (-919.933) (-920.278) [-920.145] (-922.508) -- 0:00:58
108000 -- (-922.110) (-924.331) [-921.513] (-920.522) * (-922.982) (-920.498) [-922.942] (-922.495) -- 0:00:57
108500 -- (-920.144) (-925.906) [-919.740] (-922.394) * (-920.698) [-920.010] (-920.037) (-920.606) -- 0:00:57
109000 -- (-922.257) (-925.614) [-919.755] (-921.934) * [-920.360] (-920.630) (-919.340) (-919.848) -- 0:00:57
109500 -- [-920.871] (-927.451) (-919.703) (-920.634) * [-920.819] (-920.756) (-922.077) (-921.510) -- 0:00:56
110000 -- (-920.452) (-920.155) (-919.287) [-921.986] * [-921.072] (-922.781) (-922.148) (-921.856) -- 0:00:56
Average standard deviation of split frequencies: 0.016590
110500 -- (-920.503) (-921.255) [-921.359] (-919.435) * [-922.488] (-920.141) (-922.426) (-923.029) -- 0:00:56
111000 -- [-922.499] (-919.683) (-924.182) (-920.306) * [-923.560] (-920.211) (-921.205) (-921.097) -- 0:00:56
111500 -- (-925.908) [-921.642] (-924.845) (-921.857) * (-923.214) [-920.342] (-929.713) (-920.228) -- 0:00:55
112000 -- (-922.240) [-921.116] (-925.820) (-921.666) * (-922.407) (-923.180) (-924.176) [-921.241] -- 0:00:55
112500 -- (-920.522) (-921.993) (-921.060) [-922.454] * (-921.652) (-929.214) (-921.207) [-921.957] -- 0:00:55
113000 -- (-920.142) (-921.575) [-922.957] (-921.450) * (-923.228) [-924.722] (-924.598) (-920.590) -- 0:00:54
113500 -- (-926.027) [-921.569] (-922.676) (-923.297) * (-921.131) [-923.579] (-924.206) (-921.688) -- 0:00:54
114000 -- (-920.115) (-920.261) (-921.575) [-920.642] * (-921.032) [-923.532] (-922.734) (-922.535) -- 0:01:02
114500 -- (-922.125) (-920.782) [-921.235] (-921.362) * [-920.627] (-921.770) (-922.278) (-922.909) -- 0:01:01
115000 -- [-921.095] (-921.391) (-921.008) (-923.374) * (-920.581) [-922.063] (-927.560) (-923.385) -- 0:01:01
Average standard deviation of split frequencies: 0.016255
115500 -- (-920.234) [-920.208] (-919.932) (-923.831) * [-920.561] (-920.144) (-921.725) (-920.836) -- 0:01:01
116000 -- [-920.419] (-927.795) (-920.189) (-927.677) * [-920.360] (-922.076) (-922.395) (-921.093) -- 0:01:00
116500 -- (-920.337) [-922.300] (-920.714) (-922.832) * [-921.984] (-922.377) (-922.300) (-921.072) -- 0:01:00
117000 -- (-921.726) (-921.416) (-920.543) [-926.050] * (-922.728) [-920.574] (-926.906) (-921.076) -- 0:01:00
117500 -- (-920.978) (-920.081) [-920.099] (-922.424) * [-924.910] (-920.852) (-920.828) (-920.043) -- 0:01:00
118000 -- (-919.683) (-919.322) (-921.608) [-920.708] * (-925.458) (-921.323) (-923.045) [-922.188] -- 0:00:59
118500 -- [-919.992] (-921.174) (-920.975) (-920.189) * (-922.160) (-922.429) (-919.793) [-922.497] -- 0:00:59
119000 -- (-923.654) (-921.128) (-922.651) [-919.908] * [-920.113] (-921.660) (-919.818) (-920.295) -- 0:00:59
119500 -- [-921.406] (-920.212) (-931.589) (-920.717) * [-921.259] (-923.273) (-924.556) (-921.671) -- 0:00:58
120000 -- [-920.998] (-923.241) (-920.975) (-920.479) * [-920.896] (-922.966) (-920.651) (-922.422) -- 0:00:58
Average standard deviation of split frequencies: 0.017189
120500 -- (-924.521) [-920.837] (-920.587) (-921.131) * [-920.804] (-922.328) (-920.913) (-922.510) -- 0:00:58
121000 -- (-923.062) (-920.312) [-920.183] (-920.013) * (-920.481) (-922.395) [-921.249] (-925.734) -- 0:00:58
121500 -- (-922.997) (-921.475) [-921.771] (-923.831) * [-921.479] (-922.079) (-920.580) (-920.870) -- 0:00:57
122000 -- (-922.604) [-922.428] (-924.153) (-924.044) * (-922.369) (-921.622) [-923.718] (-921.795) -- 0:00:57
122500 -- [-920.721] (-922.891) (-923.600) (-922.913) * (-922.366) [-921.325] (-924.644) (-921.189) -- 0:00:57
123000 -- (-921.872) [-922.190] (-923.316) (-929.564) * [-920.578] (-923.122) (-922.212) (-921.187) -- 0:00:57
123500 -- [-922.824] (-922.893) (-919.845) (-922.797) * (-922.609) (-921.891) (-925.579) [-920.948] -- 0:00:56
124000 -- (-923.631) [-922.593] (-922.554) (-921.747) * (-922.977) [-926.169] (-921.558) (-920.494) -- 0:00:56
124500 -- (-921.962) (-921.211) (-922.729) [-921.802] * (-921.369) [-923.783] (-921.885) (-922.202) -- 0:00:56
125000 -- (-925.769) [-920.936] (-924.208) (-920.507) * (-920.830) [-921.575] (-925.849) (-920.488) -- 0:00:56
Average standard deviation of split frequencies: 0.016649
125500 -- (-922.797) (-920.026) (-921.597) [-921.916] * (-922.553) [-920.298] (-920.606) (-920.124) -- 0:00:55
126000 -- (-921.198) (-919.758) (-920.483) [-920.376] * (-920.699) [-920.760] (-920.260) (-922.896) -- 0:00:55
126500 -- (-923.656) (-919.479) [-921.038] (-919.240) * (-920.742) [-921.425] (-920.116) (-922.030) -- 0:00:55
127000 -- (-921.870) (-920.440) (-922.215) [-922.186] * (-923.660) [-919.385] (-919.775) (-922.227) -- 0:00:54
127500 -- [-922.846] (-920.791) (-922.139) (-920.017) * (-921.601) [-919.385] (-921.911) (-920.863) -- 0:00:54
128000 -- (-924.424) (-921.462) [-921.145] (-920.231) * (-925.693) (-920.689) (-920.485) [-922.830] -- 0:00:54
128500 -- (-920.343) [-919.515] (-920.493) (-920.519) * (-921.354) (-920.153) (-921.928) [-920.945] -- 0:00:54
129000 -- [-922.847] (-922.495) (-921.191) (-920.557) * [-920.319] (-922.599) (-921.427) (-919.914) -- 0:00:54
129500 -- (-920.038) (-922.398) (-920.423) [-920.910] * (-919.884) (-919.607) (-921.100) [-920.994] -- 0:00:53
130000 -- (-922.439) (-920.035) [-921.033] (-920.841) * (-925.869) (-919.600) (-922.157) [-922.001] -- 0:00:53
Average standard deviation of split frequencies: 0.018608
130500 -- (-920.780) (-920.226) (-921.686) [-920.395] * (-920.754) (-923.607) [-921.638] (-921.633) -- 0:00:59
131000 -- (-923.067) (-924.969) (-923.452) [-919.910] * (-920.478) (-919.450) [-924.460] (-923.634) -- 0:00:59
131500 -- (-921.841) [-923.948] (-924.316) (-922.791) * (-922.185) [-919.444] (-920.432) (-921.840) -- 0:00:59
132000 -- [-921.533] (-921.060) (-922.134) (-921.268) * (-923.214) [-919.614] (-920.523) (-921.903) -- 0:00:59
132500 -- (-923.103) (-923.300) [-922.676] (-920.790) * (-924.535) [-920.380] (-919.577) (-920.863) -- 0:00:58
133000 -- (-921.694) [-920.363] (-925.359) (-920.264) * (-925.500) (-922.181) (-920.143) [-920.722] -- 0:00:58
133500 -- (-926.887) [-919.772] (-924.374) (-920.382) * (-921.220) (-919.652) (-923.210) [-922.842] -- 0:00:58
134000 -- [-920.845] (-920.276) (-924.718) (-922.210) * (-921.636) [-920.494] (-922.271) (-923.560) -- 0:00:58
134500 -- [-922.344] (-921.375) (-923.042) (-922.621) * (-924.219) (-919.695) (-920.269) [-921.548] -- 0:00:57
135000 -- (-920.553) [-925.200] (-923.600) (-921.766) * (-921.262) (-922.346) [-919.931] (-921.419) -- 0:00:57
Average standard deviation of split frequencies: 0.017696
135500 -- [-921.349] (-921.989) (-921.167) (-922.582) * (-919.424) (-924.056) (-920.220) [-920.910] -- 0:00:57
136000 -- (-920.246) (-921.284) [-921.591] (-929.833) * (-921.056) (-921.135) [-920.261] (-920.413) -- 0:00:57
136500 -- (-919.931) (-921.132) (-921.702) [-921.458] * (-921.749) (-921.011) [-920.233] (-921.258) -- 0:00:56
137000 -- (-920.806) [-920.544] (-921.644) (-922.459) * [-920.317] (-922.683) (-919.851) (-920.912) -- 0:00:56
137500 -- [-921.843] (-922.846) (-921.602) (-922.879) * (-921.108) [-924.421] (-920.364) (-921.513) -- 0:00:56
138000 -- (-923.932) [-923.777] (-920.905) (-921.415) * (-921.874) (-921.399) [-920.527] (-920.476) -- 0:00:56
138500 -- (-925.836) (-921.195) (-925.120) [-920.902] * (-920.235) [-921.324] (-924.394) (-920.654) -- 0:00:55
139000 -- (-922.374) (-920.812) (-920.844) [-919.806] * (-920.737) (-921.910) (-921.646) [-920.608] -- 0:00:55
139500 -- (-920.060) (-923.337) (-919.783) [-919.525] * (-920.944) [-922.140] (-921.661) (-924.374) -- 0:00:55
140000 -- [-923.391] (-920.639) (-920.163) (-923.158) * (-922.429) (-923.746) [-922.000] (-921.564) -- 0:00:55
Average standard deviation of split frequencies: 0.019402
140500 -- (-923.026) (-919.908) [-920.163] (-920.678) * (-926.065) (-923.183) [-921.315] (-924.114) -- 0:00:55
141000 -- (-922.544) [-920.064] (-919.888) (-920.041) * (-924.126) [-922.799] (-920.278) (-920.484) -- 0:00:54
141500 -- (-921.314) (-920.220) [-920.780] (-920.985) * (-925.665) [-921.794] (-922.757) (-922.038) -- 0:00:54
142000 -- [-919.525] (-921.953) (-922.248) (-922.191) * [-923.706] (-920.712) (-922.094) (-923.746) -- 0:00:54
142500 -- [-921.983] (-921.275) (-919.973) (-920.807) * (-922.612) (-921.433) (-924.426) [-921.118] -- 0:00:54
143000 -- (-920.197) (-920.757) (-919.846) [-921.255] * (-924.852) (-923.963) (-926.420) [-921.498] -- 0:00:53
143500 -- (-920.812) (-922.146) [-920.838] (-920.766) * [-923.415] (-921.118) (-921.697) (-922.236) -- 0:00:53
144000 -- (-925.534) (-919.574) (-920.980) [-921.534] * (-922.978) [-923.771] (-921.134) (-920.454) -- 0:00:53
144500 -- (-924.638) (-920.284) (-921.003) [-922.508] * (-920.299) (-925.461) [-921.890] (-920.973) -- 0:00:53
145000 -- [-924.216] (-928.257) (-923.981) (-923.807) * (-920.552) [-922.290] (-921.107) (-920.376) -- 0:00:53
Average standard deviation of split frequencies: 0.020341
145500 -- (-920.219) (-922.628) [-922.286] (-923.169) * [-924.383] (-922.263) (-924.059) (-920.896) -- 0:00:52
146000 -- (-927.024) (-920.973) (-920.804) [-924.223] * (-922.938) [-922.291] (-920.832) (-921.835) -- 0:00:52
146500 -- (-925.091) [-921.689] (-919.812) (-922.461) * (-920.266) [-924.426] (-920.348) (-921.112) -- 0:00:52
147000 -- (-921.075) (-922.634) [-923.788] (-921.606) * (-921.169) [-919.907] (-919.800) (-923.004) -- 0:00:52
147500 -- (-920.805) (-926.551) [-921.966] (-922.583) * (-921.088) [-925.324] (-921.416) (-923.816) -- 0:00:57
148000 -- [-921.559] (-924.666) (-925.975) (-920.844) * [-922.374] (-925.170) (-920.174) (-922.545) -- 0:00:57
148500 -- (-921.159) (-925.512) (-928.749) [-921.387] * (-925.504) (-922.777) [-919.853] (-923.108) -- 0:00:57
149000 -- (-920.467) [-922.053] (-931.253) (-920.213) * [-921.129] (-921.678) (-923.569) (-922.634) -- 0:00:57
149500 -- (-923.013) (-927.940) (-922.464) [-919.985] * (-921.130) (-922.546) (-926.177) [-924.946] -- 0:00:56
150000 -- (-931.091) [-920.020] (-920.815) (-923.134) * [-923.114] (-920.612) (-921.494) (-923.274) -- 0:00:56
Average standard deviation of split frequencies: 0.018599
150500 -- (-931.084) [-919.867] (-921.741) (-922.273) * (-922.884) [-920.242] (-923.151) (-921.141) -- 0:00:56
151000 -- (-927.790) [-919.556] (-922.734) (-924.493) * (-921.166) (-920.226) [-922.423] (-921.643) -- 0:00:56
151500 -- (-924.690) [-920.053] (-923.402) (-920.249) * (-922.356) (-921.601) (-923.451) [-924.505] -- 0:00:56
152000 -- (-924.325) (-922.027) [-920.796] (-921.710) * (-920.670) (-920.735) (-925.712) [-921.440] -- 0:00:55
152500 -- [-921.282] (-920.496) (-920.630) (-920.935) * [-919.735] (-920.724) (-926.079) (-921.202) -- 0:00:55
153000 -- (-920.122) [-920.370] (-921.022) (-922.881) * (-926.963) (-920.346) [-925.202] (-920.889) -- 0:00:55
153500 -- (-922.489) [-919.796] (-922.805) (-920.822) * (-922.506) [-920.435] (-920.867) (-919.651) -- 0:00:55
154000 -- (-921.626) [-919.819] (-926.149) (-921.028) * (-921.194) [-919.633] (-920.585) (-921.964) -- 0:00:54
154500 -- (-922.093) [-922.822] (-922.050) (-922.887) * (-920.284) (-922.600) [-923.144] (-921.283) -- 0:00:54
155000 -- (-924.670) (-920.355) (-921.638) [-921.519] * (-920.141) [-921.047] (-920.686) (-925.808) -- 0:00:54
Average standard deviation of split frequencies: 0.020699
155500 -- (-924.513) (-919.820) (-921.536) [-920.663] * [-921.652] (-920.102) (-921.324) (-922.308) -- 0:00:54
156000 -- (-925.069) [-921.350] (-920.694) (-922.494) * (-921.181) (-923.849) (-925.020) [-921.438] -- 0:00:54
156500 -- (-923.613) (-922.779) (-920.694) [-923.253] * [-921.224] (-921.243) (-926.951) (-922.608) -- 0:00:53
157000 -- (-927.232) (-923.218) (-920.544) [-922.691] * (-920.172) [-922.899] (-919.969) (-919.860) -- 0:00:53
157500 -- (-921.634) (-924.146) (-920.544) [-920.917] * (-920.814) (-923.460) (-922.198) [-922.019] -- 0:00:53
158000 -- (-921.379) (-921.659) (-920.632) [-920.431] * (-923.975) (-922.862) (-926.772) [-919.894] -- 0:00:53
158500 -- [-921.400] (-920.376) (-920.550) (-921.159) * (-923.241) (-922.203) [-924.742] (-919.954) -- 0:00:53
159000 -- (-926.375) [-920.151] (-922.669) (-922.911) * (-923.018) (-920.068) [-922.117] (-928.013) -- 0:00:52
159500 -- (-922.443) (-919.548) [-922.845] (-923.723) * (-923.453) [-921.299] (-926.702) (-923.505) -- 0:00:52
160000 -- [-921.161] (-919.954) (-922.973) (-921.074) * (-925.198) [-922.309] (-924.996) (-922.532) -- 0:00:52
Average standard deviation of split frequencies: 0.019612
160500 -- (-922.922) [-921.389] (-920.967) (-922.209) * (-922.314) (-925.548) [-921.923] (-921.970) -- 0:00:52
161000 -- (-921.193) [-920.161] (-924.114) (-923.587) * (-920.884) (-921.290) (-920.042) [-921.319] -- 0:00:52
161500 -- (-921.828) (-920.886) [-921.691] (-920.705) * (-920.951) (-924.064) (-920.042) [-920.622] -- 0:00:51
162000 -- (-923.085) [-922.667] (-921.356) (-923.510) * [-921.384] (-922.700) (-919.183) (-919.470) -- 0:00:51
162500 -- (-921.189) (-922.843) (-922.889) [-924.789] * [-922.011] (-922.133) (-920.914) (-922.575) -- 0:00:51
163000 -- (-919.703) [-920.406] (-921.448) (-921.331) * (-920.010) (-922.166) (-924.006) [-925.420] -- 0:00:51
163500 -- (-922.076) (-921.722) [-923.968] (-925.189) * (-921.152) (-919.741) (-923.762) [-921.894] -- 0:00:51
164000 -- (-921.437) [-920.625] (-922.467) (-922.952) * (-921.245) [-919.729] (-922.594) (-922.856) -- 0:00:56
164500 -- (-923.465) [-921.474] (-927.158) (-921.370) * (-921.209) [-920.204] (-923.389) (-925.825) -- 0:00:55
165000 -- (-921.718) (-923.096) [-921.931] (-921.868) * [-921.724] (-920.852) (-920.326) (-922.589) -- 0:00:55
Average standard deviation of split frequencies: 0.019729
165500 -- [-921.446] (-921.637) (-923.132) (-925.288) * (-920.269) [-921.741] (-923.870) (-922.196) -- 0:00:55
166000 -- (-921.498) [-924.799] (-921.267) (-925.472) * (-920.114) (-921.512) (-925.827) [-921.817] -- 0:00:55
166500 -- [-920.280] (-922.344) (-920.969) (-921.293) * (-920.230) [-919.967] (-926.650) (-919.993) -- 0:00:55
167000 -- (-920.961) (-920.765) (-922.301) [-919.413] * (-920.297) (-920.201) [-922.129] (-921.355) -- 0:00:54
167500 -- [-922.671] (-919.972) (-926.366) (-924.164) * (-919.646) (-921.908) [-920.531] (-921.071) -- 0:00:54
168000 -- (-920.087) (-919.912) (-922.901) [-922.133] * (-921.255) (-920.005) [-920.876] (-922.283) -- 0:00:54
168500 -- (-920.070) [-919.974] (-922.208) (-919.951) * (-920.432) (-921.680) [-923.345] (-920.973) -- 0:00:54
169000 -- (-920.462) (-919.573) (-921.936) [-923.775] * (-928.212) (-919.653) [-922.817] (-925.639) -- 0:00:54
169500 -- (-920.450) (-922.350) (-920.167) [-924.672] * (-922.018) [-919.640] (-924.015) (-921.767) -- 0:00:53
170000 -- (-922.224) (-921.660) [-922.213] (-920.831) * (-920.726) (-921.922) [-920.510] (-922.643) -- 0:00:53
Average standard deviation of split frequencies: 0.018317
170500 -- [-921.252] (-922.111) (-921.023) (-923.958) * [-921.233] (-925.080) (-923.939) (-924.137) -- 0:00:53
171000 -- [-921.252] (-920.658) (-920.726) (-921.939) * (-924.675) (-920.573) [-920.743] (-919.708) -- 0:00:53
171500 -- (-923.476) (-922.628) (-922.089) [-925.544] * (-921.507) (-925.350) [-921.846] (-920.620) -- 0:00:53
172000 -- [-925.615] (-921.226) (-921.490) (-923.567) * [-920.195] (-920.095) (-920.882) (-920.185) -- 0:00:52
172500 -- [-921.944] (-922.502) (-923.096) (-923.879) * (-920.922) (-920.482) (-922.378) [-921.200] -- 0:00:52
173000 -- (-922.446) (-925.905) [-923.038] (-922.372) * (-919.312) (-922.008) [-923.948] (-921.229) -- 0:00:52
173500 -- [-921.887] (-921.221) (-923.070) (-924.799) * (-921.699) (-924.369) [-921.818] (-924.413) -- 0:00:52
174000 -- (-922.180) (-921.221) [-922.611] (-925.807) * (-926.516) [-919.669] (-923.945) (-921.693) -- 0:00:52
174500 -- (-921.255) (-921.494) [-920.954] (-921.952) * (-920.104) [-919.502] (-922.514) (-922.926) -- 0:00:52
175000 -- (-922.366) [-920.846] (-921.294) (-921.358) * (-919.539) (-919.922) [-920.900] (-922.865) -- 0:00:51
Average standard deviation of split frequencies: 0.020624
175500 -- (-919.410) (-923.372) [-921.768] (-926.485) * (-920.258) (-920.708) [-920.646] (-920.565) -- 0:00:51
176000 -- (-921.218) (-923.865) [-922.054] (-924.964) * (-920.130) (-923.486) [-922.490] (-921.184) -- 0:00:51
176500 -- (-919.447) (-921.714) (-921.805) [-921.986] * [-920.900] (-919.418) (-922.130) (-922.719) -- 0:00:51
177000 -- [-919.461] (-923.714) (-920.688) (-923.592) * [-922.457] (-922.717) (-920.033) (-924.692) -- 0:00:51
177500 -- (-922.030) [-921.942] (-923.384) (-920.521) * (-923.042) (-921.394) [-919.938] (-924.999) -- 0:00:50
178000 -- (-922.765) (-920.246) [-920.038] (-921.530) * (-922.715) [-922.341] (-920.055) (-920.706) -- 0:00:50
178500 -- [-920.107] (-920.105) (-922.247) (-923.522) * [-924.097] (-921.024) (-922.691) (-924.157) -- 0:00:50
179000 -- (-920.151) (-923.189) [-922.771] (-922.387) * [-922.342] (-923.788) (-923.737) (-923.513) -- 0:00:50
179500 -- (-920.342) (-920.353) [-920.445] (-921.805) * [-924.683] (-923.476) (-923.008) (-922.789) -- 0:00:50
180000 -- [-925.364] (-920.027) (-920.362) (-922.547) * (-924.849) (-922.915) [-921.918] (-922.177) -- 0:00:50
Average standard deviation of split frequencies: 0.020325
180500 -- (-923.022) (-920.072) [-921.669] (-922.122) * [-920.400] (-925.742) (-924.437) (-926.068) -- 0:00:49
181000 -- (-919.960) (-923.899) (-922.556) [-921.174] * [-921.292] (-920.459) (-921.283) (-922.249) -- 0:00:54
181500 -- [-920.690] (-922.938) (-921.521) (-920.414) * [-920.185] (-921.496) (-924.076) (-922.366) -- 0:00:54
182000 -- [-919.949] (-921.143) (-921.420) (-920.283) * (-920.854) [-920.155] (-924.969) (-924.399) -- 0:00:53
182500 -- (-920.925) (-921.843) (-919.446) [-920.298] * (-925.328) [-923.155] (-920.749) (-924.167) -- 0:00:53
183000 -- (-923.743) [-921.764] (-921.357) (-920.842) * [-922.610] (-926.315) (-919.482) (-921.606) -- 0:00:53
183500 -- (-925.572) (-921.553) [-921.251] (-921.072) * (-920.946) [-921.842] (-920.363) (-923.477) -- 0:00:53
184000 -- (-926.028) (-924.698) (-922.972) [-921.659] * (-920.524) (-920.896) [-920.382] (-922.746) -- 0:00:53
184500 -- (-924.615) (-923.661) (-921.399) [-921.793] * [-919.941] (-921.621) (-921.826) (-921.579) -- 0:00:53
185000 -- (-923.289) [-919.610] (-922.736) (-927.467) * (-923.866) [-920.116] (-920.997) (-921.842) -- 0:00:52
Average standard deviation of split frequencies: 0.017868
185500 -- [-920.686] (-921.516) (-920.735) (-921.579) * (-920.335) [-928.291] (-920.218) (-920.096) -- 0:00:52
186000 -- (-922.395) (-920.325) [-920.775] (-921.207) * (-921.426) (-925.200) [-922.559] (-922.466) -- 0:00:52
186500 -- (-923.582) (-919.875) [-919.966] (-923.230) * (-925.026) [-921.388] (-922.189) (-922.383) -- 0:00:52
187000 -- (-923.488) (-921.957) (-919.755) [-927.732] * (-920.033) (-921.200) (-921.074) [-924.536] -- 0:00:52
187500 -- (-921.373) [-922.270] (-919.296) (-922.761) * (-920.263) (-921.913) (-923.286) [-920.932] -- 0:00:52
188000 -- (-919.636) (-919.497) (-925.123) [-922.813] * (-919.855) [-920.265] (-922.082) (-920.393) -- 0:00:51
188500 -- (-920.044) [-923.340] (-921.035) (-921.903) * (-920.488) (-920.102) [-921.915] (-920.432) -- 0:00:51
189000 -- (-920.727) (-920.959) (-923.015) [-922.511] * (-925.870) (-920.212) (-921.400) [-922.261] -- 0:00:51
189500 -- (-920.363) (-920.556) [-919.738] (-923.079) * (-921.173) [-919.811] (-921.444) (-921.368) -- 0:00:51
190000 -- (-920.168) (-919.698) [-923.349] (-924.048) * [-923.660] (-921.499) (-921.654) (-920.478) -- 0:00:51
Average standard deviation of split frequencies: 0.018348
190500 -- (-921.020) (-920.277) (-924.018) [-920.740] * (-924.378) (-922.884) [-920.514] (-924.073) -- 0:00:50
191000 -- (-921.867) [-920.159] (-923.426) (-922.167) * (-921.977) [-919.872] (-921.029) (-925.569) -- 0:00:50
191500 -- [-920.511] (-920.558) (-921.142) (-920.501) * (-923.290) (-920.419) [-921.347] (-924.829) -- 0:00:50
192000 -- (-919.805) (-919.725) (-924.990) [-920.486] * (-920.683) (-923.395) (-920.638) [-920.949] -- 0:00:50
192500 -- [-925.156] (-919.660) (-923.123) (-921.709) * (-922.470) (-919.970) (-920.543) [-921.419] -- 0:00:50
193000 -- (-921.664) (-921.994) (-922.143) [-921.227] * (-923.461) (-922.514) (-920.326) [-924.580] -- 0:00:50
193500 -- (-922.122) [-922.930] (-925.245) (-923.398) * (-920.667) (-923.091) (-920.400) [-922.059] -- 0:00:50
194000 -- (-921.187) (-923.230) [-923.543] (-922.594) * [-919.440] (-926.726) (-923.173) (-921.863) -- 0:00:49
194500 -- [-920.859] (-924.731) (-920.780) (-924.406) * [-920.767] (-924.320) (-920.735) (-921.889) -- 0:00:49
195000 -- (-924.244) (-922.117) [-921.062] (-922.544) * (-920.846) (-923.856) (-923.594) [-920.865] -- 0:00:49
Average standard deviation of split frequencies: 0.016583
195500 -- (-919.944) (-925.737) [-923.003] (-921.126) * [-924.110] (-922.094) (-923.308) (-924.882) -- 0:00:49
196000 -- (-921.550) (-921.256) (-924.297) [-920.411] * (-920.822) [-921.930] (-923.591) (-920.903) -- 0:00:49
196500 -- (-919.578) [-925.420] (-922.848) (-920.698) * (-925.630) (-922.555) (-919.877) [-919.907] -- 0:00:49
197000 -- (-920.219) (-920.301) (-919.956) [-924.555] * (-923.958) (-921.767) [-922.102] (-921.185) -- 0:00:48
197500 -- (-919.724) [-919.514] (-920.241) (-928.034) * (-924.435) (-924.883) [-920.093] (-922.875) -- 0:00:52
198000 -- (-919.755) [-921.202] (-922.813) (-922.300) * (-920.968) [-921.390] (-919.818) (-920.123) -- 0:00:52
198500 -- (-921.586) (-922.328) [-923.022] (-921.112) * (-920.706) (-922.704) (-920.047) [-921.567] -- 0:00:52
199000 -- (-920.025) [-921.532] (-924.313) (-924.603) * (-920.743) (-923.710) (-920.368) [-922.023] -- 0:00:52
199500 -- (-920.918) [-920.730] (-920.823) (-921.566) * (-924.243) (-922.391) (-920.960) [-920.273] -- 0:00:52
200000 -- [-921.458] (-919.930) (-924.756) (-927.149) * (-920.669) [-921.804] (-922.292) (-925.166) -- 0:00:51
Average standard deviation of split frequencies: 0.017749
200500 -- (-920.497) [-920.793] (-921.253) (-922.881) * (-919.905) (-922.228) (-922.800) [-926.519] -- 0:00:51
201000 -- (-921.764) (-921.093) (-922.126) [-921.942] * (-919.901) (-921.737) (-921.507) [-921.099] -- 0:00:51
201500 -- (-920.194) [-925.417] (-923.024) (-927.717) * [-922.699] (-921.100) (-924.227) (-925.808) -- 0:00:51
202000 -- (-923.056) (-924.736) (-920.049) [-923.834] * (-919.707) (-919.744) [-922.452] (-922.446) -- 0:00:51
202500 -- [-919.998] (-921.936) (-920.149) (-923.167) * (-922.423) (-920.588) (-921.851) [-920.593] -- 0:00:51
203000 -- (-923.546) (-920.200) [-920.631] (-921.134) * (-922.697) (-921.569) [-923.456] (-921.124) -- 0:00:51
203500 -- (-922.199) (-920.720) [-920.671] (-921.545) * (-923.496) (-921.581) (-926.063) [-921.122] -- 0:00:50
204000 -- [-922.329] (-920.693) (-919.734) (-922.916) * (-926.277) (-921.226) [-921.292] (-922.745) -- 0:00:50
204500 -- (-923.117) (-920.357) (-921.763) [-922.724] * (-921.146) [-922.930] (-921.517) (-921.745) -- 0:00:50
205000 -- [-922.420] (-921.695) (-922.016) (-922.134) * [-921.254] (-922.320) (-919.960) (-922.418) -- 0:00:50
Average standard deviation of split frequencies: 0.017343
205500 -- (-920.897) [-919.946] (-920.917) (-919.751) * (-922.058) [-920.082] (-921.305) (-920.543) -- 0:00:50
206000 -- (-920.953) (-921.156) (-921.479) [-921.680] * (-924.396) (-921.455) (-920.984) [-920.214] -- 0:00:50
206500 -- (-924.871) (-921.876) [-920.978] (-923.312) * (-920.300) [-920.472] (-920.332) (-921.467) -- 0:00:49
207000 -- [-922.821] (-922.614) (-920.743) (-919.379) * (-921.116) (-922.768) [-924.767] (-921.124) -- 0:00:49
207500 -- (-921.999) [-923.220] (-920.827) (-919.819) * (-920.434) (-920.235) [-919.914] (-927.080) -- 0:00:49
208000 -- (-924.011) [-924.062] (-921.678) (-919.864) * (-919.808) [-922.856] (-919.882) (-921.765) -- 0:00:49
208500 -- (-923.863) [-922.688] (-920.916) (-922.646) * (-922.190) [-921.098] (-920.267) (-921.760) -- 0:00:49
209000 -- [-919.834] (-923.063) (-921.030) (-926.754) * (-927.933) (-925.395) (-919.542) [-920.751] -- 0:00:49
209500 -- [-919.906] (-921.476) (-919.698) (-921.443) * (-924.828) [-923.511] (-922.573) (-920.730) -- 0:00:49
210000 -- (-919.713) [-922.998] (-920.015) (-921.920) * (-925.216) [-921.839] (-922.302) (-921.686) -- 0:00:48
Average standard deviation of split frequencies: 0.017790
210500 -- [-919.709] (-925.108) (-922.780) (-921.952) * (-921.557) (-921.318) (-920.333) [-923.703] -- 0:00:48
211000 -- (-920.489) (-923.624) (-920.089) [-922.482] * (-920.808) [-921.322] (-919.922) (-923.215) -- 0:00:48
211500 -- (-923.318) (-920.958) (-925.774) [-920.849] * (-920.627) (-921.610) [-919.726] (-922.482) -- 0:00:48
212000 -- (-923.280) (-920.936) [-922.643] (-920.966) * (-920.630) (-921.073) [-921.450] (-920.074) -- 0:00:48
212500 -- [-923.482] (-921.507) (-923.097) (-922.648) * (-920.324) [-921.697] (-923.020) (-924.202) -- 0:00:48
213000 -- [-922.846] (-923.960) (-920.955) (-925.917) * (-921.917) [-921.656] (-921.945) (-925.408) -- 0:00:48
213500 -- (-923.120) [-921.650] (-923.960) (-921.535) * [-919.522] (-921.844) (-921.360) (-921.109) -- 0:00:47
214000 -- (-926.784) (-921.983) (-922.510) [-920.529] * (-923.424) (-921.339) (-923.289) [-919.872] -- 0:00:47
214500 -- [-920.535] (-922.017) (-922.451) (-922.819) * (-920.559) (-921.949) (-924.456) [-920.079] -- 0:00:51
215000 -- [-920.630] (-921.746) (-920.409) (-922.920) * (-924.374) (-922.932) (-924.475) [-921.887] -- 0:00:51
Average standard deviation of split frequencies: 0.016885
215500 -- (-926.344) [-920.977] (-921.523) (-925.136) * (-922.546) (-920.910) [-925.112] (-923.605) -- 0:00:50
216000 -- (-921.614) (-921.592) (-923.446) [-920.607] * [-920.210] (-921.127) (-924.463) (-926.625) -- 0:00:50
216500 -- (-921.633) (-921.697) (-920.779) [-921.627] * (-921.849) (-921.974) (-921.097) [-923.267] -- 0:00:50
217000 -- (-922.082) [-920.666] (-926.251) (-920.479) * [-921.494] (-924.005) (-921.006) (-922.160) -- 0:00:50
217500 -- (-921.557) [-927.085] (-927.906) (-922.996) * (-925.731) [-920.535] (-919.712) (-924.953) -- 0:00:50
218000 -- [-921.116] (-925.372) (-920.543) (-920.215) * (-925.409) (-919.721) [-924.626] (-922.107) -- 0:00:50
218500 -- (-921.386) [-923.126] (-920.542) (-922.180) * (-921.706) [-922.210] (-922.283) (-925.043) -- 0:00:50
219000 -- (-923.876) [-920.437] (-920.902) (-921.688) * (-921.497) (-920.530) (-921.483) [-920.733] -- 0:00:49
219500 -- (-922.268) [-919.806] (-920.762) (-925.841) * (-923.585) [-920.530] (-921.141) (-921.022) -- 0:00:49
220000 -- (-923.547) (-920.138) (-921.100) [-922.921] * [-921.299] (-925.590) (-920.423) (-922.397) -- 0:00:49
Average standard deviation of split frequencies: 0.015629
220500 -- (-923.608) (-920.425) [-922.029] (-921.323) * (-921.002) (-919.825) [-920.887] (-920.204) -- 0:00:49
221000 -- (-923.063) (-921.767) (-920.492) [-919.980] * [-921.270] (-921.179) (-923.767) (-921.472) -- 0:00:49
221500 -- (-920.420) (-922.709) [-921.057] (-921.576) * [-921.353] (-920.354) (-920.255) (-920.229) -- 0:00:49
222000 -- (-922.366) (-922.089) (-921.212) [-924.542] * (-922.272) [-920.081] (-920.476) (-920.041) -- 0:00:49
222500 -- (-923.571) [-925.115] (-921.045) (-920.805) * (-927.728) [-923.873] (-922.759) (-920.848) -- 0:00:48
223000 -- (-920.278) (-920.824) [-920.674] (-922.227) * (-926.215) (-921.006) (-922.651) [-920.109] -- 0:00:48
223500 -- [-919.260] (-920.205) (-920.780) (-922.322) * (-923.823) (-920.110) [-921.186] (-922.575) -- 0:00:48
224000 -- [-921.698] (-921.690) (-919.851) (-919.971) * (-923.322) (-921.130) [-925.337] (-921.284) -- 0:00:48
224500 -- [-921.864] (-920.669) (-920.507) (-920.095) * (-919.735) [-920.268] (-921.486) (-920.342) -- 0:00:48
225000 -- (-923.377) (-921.077) [-920.354] (-922.845) * (-919.832) (-920.105) [-920.366] (-921.884) -- 0:00:48
Average standard deviation of split frequencies: 0.014821
225500 -- (-922.504) [-920.545] (-921.584) (-921.145) * [-921.596] (-920.191) (-924.373) (-923.154) -- 0:00:48
226000 -- (-919.684) [-921.162] (-920.431) (-923.340) * (-922.753) (-927.054) [-921.304] (-920.101) -- 0:00:47
226500 -- [-919.278] (-922.209) (-921.416) (-922.446) * (-921.882) [-922.033] (-923.083) (-923.336) -- 0:00:47
227000 -- (-921.248) [-921.022] (-925.334) (-921.142) * (-920.129) [-922.149] (-921.590) (-921.324) -- 0:00:47
227500 -- (-921.178) [-921.708] (-925.535) (-921.971) * [-923.241] (-921.444) (-921.799) (-923.951) -- 0:00:47
228000 -- [-919.948] (-922.019) (-924.954) (-923.705) * [-919.886] (-921.757) (-921.163) (-922.297) -- 0:00:47
228500 -- (-921.346) [-921.121] (-923.595) (-920.370) * (-922.578) (-922.182) [-920.478] (-922.046) -- 0:00:47
229000 -- (-919.905) (-920.346) [-922.381] (-919.747) * (-922.666) [-922.178] (-919.852) (-921.918) -- 0:00:47
229500 -- (-920.336) (-922.620) [-919.728] (-921.688) * (-920.253) (-925.736) (-920.382) [-919.415] -- 0:00:47
230000 -- [-920.767] (-926.807) (-921.259) (-921.487) * (-920.132) (-923.100) (-921.096) [-919.962] -- 0:00:46
Average standard deviation of split frequencies: 0.015811
230500 -- [-924.076] (-922.999) (-922.131) (-921.005) * (-920.130) (-922.485) [-920.736] (-924.117) -- 0:00:46
231000 -- [-922.471] (-919.898) (-919.773) (-921.846) * (-919.465) (-921.732) (-924.320) [-923.543] -- 0:00:49
231500 -- (-922.977) (-920.971) (-919.531) [-921.767] * (-922.610) [-921.234] (-921.893) (-922.326) -- 0:00:49
232000 -- (-920.193) (-920.444) (-923.330) [-920.932] * (-925.938) [-920.803] (-920.240) (-921.175) -- 0:00:49
232500 -- (-922.346) (-921.865) [-919.415] (-922.391) * [-921.983] (-920.553) (-920.142) (-920.467) -- 0:00:49
233000 -- [-922.975] (-923.250) (-919.913) (-923.348) * [-925.731] (-920.877) (-924.128) (-921.584) -- 0:00:49
233500 -- (-921.556) (-920.040) [-920.143] (-922.090) * [-921.714] (-920.736) (-921.262) (-922.178) -- 0:00:49
234000 -- [-921.129] (-921.709) (-922.172) (-925.019) * (-919.448) (-920.139) [-921.843] (-923.259) -- 0:00:49
234500 -- [-921.340] (-921.831) (-920.532) (-919.713) * (-924.201) (-920.171) [-920.575] (-921.843) -- 0:00:48
235000 -- (-930.719) [-920.604] (-919.735) (-922.176) * (-921.066) [-924.150] (-922.286) (-922.124) -- 0:00:48
Average standard deviation of split frequencies: 0.015869
235500 -- [-921.403] (-924.181) (-922.026) (-927.712) * (-920.348) (-923.524) [-923.241] (-924.077) -- 0:00:48
236000 -- (-923.522) [-925.768] (-922.020) (-931.345) * (-920.706) [-920.401] (-921.782) (-927.215) -- 0:00:48
236500 -- (-921.466) (-921.433) [-922.346] (-923.702) * (-925.346) [-920.380] (-923.520) (-925.713) -- 0:00:48
237000 -- (-921.647) (-923.627) (-921.556) [-923.257] * (-921.075) (-925.088) [-924.213] (-922.493) -- 0:00:48
237500 -- (-921.182) [-921.078] (-920.203) (-922.299) * [-925.424] (-920.929) (-920.405) (-921.254) -- 0:00:48
238000 -- (-921.682) (-921.896) (-922.005) [-921.798] * (-922.511) [-926.941] (-921.161) (-922.134) -- 0:00:48
238500 -- [-923.010] (-920.029) (-921.326) (-920.559) * (-921.152) (-925.845) [-919.842] (-924.327) -- 0:00:47
239000 -- (-921.887) (-920.612) [-922.061] (-922.300) * (-920.915) (-921.268) (-923.007) [-921.961] -- 0:00:47
239500 -- (-921.035) (-922.714) [-921.406] (-923.082) * (-920.935) [-923.969] (-922.195) (-920.142) -- 0:00:47
240000 -- [-923.499] (-920.850) (-921.181) (-923.417) * [-920.192] (-923.076) (-922.667) (-926.368) -- 0:00:47
Average standard deviation of split frequencies: 0.015235
240500 -- [-922.007] (-921.277) (-921.368) (-921.958) * (-921.947) [-920.679] (-921.937) (-922.069) -- 0:00:47
241000 -- (-920.230) (-924.431) [-923.703] (-920.201) * (-924.019) (-920.595) [-920.469] (-921.507) -- 0:00:47
241500 -- (-924.091) [-921.688] (-921.475) (-921.601) * (-920.237) (-923.576) (-919.726) [-920.141] -- 0:00:47
242000 -- (-927.619) (-926.051) (-923.897) [-924.854] * (-920.638) (-924.867) [-921.497] (-920.302) -- 0:00:46
242500 -- (-922.534) (-920.903) [-926.639] (-922.530) * (-920.596) [-919.802] (-920.073) (-920.190) -- 0:00:46
243000 -- (-921.625) (-922.533) [-923.073] (-923.814) * [-919.922] (-922.671) (-922.972) (-921.017) -- 0:00:46
243500 -- (-922.886) [-921.001] (-921.708) (-919.628) * (-920.719) (-923.378) (-921.683) [-920.127] -- 0:00:46
244000 -- (-921.232) [-920.782] (-921.518) (-921.948) * (-923.530) [-925.287] (-920.959) (-926.206) -- 0:00:46
244500 -- (-922.206) [-920.944] (-922.574) (-919.863) * (-919.664) (-925.396) [-921.004] (-922.668) -- 0:00:46
245000 -- (-926.172) (-921.583) (-923.734) [-920.278] * (-922.459) (-924.962) [-921.999] (-925.862) -- 0:00:46
Average standard deviation of split frequencies: 0.016440
245500 -- (-921.391) [-921.759] (-922.043) (-920.082) * (-921.650) (-929.830) (-922.594) [-925.107] -- 0:00:46
246000 -- (-921.716) (-924.141) [-921.937] (-920.788) * [-923.601] (-922.959) (-920.608) (-923.974) -- 0:00:45
246500 -- (-921.340) (-921.338) [-920.677] (-922.548) * (-922.322) (-921.992) (-921.912) [-923.450] -- 0:00:45
247000 -- (-922.764) (-922.912) (-923.557) [-919.508] * (-921.970) [-920.355] (-920.577) (-926.709) -- 0:00:45
247500 -- (-921.318) (-921.343) (-926.228) [-924.520] * [-921.728] (-920.217) (-922.252) (-926.068) -- 0:00:48
248000 -- [-920.219] (-923.543) (-925.817) (-926.620) * (-921.012) (-920.356) (-921.678) [-921.545] -- 0:00:48
248500 -- (-923.545) (-921.151) [-922.196] (-920.745) * (-921.669) (-920.409) [-920.199] (-924.898) -- 0:00:48
249000 -- (-922.965) (-921.191) (-922.352) [-921.914] * (-924.318) (-919.976) [-919.772] (-922.103) -- 0:00:48
249500 -- (-921.099) (-921.575) [-919.913] (-919.688) * (-922.601) [-920.493] (-919.959) (-923.516) -- 0:00:48
250000 -- (-920.840) [-920.895] (-924.064) (-922.392) * (-924.124) [-922.998] (-922.417) (-922.057) -- 0:00:48
Average standard deviation of split frequencies: 0.015985
250500 -- (-921.432) (-920.319) (-925.475) [-922.147] * [-919.833] (-922.634) (-920.450) (-920.823) -- 0:00:47
251000 -- (-923.093) (-921.299) (-924.619) [-922.038] * [-919.844] (-922.439) (-920.052) (-920.198) -- 0:00:47
251500 -- (-921.719) (-925.328) (-920.891) [-922.496] * (-923.704) (-922.486) (-923.798) [-920.879] -- 0:00:47
252000 -- (-920.610) (-920.573) (-919.576) [-923.482] * (-921.561) (-922.531) [-921.339] (-920.420) -- 0:00:47
252500 -- (-920.213) [-919.339] (-920.575) (-920.897) * [-922.248] (-919.362) (-921.023) (-924.535) -- 0:00:47
253000 -- (-920.120) [-919.428] (-923.560) (-921.157) * (-922.731) (-920.918) [-921.021] (-924.799) -- 0:00:47
253500 -- (-920.579) [-920.906] (-921.352) (-925.361) * [-922.186] (-920.708) (-923.590) (-921.436) -- 0:00:47
254000 -- (-920.995) (-922.608) (-920.435) [-922.799] * (-921.096) (-920.089) [-920.062] (-922.389) -- 0:00:46
254500 -- (-924.660) [-920.969] (-920.750) (-921.027) * (-920.981) (-922.021) (-921.166) [-924.387] -- 0:00:46
255000 -- (-922.003) [-921.038] (-923.406) (-924.811) * [-922.044] (-920.487) (-920.500) (-920.230) -- 0:00:46
Average standard deviation of split frequencies: 0.017084
255500 -- (-924.696) (-920.914) [-923.060] (-922.951) * (-920.812) [-920.487] (-921.096) (-920.170) -- 0:00:46
256000 -- (-924.448) [-920.580] (-922.885) (-921.232) * (-925.396) [-919.845] (-922.390) (-923.072) -- 0:00:46
256500 -- (-923.442) [-927.096] (-922.340) (-927.383) * (-924.920) [-922.740] (-920.415) (-922.113) -- 0:00:46
257000 -- (-923.550) (-928.737) (-920.897) [-923.502] * (-923.377) [-922.061] (-921.596) (-923.284) -- 0:00:46
257500 -- (-921.068) (-922.250) (-921.292) [-920.744] * [-923.111] (-920.599) (-920.106) (-922.977) -- 0:00:46
258000 -- [-921.005] (-921.745) (-921.543) (-922.681) * (-920.401) (-921.270) (-920.210) [-920.393] -- 0:00:46
258500 -- (-920.403) (-924.171) (-922.453) [-921.653] * [-920.343] (-919.974) (-920.713) (-921.565) -- 0:00:45
259000 -- (-923.617) (-924.595) (-920.719) [-919.698] * (-922.907) [-920.177] (-921.357) (-932.323) -- 0:00:45
259500 -- [-921.218] (-921.827) (-922.929) (-924.129) * (-921.160) (-920.233) (-921.280) [-923.337] -- 0:00:45
260000 -- (-923.712) (-921.076) (-922.531) [-921.823] * [-921.077] (-920.263) (-923.154) (-921.500) -- 0:00:45
Average standard deviation of split frequencies: 0.017381
260500 -- (-929.553) (-922.675) [-919.991] (-923.989) * [-921.797] (-921.335) (-921.236) (-925.920) -- 0:00:45
261000 -- [-922.662] (-922.464) (-920.167) (-923.885) * (-923.942) (-923.720) [-920.690] (-925.140) -- 0:00:45
261500 -- (-922.961) (-922.740) (-926.525) [-920.611] * (-922.883) [-922.038] (-920.654) (-921.483) -- 0:00:45
262000 -- (-924.101) [-924.008] (-919.441) (-923.461) * (-926.306) (-920.194) [-919.950] (-922.112) -- 0:00:45
262500 -- [-921.325] (-920.910) (-924.683) (-923.963) * [-920.997] (-919.437) (-920.620) (-927.538) -- 0:00:44
263000 -- (-923.298) (-924.094) (-922.712) [-920.791] * (-922.689) (-919.542) (-919.873) [-920.364] -- 0:00:44
263500 -- (-924.086) (-924.447) (-922.697) [-921.965] * (-920.504) (-924.028) (-924.781) [-920.778] -- 0:00:44
264000 -- (-925.701) (-922.300) [-919.701] (-925.554) * [-925.475] (-921.639) (-921.784) (-920.950) -- 0:00:47
264500 -- (-922.920) (-921.908) (-923.086) [-919.850] * (-920.529) (-925.486) [-921.503] (-922.846) -- 0:00:47
265000 -- (-920.836) (-923.319) (-921.630) [-920.227] * (-920.640) [-923.607] (-922.812) (-922.451) -- 0:00:47
Average standard deviation of split frequencies: 0.017722
265500 -- (-925.645) (-921.710) [-921.042] (-919.830) * (-921.986) [-922.511] (-921.207) (-920.646) -- 0:00:47
266000 -- (-927.134) (-919.820) (-922.516) [-921.116] * (-921.101) [-921.747] (-922.365) (-922.591) -- 0:00:46
266500 -- (-922.428) (-925.578) (-921.399) [-922.197] * [-919.639] (-924.591) (-920.984) (-921.171) -- 0:00:46
267000 -- [-921.765] (-921.204) (-923.230) (-922.917) * [-920.762] (-921.434) (-920.234) (-921.348) -- 0:00:46
267500 -- [-922.498] (-920.145) (-919.918) (-920.650) * (-920.326) [-924.049] (-919.694) (-922.680) -- 0:00:46
268000 -- [-921.381] (-920.609) (-923.670) (-921.077) * [-920.948] (-921.915) (-919.669) (-925.394) -- 0:00:46
268500 -- (-922.907) [-922.690] (-922.276) (-920.136) * (-921.951) [-920.203] (-922.250) (-924.832) -- 0:00:46
269000 -- (-920.539) (-920.848) [-921.782] (-923.940) * (-923.501) [-921.132] (-921.977) (-921.844) -- 0:00:46
269500 -- [-920.054] (-920.659) (-921.674) (-922.869) * (-922.455) (-921.285) [-922.040] (-923.738) -- 0:00:46
270000 -- (-926.244) (-920.848) [-921.627] (-923.094) * (-923.684) (-921.807) [-925.528] (-920.419) -- 0:00:45
Average standard deviation of split frequencies: 0.016408
270500 -- (-921.574) [-919.359] (-929.183) (-919.518) * (-923.663) (-921.332) [-922.933] (-920.605) -- 0:00:45
271000 -- (-921.271) [-920.009] (-921.983) (-919.518) * (-926.197) (-921.797) [-922.589] (-920.660) -- 0:00:45
271500 -- (-923.955) (-920.000) (-922.668) [-919.611] * [-921.404] (-924.131) (-922.736) (-920.590) -- 0:00:45
272000 -- (-925.933) (-921.775) [-919.552] (-920.206) * [-921.486] (-923.658) (-921.417) (-922.580) -- 0:00:45
272500 -- [-924.659] (-923.474) (-919.828) (-923.653) * (-922.012) (-923.068) (-923.012) [-920.865] -- 0:00:45
273000 -- (-923.845) (-923.409) [-923.947] (-924.572) * (-919.286) [-919.997] (-922.178) (-920.826) -- 0:00:45
273500 -- [-921.848] (-925.241) (-920.819) (-922.477) * (-921.106) [-919.998] (-923.591) (-920.994) -- 0:00:45
274000 -- [-920.026] (-923.206) (-922.370) (-927.634) * (-920.551) [-923.517] (-920.703) (-921.329) -- 0:00:45
274500 -- (-919.833) [-922.806] (-922.168) (-924.963) * (-921.934) (-923.119) [-921.333] (-922.405) -- 0:00:44
275000 -- (-919.911) (-923.024) [-921.025] (-922.747) * (-922.131) [-922.826] (-926.811) (-922.269) -- 0:00:44
Average standard deviation of split frequencies: 0.016605
275500 -- [-919.965] (-921.505) (-921.235) (-921.848) * [-920.540] (-922.626) (-926.016) (-920.276) -- 0:00:44
276000 -- (-922.088) (-922.074) [-919.787] (-924.375) * (-920.909) [-921.517] (-920.626) (-920.342) -- 0:00:44
276500 -- (-920.018) (-922.985) (-921.400) [-921.998] * [-922.934] (-921.968) (-921.616) (-923.193) -- 0:00:44
277000 -- (-922.035) (-922.410) [-921.412] (-920.126) * (-920.511) (-921.684) (-921.943) [-922.350] -- 0:00:44
277500 -- (-921.542) [-922.415] (-922.833) (-926.667) * (-920.180) [-920.598] (-922.460) (-921.611) -- 0:00:44
278000 -- (-921.981) (-921.318) [-922.153] (-923.803) * [-920.699] (-921.391) (-923.051) (-922.261) -- 0:00:44
278500 -- (-922.868) [-922.232] (-925.687) (-925.896) * [-920.721] (-919.835) (-922.020) (-921.683) -- 0:00:44
279000 -- (-927.332) (-922.407) [-920.887] (-921.427) * [-923.237] (-920.786) (-923.543) (-921.417) -- 0:00:43
279500 -- (-923.992) [-923.338] (-922.971) (-921.094) * (-922.355) (-921.241) [-920.728] (-922.387) -- 0:00:43
280000 -- [-921.251] (-921.337) (-920.969) (-922.579) * [-920.467] (-921.657) (-921.255) (-923.332) -- 0:00:43
Average standard deviation of split frequencies: 0.015228
280500 -- (-923.654) (-920.856) [-921.979] (-919.711) * [-920.510] (-921.242) (-922.259) (-920.535) -- 0:00:46
281000 -- (-920.523) (-920.019) [-920.760] (-920.127) * (-922.464) (-923.611) [-920.351] (-925.342) -- 0:00:46
281500 -- (-920.739) (-921.604) [-921.212] (-921.886) * (-923.205) [-921.733] (-921.201) (-921.279) -- 0:00:45
282000 -- (-922.568) (-922.775) (-922.413) [-925.836] * (-926.263) [-924.677] (-923.364) (-920.455) -- 0:00:45
282500 -- [-922.425] (-922.812) (-921.656) (-920.497) * (-922.349) (-922.180) [-919.995] (-920.177) -- 0:00:45
283000 -- [-922.483] (-922.549) (-924.003) (-921.817) * (-922.296) [-922.184] (-920.131) (-924.792) -- 0:00:45
283500 -- (-927.470) [-924.107] (-924.159) (-919.424) * [-921.139] (-921.615) (-926.358) (-922.267) -- 0:00:45
284000 -- (-922.714) [-920.113] (-925.645) (-922.389) * (-921.815) (-926.490) [-922.084] (-922.515) -- 0:00:45
284500 -- [-921.492] (-921.677) (-925.541) (-923.174) * (-921.703) [-921.788] (-922.530) (-924.157) -- 0:00:45
285000 -- (-919.941) (-921.550) (-925.437) [-926.925] * (-920.943) (-920.132) [-923.174] (-922.083) -- 0:00:45
Average standard deviation of split frequencies: 0.015319
285500 -- (-931.051) (-922.271) [-922.798] (-924.833) * (-925.800) [-919.858] (-923.315) (-923.736) -- 0:00:45
286000 -- [-922.642] (-920.291) (-925.851) (-922.541) * [-922.537] (-921.732) (-922.732) (-925.557) -- 0:00:44
286500 -- (-919.712) (-922.911) (-924.306) [-920.474] * (-920.382) [-920.508] (-920.463) (-922.601) -- 0:00:44
287000 -- (-920.275) (-922.082) (-922.261) [-920.024] * [-921.629] (-921.678) (-921.096) (-922.787) -- 0:00:44
287500 -- [-921.175] (-925.853) (-924.421) (-925.978) * (-923.795) (-924.052) [-921.643] (-921.726) -- 0:00:44
288000 -- (-921.709) (-922.449) (-923.760) [-926.748] * [-923.585] (-926.953) (-921.580) (-920.313) -- 0:00:44
288500 -- (-919.519) (-921.871) (-920.638) [-922.432] * (-921.869) (-923.354) (-922.002) [-920.157] -- 0:00:44
289000 -- (-923.831) [-920.805] (-922.809) (-925.352) * (-923.378) [-923.306] (-922.390) (-920.156) -- 0:00:44
289500 -- (-920.703) (-921.033) (-920.699) [-923.382] * (-922.431) [-923.549] (-920.130) (-922.052) -- 0:00:44
290000 -- [-920.289] (-920.713) (-923.914) (-922.743) * (-922.166) [-927.960] (-924.840) (-922.908) -- 0:00:44
Average standard deviation of split frequencies: 0.014692
290500 -- (-921.236) (-921.106) (-921.161) [-921.610] * (-921.315) [-920.139] (-922.002) (-924.324) -- 0:00:43
291000 -- (-920.682) (-922.997) [-922.716] (-921.941) * (-924.568) (-920.298) (-925.461) [-920.120] -- 0:00:43
291500 -- (-921.779) (-920.126) [-922.708] (-922.293) * [-921.044] (-929.770) (-921.254) (-920.120) -- 0:00:43
292000 -- (-922.729) [-919.557] (-924.534) (-922.398) * [-920.987] (-929.684) (-923.391) (-921.703) -- 0:00:43
292500 -- [-921.764] (-920.005) (-922.165) (-924.383) * (-924.583) (-923.285) (-923.288) [-919.801] -- 0:00:43
293000 -- (-921.485) (-919.765) (-922.483) [-922.921] * (-923.875) [-926.081] (-921.982) (-920.665) -- 0:00:43
293500 -- (-930.795) [-919.458] (-923.024) (-920.814) * (-921.615) (-921.128) (-923.549) [-919.568] -- 0:00:43
294000 -- (-927.566) (-920.178) [-922.468] (-923.329) * (-921.536) [-922.092] (-922.558) (-919.503) -- 0:00:43
294500 -- [-924.129] (-921.106) (-921.775) (-922.383) * (-919.702) (-920.431) (-927.044) [-922.185] -- 0:00:43
295000 -- (-921.540) [-923.127] (-922.081) (-924.318) * (-920.539) (-920.578) [-919.219] (-919.860) -- 0:00:43
Average standard deviation of split frequencies: 0.015130
295500 -- (-920.089) (-924.736) [-921.100] (-922.000) * (-923.483) (-922.555) [-919.570] (-922.574) -- 0:00:42
296000 -- (-923.372) (-921.111) (-920.473) [-923.108] * (-921.638) (-922.465) [-919.780] (-920.976) -- 0:00:42
296500 -- (-921.748) (-920.358) (-927.929) [-919.750] * (-920.874) [-920.725] (-920.819) (-920.998) -- 0:00:42
297000 -- (-926.359) (-921.672) [-926.459] (-922.677) * (-920.304) (-919.862) (-921.305) [-920.876] -- 0:00:42
297500 -- (-923.586) (-920.768) (-922.554) [-921.735] * (-923.830) (-919.802) (-922.836) [-920.840] -- 0:00:44
298000 -- (-924.327) (-920.409) [-925.805] (-922.093) * (-920.998) [-924.201] (-920.922) (-920.529) -- 0:00:44
298500 -- (-924.000) (-920.999) [-926.479] (-920.738) * (-922.490) [-925.730] (-920.802) (-919.954) -- 0:00:44
299000 -- [-922.537] (-924.150) (-921.383) (-921.899) * (-921.868) [-926.685] (-920.417) (-923.615) -- 0:00:44
299500 -- (-921.555) (-922.488) (-920.366) [-921.036] * (-922.666) [-922.285] (-920.488) (-922.849) -- 0:00:44
300000 -- [-922.538] (-922.641) (-921.885) (-921.804) * (-920.593) [-920.426] (-921.752) (-924.909) -- 0:00:44
Average standard deviation of split frequencies: 0.014797
300500 -- (-921.551) (-920.849) (-922.509) [-921.791] * [-921.911] (-920.895) (-921.242) (-919.991) -- 0:00:44
301000 -- (-921.969) [-921.362] (-921.955) (-922.412) * (-920.725) (-920.352) [-922.506] (-920.139) -- 0:00:44
301500 -- (-925.292) (-920.913) (-920.824) [-921.062] * (-922.053) (-920.805) [-921.462] (-922.364) -- 0:00:44
302000 -- (-926.583) (-924.888) (-920.662) [-922.128] * (-921.729) [-920.097] (-920.203) (-921.669) -- 0:00:43
302500 -- (-922.684) [-921.402] (-923.920) (-920.880) * (-923.393) [-921.728] (-920.987) (-920.954) -- 0:00:43
303000 -- (-921.232) (-924.095) [-920.007] (-921.497) * [-926.764] (-922.344) (-920.388) (-922.765) -- 0:00:43
303500 -- [-922.029] (-924.415) (-919.741) (-922.682) * [-925.307] (-920.455) (-922.029) (-923.228) -- 0:00:43
304000 -- (-921.126) (-924.242) (-920.246) [-920.739] * [-922.636] (-921.132) (-922.812) (-924.591) -- 0:00:43
304500 -- (-920.215) [-923.557] (-921.846) (-921.771) * [-920.435] (-921.915) (-922.183) (-923.140) -- 0:00:43
305000 -- (-921.278) [-921.084] (-920.489) (-921.769) * (-922.244) [-919.476] (-922.738) (-920.335) -- 0:00:43
Average standard deviation of split frequencies: 0.014154
305500 -- (-921.138) [-922.182] (-920.796) (-921.383) * (-922.256) (-919.971) [-921.064] (-920.300) -- 0:00:43
306000 -- [-919.779] (-923.058) (-921.150) (-921.139) * (-922.193) (-921.936) [-920.230] (-920.660) -- 0:00:43
306500 -- (-921.111) (-929.532) (-921.215) [-921.247] * (-921.417) (-923.544) [-919.861] (-919.874) -- 0:00:42
307000 -- (-922.434) (-919.693) (-921.842) [-921.639] * (-923.065) [-923.020] (-921.741) (-921.420) -- 0:00:42
307500 -- [-920.423] (-921.230) (-923.030) (-922.871) * (-920.515) (-920.814) (-921.878) [-920.287] -- 0:00:42
308000 -- (-920.604) (-925.218) [-921.253] (-926.628) * (-922.596) (-920.879) [-920.568] (-925.520) -- 0:00:42
308500 -- [-923.023] (-925.198) (-924.192) (-923.104) * (-920.974) (-920.538) [-923.654] (-922.664) -- 0:00:42
309000 -- [-919.840] (-926.212) (-922.262) (-923.152) * (-924.658) (-921.884) (-922.405) [-920.353] -- 0:00:42
309500 -- (-919.724) (-922.792) [-921.375] (-921.440) * [-921.358] (-922.297) (-921.053) (-922.006) -- 0:00:42
310000 -- (-920.407) (-921.525) (-920.781) [-920.451] * (-921.433) [-923.385] (-922.972) (-924.593) -- 0:00:42
Average standard deviation of split frequencies: 0.014510
310500 -- [-920.423] (-922.244) (-923.275) (-923.169) * [-921.137] (-922.020) (-921.940) (-920.806) -- 0:00:42
311000 -- (-923.494) [-924.158] (-922.709) (-919.598) * (-923.771) [-922.173] (-920.150) (-926.849) -- 0:00:42
311500 -- (-922.601) (-921.380) (-926.195) [-921.003] * (-927.079) (-921.023) (-923.861) [-920.316] -- 0:00:41
312000 -- (-922.536) (-922.083) [-924.405] (-922.722) * (-924.766) [-920.623] (-920.755) (-921.521) -- 0:00:41
312500 -- [-919.986] (-921.180) (-922.591) (-921.284) * (-923.040) [-919.827] (-922.062) (-923.711) -- 0:00:41
313000 -- (-922.001) (-921.779) (-928.002) [-920.740] * (-921.524) (-920.351) [-921.729] (-921.762) -- 0:00:41
313500 -- (-921.220) (-925.695) (-919.937) [-921.096] * (-925.225) [-921.817] (-920.706) (-921.821) -- 0:00:41
314000 -- [-922.222] (-921.707) (-920.850) (-923.460) * (-924.284) (-920.879) [-919.784] (-927.826) -- 0:00:43
314500 -- (-919.603) (-920.845) [-921.454] (-923.043) * (-921.977) (-922.316) (-923.997) [-924.375] -- 0:00:43
315000 -- (-921.541) (-921.501) (-920.223) [-921.849] * (-921.430) (-923.377) [-922.026] (-927.578) -- 0:00:43
Average standard deviation of split frequencies: 0.014545
315500 -- (-922.142) [-924.514] (-920.910) (-920.896) * (-921.154) [-921.800] (-922.341) (-926.913) -- 0:00:43
316000 -- (-920.479) (-921.885) (-921.868) [-920.877] * (-920.800) [-921.827] (-920.840) (-922.405) -- 0:00:43
316500 -- [-920.115] (-920.601) (-923.180) (-922.479) * (-920.080) [-923.146] (-928.365) (-923.645) -- 0:00:43
317000 -- [-919.811] (-923.274) (-919.705) (-920.923) * [-919.450] (-919.483) (-930.256) (-919.553) -- 0:00:43
317500 -- [-920.241] (-922.306) (-921.309) (-921.392) * (-920.674) [-923.895] (-925.567) (-919.506) -- 0:00:42
318000 -- (-919.642) (-920.903) (-921.867) [-921.756] * (-922.460) (-923.332) (-923.016) [-924.941] -- 0:00:42
318500 -- (-923.299) (-923.023) [-923.079] (-921.047) * (-920.798) (-922.868) (-923.442) [-921.273] -- 0:00:42
319000 -- (-921.320) [-921.826] (-921.672) (-920.015) * [-921.394] (-920.734) (-921.724) (-920.148) -- 0:00:42
319500 -- (-923.385) [-920.337] (-923.079) (-919.975) * (-923.608) (-922.407) (-920.585) [-921.337] -- 0:00:42
320000 -- (-921.546) (-919.930) (-921.358) [-923.825] * (-922.768) (-923.630) [-921.330] (-921.428) -- 0:00:42
Average standard deviation of split frequencies: 0.014058
320500 -- (-921.679) (-919.913) (-922.236) [-920.329] * (-920.920) (-920.704) [-919.633] (-921.114) -- 0:00:42
321000 -- (-920.226) (-924.141) [-922.369] (-921.186) * (-920.733) [-921.407] (-921.401) (-923.247) -- 0:00:42
321500 -- (-920.420) (-924.293) [-920.296] (-926.530) * (-921.303) [-923.757] (-920.748) (-924.829) -- 0:00:42
322000 -- [-920.298] (-923.538) (-920.587) (-921.952) * (-921.314) (-922.279) [-920.831] (-920.159) -- 0:00:42
322500 -- [-922.175] (-922.630) (-922.305) (-923.161) * (-921.974) (-922.004) [-922.146] (-921.069) -- 0:00:42
323000 -- (-924.288) (-919.617) [-920.420] (-920.408) * (-921.884) (-920.142) [-920.527] (-920.202) -- 0:00:41
323500 -- (-924.459) [-922.730] (-920.197) (-923.352) * (-924.108) (-920.142) [-920.055] (-923.836) -- 0:00:41
324000 -- (-924.173) [-924.242] (-922.683) (-922.204) * (-921.985) (-922.096) [-922.079] (-925.868) -- 0:00:41
324500 -- (-921.441) (-923.819) [-921.457] (-921.692) * (-921.122) (-925.591) (-922.835) [-920.972] -- 0:00:41
325000 -- (-922.642) (-922.468) [-922.693] (-922.501) * (-923.526) [-922.447] (-922.310) (-919.516) -- 0:00:41
Average standard deviation of split frequencies: 0.013285
325500 -- (-922.978) (-922.668) [-919.966] (-924.330) * (-923.316) (-921.240) [-921.755] (-920.548) -- 0:00:41
326000 -- [-919.453] (-924.769) (-920.696) (-922.951) * (-923.684) (-921.943) (-920.926) [-920.104] -- 0:00:41
326500 -- (-919.636) [-923.022] (-921.439) (-923.438) * (-923.120) (-919.695) [-921.534] (-921.532) -- 0:00:41
327000 -- [-920.545] (-921.105) (-922.383) (-921.782) * [-922.675] (-920.950) (-921.163) (-922.820) -- 0:00:41
327500 -- (-921.080) (-922.230) [-919.841] (-927.000) * (-919.531) (-920.957) [-922.596] (-920.726) -- 0:00:41
328000 -- (-920.109) (-923.388) [-922.331] (-922.598) * (-919.529) (-921.852) [-920.676] (-923.356) -- 0:00:40
328500 -- [-924.900] (-921.012) (-920.393) (-921.104) * (-922.764) (-921.433) [-923.669] (-922.288) -- 0:00:40
329000 -- (-926.881) [-920.303] (-921.186) (-921.391) * [-920.231] (-920.112) (-922.479) (-921.909) -- 0:00:40
329500 -- (-920.646) [-923.251] (-919.531) (-924.307) * (-920.416) [-921.068] (-922.045) (-923.590) -- 0:00:40
330000 -- (-920.466) [-923.168] (-920.281) (-924.060) * (-921.081) (-920.163) (-921.909) [-921.577] -- 0:00:40
Average standard deviation of split frequencies: 0.013454
330500 -- (-923.208) (-920.372) [-920.270] (-921.911) * [-923.262] (-922.742) (-921.732) (-925.685) -- 0:00:42
331000 -- [-921.023] (-921.634) (-920.153) (-923.673) * (-923.761) [-920.511] (-921.097) (-923.986) -- 0:00:42
331500 -- (-925.315) [-921.669] (-919.626) (-920.109) * (-923.241) [-920.584] (-921.383) (-920.231) -- 0:00:42
332000 -- (-923.779) (-924.210) (-924.618) [-920.758] * (-923.281) (-920.496) [-920.817] (-921.936) -- 0:00:42
332500 -- (-923.175) [-922.910] (-921.583) (-921.195) * (-921.875) (-920.157) [-924.656] (-920.454) -- 0:00:42
333000 -- (-921.838) (-923.571) [-922.163] (-920.815) * [-921.218] (-922.653) (-920.563) (-922.960) -- 0:00:42
333500 -- (-925.023) (-923.735) (-925.165) [-920.287] * [-921.475] (-922.526) (-923.922) (-923.687) -- 0:00:41
334000 -- (-920.787) (-920.907) [-921.532] (-920.688) * (-921.064) (-920.119) (-926.196) [-922.398] -- 0:00:41
334500 -- (-921.562) (-925.161) (-921.149) [-920.438] * (-920.118) (-922.220) [-922.177] (-919.919) -- 0:00:41
335000 -- (-921.188) (-921.015) (-921.115) [-920.236] * (-920.389) [-923.733] (-921.405) (-921.227) -- 0:00:41
Average standard deviation of split frequencies: 0.013241
335500 -- [-921.349] (-922.571) (-919.897) (-919.753) * (-920.210) (-920.574) (-922.421) [-922.094] -- 0:00:41
336000 -- (-920.120) (-922.711) (-920.903) [-921.373] * (-921.624) (-920.357) (-923.677) [-921.024] -- 0:00:41
336500 -- (-920.306) (-922.390) [-920.770] (-926.496) * (-923.403) (-920.423) (-920.794) [-920.682] -- 0:00:41
337000 -- (-920.190) (-921.637) (-922.964) [-921.491] * (-919.570) [-922.155] (-919.899) (-920.763) -- 0:00:41
337500 -- (-920.070) (-920.857) (-927.364) [-924.570] * (-919.584) [-924.007] (-921.927) (-921.282) -- 0:00:41
338000 -- [-921.131] (-920.665) (-921.291) (-920.093) * (-920.288) [-921.460] (-920.211) (-920.040) -- 0:00:41
338500 -- (-921.234) (-921.771) (-920.665) [-920.243] * (-919.852) (-921.711) [-921.078] (-921.970) -- 0:00:41
339000 -- (-922.945) (-919.877) [-923.114] (-919.772) * [-919.885] (-920.793) (-921.881) (-921.277) -- 0:00:40
339500 -- (-919.387) (-921.329) [-920.112] (-925.539) * [-920.203] (-924.009) (-923.469) (-922.089) -- 0:00:40
340000 -- (-920.691) [-920.138] (-921.297) (-922.465) * (-920.358) (-923.921) (-920.736) [-920.286] -- 0:00:40
Average standard deviation of split frequencies: 0.012281
340500 -- (-921.877) (-921.169) [-922.053] (-922.214) * (-920.862) [-922.918] (-920.332) (-919.965) -- 0:00:40
341000 -- [-919.301] (-920.550) (-920.934) (-920.077) * (-921.898) (-920.089) (-920.539) [-919.844] -- 0:00:40
341500 -- (-920.467) (-922.369) (-919.782) [-920.603] * [-921.316] (-920.927) (-921.958) (-921.168) -- 0:00:40
342000 -- (-921.658) (-921.294) (-920.448) [-925.057] * (-921.316) [-920.655] (-921.033) (-921.557) -- 0:00:40
342500 -- (-922.798) (-921.666) (-920.782) [-920.700] * [-922.289] (-921.576) (-920.142) (-922.015) -- 0:00:40
343000 -- (-922.345) [-920.353] (-922.378) (-919.172) * [-922.501] (-922.024) (-920.824) (-923.797) -- 0:00:40
343500 -- (-922.267) (-920.967) (-921.902) [-919.714] * [-920.248] (-921.321) (-923.800) (-933.070) -- 0:00:40
344000 -- (-921.453) [-922.371] (-922.907) (-921.284) * (-921.731) (-922.829) (-922.230) [-922.087] -- 0:00:40
344500 -- (-928.028) [-920.707] (-922.398) (-923.166) * (-921.654) (-928.057) (-924.749) [-922.296] -- 0:00:39
345000 -- (-922.049) [-919.363] (-922.379) (-920.944) * (-922.572) (-923.895) (-920.096) [-921.631] -- 0:00:39
Average standard deviation of split frequencies: 0.011701
345500 -- (-919.993) [-921.594] (-923.276) (-921.622) * [-922.738] (-922.417) (-921.392) (-922.274) -- 0:00:39
346000 -- (-920.732) (-922.870) [-921.010] (-919.640) * (-922.407) (-921.078) [-920.996] (-922.111) -- 0:00:39
346500 -- (-923.483) [-922.037] (-921.116) (-921.391) * (-921.937) (-920.834) (-921.281) [-923.592] -- 0:00:39
347000 -- (-923.122) (-921.113) [-924.937] (-920.203) * (-924.345) (-921.309) (-921.836) [-921.181] -- 0:00:41
347500 -- (-921.064) [-920.969] (-922.476) (-920.686) * (-925.245) [-920.124] (-923.306) (-922.274) -- 0:00:41
348000 -- [-922.538] (-925.160) (-925.115) (-921.856) * [-923.616] (-921.899) (-923.644) (-921.198) -- 0:00:41
348500 -- (-925.303) (-920.660) (-920.218) [-920.529] * (-927.144) (-920.568) (-923.182) [-921.076] -- 0:00:41
349000 -- (-921.533) (-920.897) (-921.633) [-919.505] * (-925.032) (-922.774) [-922.151] (-921.191) -- 0:00:41
349500 -- (-920.938) [-920.489] (-922.114) (-919.242) * (-919.674) (-923.232) [-922.822] (-921.699) -- 0:00:40
350000 -- (-922.732) [-921.427] (-921.202) (-921.543) * (-920.911) (-920.506) (-921.660) [-922.246] -- 0:00:40
Average standard deviation of split frequencies: 0.011229
350500 -- (-920.498) (-920.409) (-922.595) [-921.888] * (-920.437) [-922.728] (-923.050) (-922.080) -- 0:00:40
351000 -- (-920.772) (-920.412) (-920.097) [-922.078] * (-920.808) (-919.612) [-921.565] (-922.254) -- 0:00:40
351500 -- [-921.142] (-923.649) (-921.906) (-921.830) * [-921.416] (-925.779) (-922.569) (-920.918) -- 0:00:40
352000 -- (-922.650) (-920.921) [-920.890] (-925.343) * (-922.119) (-921.664) [-921.005] (-923.327) -- 0:00:40
352500 -- (-926.864) [-921.700] (-919.383) (-925.045) * (-920.418) (-920.982) [-921.482] (-922.086) -- 0:00:40
353000 -- (-923.628) (-923.679) [-921.528] (-925.151) * (-922.826) [-921.649] (-921.773) (-921.406) -- 0:00:40
353500 -- (-923.357) (-925.045) [-922.287] (-920.253) * (-921.275) [-920.524] (-919.969) (-922.387) -- 0:00:40
354000 -- (-925.014) [-921.270] (-919.664) (-919.973) * [-921.061] (-920.630) (-922.234) (-923.286) -- 0:00:40
354500 -- (-923.689) (-921.840) (-921.988) [-919.822] * (-921.295) (-920.430) (-920.518) [-921.896] -- 0:00:40
355000 -- (-920.124) (-920.622) (-919.530) [-921.313] * (-920.009) [-920.534] (-924.215) (-920.435) -- 0:00:39
Average standard deviation of split frequencies: 0.010204
355500 -- (-921.543) [-922.247] (-919.467) (-926.004) * [-921.858] (-922.979) (-920.355) (-922.310) -- 0:00:39
356000 -- (-925.681) (-920.446) (-921.113) [-922.328] * [-919.938] (-924.342) (-920.613) (-922.901) -- 0:00:39
356500 -- [-923.247] (-920.339) (-923.984) (-924.803) * (-921.777) (-922.788) [-921.648] (-921.070) -- 0:00:39
357000 -- (-921.172) [-920.090] (-921.201) (-920.462) * [-920.665] (-923.873) (-927.458) (-922.407) -- 0:00:39
357500 -- (-921.882) [-919.922] (-922.475) (-921.557) * [-922.047] (-926.222) (-920.302) (-921.607) -- 0:00:39
358000 -- [-921.073] (-920.542) (-926.923) (-919.723) * [-923.807] (-922.940) (-921.148) (-921.439) -- 0:00:39
358500 -- [-924.656] (-920.021) (-923.544) (-920.020) * (-921.641) [-922.378] (-920.395) (-920.134) -- 0:00:39
359000 -- (-923.191) [-921.075] (-925.139) (-920.752) * [-923.561] (-925.272) (-922.904) (-922.560) -- 0:00:39
359500 -- (-920.593) [-921.275] (-920.537) (-927.562) * [-923.189] (-920.641) (-926.046) (-922.344) -- 0:00:39
360000 -- (-924.757) (-920.114) (-921.797) [-921.568] * [-919.995] (-920.700) (-921.472) (-920.553) -- 0:00:39
Average standard deviation of split frequencies: 0.010456
360500 -- [-920.291] (-926.157) (-924.398) (-920.111) * (-924.179) (-922.365) (-920.120) [-920.370] -- 0:00:39
361000 -- [-920.880] (-926.806) (-926.756) (-922.076) * (-924.651) [-920.899] (-920.176) (-921.148) -- 0:00:38
361500 -- (-923.186) [-923.995] (-920.541) (-925.856) * (-921.636) (-924.814) [-920.455] (-922.757) -- 0:00:38
362000 -- (-921.073) [-920.759] (-923.340) (-924.354) * (-922.603) (-923.719) (-922.553) [-919.914] -- 0:00:38
362500 -- (-921.281) (-919.939) (-921.025) [-921.385] * [-921.930] (-922.057) (-927.783) (-919.830) -- 0:00:38
363000 -- (-922.039) (-922.588) [-920.836] (-921.547) * (-921.318) (-919.612) (-922.335) [-921.115] -- 0:00:38
363500 -- [-921.568] (-921.721) (-922.442) (-922.344) * (-920.888) (-919.612) [-921.026] (-921.973) -- 0:00:38
364000 -- (-921.790) (-922.362) [-921.995] (-921.505) * [-923.268] (-923.634) (-923.651) (-924.934) -- 0:00:40
364500 -- [-919.597] (-919.452) (-924.838) (-921.770) * (-920.214) (-920.162) [-920.672] (-925.088) -- 0:00:40
365000 -- (-920.098) (-921.673) [-921.647] (-925.515) * (-919.939) (-921.957) (-919.530) [-922.693] -- 0:00:40
Average standard deviation of split frequencies: 0.009982
365500 -- (-922.894) (-921.455) [-920.520] (-923.199) * (-920.893) [-919.563] (-923.549) (-920.507) -- 0:00:39
366000 -- (-922.959) (-921.693) [-920.213] (-922.969) * [-922.140] (-920.669) (-921.448) (-921.076) -- 0:00:39
366500 -- (-921.572) [-919.727] (-922.720) (-923.152) * [-921.566] (-922.495) (-921.371) (-928.805) -- 0:00:39
367000 -- [-922.910] (-925.647) (-922.283) (-920.736) * (-921.352) (-921.415) [-920.548] (-921.471) -- 0:00:39
367500 -- (-920.554) [-919.375] (-925.725) (-923.326) * (-927.728) [-920.505] (-923.857) (-921.919) -- 0:00:39
368000 -- (-921.820) [-924.680] (-922.223) (-922.914) * (-920.368) (-921.550) (-920.765) [-920.322] -- 0:00:39
368500 -- [-921.296] (-922.415) (-922.222) (-920.482) * (-920.827) [-921.021] (-922.185) (-924.507) -- 0:00:39
369000 -- [-921.498] (-922.543) (-921.517) (-922.275) * (-920.948) (-920.550) [-921.010] (-922.466) -- 0:00:39
369500 -- (-920.968) (-920.830) (-920.993) [-923.002] * [-921.712] (-921.855) (-921.962) (-920.202) -- 0:00:39
370000 -- [-926.361] (-922.099) (-921.256) (-925.179) * (-919.664) (-920.627) [-921.986] (-919.896) -- 0:00:39
Average standard deviation of split frequencies: 0.010254
370500 -- [-923.858] (-921.275) (-924.812) (-925.187) * (-921.300) (-922.050) [-922.387] (-921.742) -- 0:00:39
371000 -- [-920.840] (-920.853) (-925.846) (-925.738) * (-921.310) (-923.289) (-920.657) [-921.604] -- 0:00:38
371500 -- (-921.366) (-919.813) (-919.816) [-919.973] * (-921.466) [-919.686] (-919.839) (-920.177) -- 0:00:38
372000 -- (-920.964) [-921.681] (-923.588) (-925.366) * [-923.763] (-922.990) (-921.393) (-919.661) -- 0:00:38
372500 -- (-921.031) (-922.714) [-922.696] (-921.276) * (-921.964) (-924.632) (-923.732) [-920.557] -- 0:00:38
373000 -- (-920.498) (-921.428) [-923.085] (-920.053) * [-922.081] (-924.824) (-923.001) (-922.351) -- 0:00:38
373500 -- (-921.828) (-921.381) [-922.403] (-919.863) * [-920.339] (-922.241) (-922.715) (-921.880) -- 0:00:38
374000 -- [-920.481] (-920.795) (-920.641) (-920.698) * (-923.256) (-923.370) (-924.086) [-922.367] -- 0:00:38
374500 -- (-922.969) [-921.177] (-922.239) (-920.292) * [-921.544] (-922.316) (-924.807) (-922.461) -- 0:00:38
375000 -- [-919.852] (-919.956) (-921.987) (-921.272) * (-921.880) [-922.732] (-921.570) (-919.651) -- 0:00:38
Average standard deviation of split frequencies: 0.009952
375500 -- [-922.687] (-921.871) (-923.731) (-925.233) * (-920.805) [-925.974] (-923.654) (-922.934) -- 0:00:38
376000 -- (-920.186) (-920.487) (-921.950) [-921.842] * (-922.751) [-924.271] (-924.100) (-920.899) -- 0:00:38
376500 -- (-919.762) (-919.834) [-921.226] (-921.772) * (-922.881) (-923.406) [-920.619] (-921.926) -- 0:00:38
377000 -- [-921.667] (-921.921) (-920.043) (-920.526) * (-921.547) (-924.362) [-920.170] (-922.253) -- 0:00:38
377500 -- [-923.411] (-923.559) (-920.390) (-922.510) * [-921.606] (-922.683) (-920.334) (-924.149) -- 0:00:37
378000 -- [-920.473] (-921.391) (-921.931) (-927.156) * (-920.631) [-922.748] (-923.186) (-922.125) -- 0:00:37
378500 -- (-922.301) (-922.456) (-924.782) [-922.959] * [-924.776] (-922.043) (-921.279) (-921.940) -- 0:00:37
379000 -- (-921.313) [-922.002] (-920.453) (-922.864) * (-925.765) (-920.798) (-922.582) [-922.673] -- 0:00:37
379500 -- (-920.630) (-921.361) (-920.946) [-920.894] * [-923.530] (-922.540) (-923.341) (-921.871) -- 0:00:37
380000 -- (-922.191) (-921.368) (-921.605) [-925.616] * (-921.452) (-922.179) (-923.323) [-920.718] -- 0:00:37
Average standard deviation of split frequencies: 0.009412
380500 -- (-924.016) [-921.286] (-920.863) (-924.278) * (-925.371) (-921.916) [-921.385] (-921.848) -- 0:00:39
381000 -- (-922.805) [-920.646] (-920.458) (-921.718) * (-920.386) (-923.929) [-920.564] (-920.465) -- 0:00:38
381500 -- (-921.493) [-921.066] (-920.412) (-922.217) * (-922.270) (-921.112) [-920.877] (-921.853) -- 0:00:38
382000 -- (-920.213) (-919.839) (-921.247) [-920.834] * [-920.329] (-921.141) (-920.628) (-920.511) -- 0:00:38
382500 -- [-921.576] (-923.890) (-924.788) (-920.165) * (-923.085) (-922.970) [-920.928] (-919.866) -- 0:00:38
383000 -- (-920.403) (-924.103) (-920.782) [-921.485] * [-923.807] (-921.330) (-920.513) (-923.895) -- 0:00:38
383500 -- (-922.420) [-920.460] (-921.352) (-920.696) * (-921.416) (-920.742) [-920.215] (-927.529) -- 0:00:38
384000 -- [-920.301] (-924.435) (-921.063) (-921.140) * (-923.361) (-922.308) (-920.050) [-922.280] -- 0:00:38
384500 -- (-919.831) [-922.864] (-921.033) (-919.993) * [-921.976] (-919.773) (-922.644) (-921.150) -- 0:00:38
385000 -- (-920.501) (-924.798) (-920.173) [-922.898] * (-922.894) (-920.486) (-921.150) [-919.871] -- 0:00:38
Average standard deviation of split frequencies: 0.010014
385500 -- (-921.284) (-923.895) [-921.112] (-920.669) * (-922.454) (-920.299) [-922.052] (-924.652) -- 0:00:38
386000 -- (-920.715) (-923.691) (-921.570) [-919.787] * [-922.890] (-922.142) (-920.289) (-919.635) -- 0:00:38
386500 -- (-920.495) [-923.312] (-923.766) (-921.446) * (-921.755) (-922.204) [-919.607] (-921.083) -- 0:00:38
387000 -- (-926.031) (-923.716) [-923.336] (-920.788) * (-919.491) (-924.044) (-923.161) [-921.691] -- 0:00:38
387500 -- (-924.319) (-923.027) [-920.691] (-921.381) * (-921.104) [-919.476] (-925.176) (-924.669) -- 0:00:37
388000 -- (-922.279) (-922.009) (-920.591) [-922.518] * (-920.999) (-923.478) [-929.288] (-923.857) -- 0:00:37
388500 -- [-921.199] (-919.679) (-922.492) (-924.100) * (-921.668) (-924.148) [-924.524] (-923.669) -- 0:00:37
389000 -- [-923.995] (-922.702) (-922.411) (-923.421) * (-924.311) [-921.014] (-923.320) (-920.137) -- 0:00:37
389500 -- [-919.417] (-923.311) (-926.758) (-926.695) * (-921.467) [-923.486] (-921.474) (-920.766) -- 0:00:37
390000 -- (-919.627) (-922.655) (-922.777) [-923.061] * (-920.710) [-922.636] (-920.573) (-921.687) -- 0:00:37
Average standard deviation of split frequencies: 0.010216
390500 -- (-921.637) [-921.448] (-924.111) (-920.130) * (-920.688) [-922.244] (-922.585) (-923.329) -- 0:00:37
391000 -- (-922.168) [-922.763] (-922.833) (-922.733) * (-920.481) (-920.835) (-921.673) [-922.581] -- 0:00:37
391500 -- (-922.999) (-924.264) (-923.657) [-924.512] * (-921.816) (-920.311) [-921.237] (-923.593) -- 0:00:37
392000 -- (-919.901) (-924.862) [-922.817] (-922.780) * (-921.667) (-921.076) [-920.703] (-921.127) -- 0:00:37
392500 -- (-922.163) (-920.672) [-924.884] (-921.351) * (-921.555) [-921.479] (-922.104) (-919.926) -- 0:00:37
393000 -- (-924.059) (-920.411) (-923.282) [-920.321] * [-921.034] (-925.087) (-920.564) (-920.260) -- 0:00:37
393500 -- (-921.690) (-920.550) (-926.954) [-920.971] * (-931.733) (-922.997) [-920.489] (-920.260) -- 0:00:36
394000 -- (-923.399) (-923.561) (-920.209) [-920.704] * (-921.238) (-919.795) [-920.183] (-928.171) -- 0:00:36
394500 -- (-923.334) (-922.303) (-920.706) [-921.462] * (-922.869) (-924.610) (-922.336) [-924.007] -- 0:00:36
395000 -- (-924.333) (-920.063) (-919.973) [-923.088] * [-921.224] (-920.801) (-921.952) (-926.016) -- 0:00:36
Average standard deviation of split frequencies: 0.010793
395500 -- [-921.829] (-919.952) (-925.094) (-920.494) * (-924.243) [-921.012] (-922.114) (-928.695) -- 0:00:36
396000 -- (-922.944) [-922.706] (-922.142) (-922.452) * (-923.857) (-922.913) (-922.338) [-923.400] -- 0:00:36
396500 -- (-921.935) (-923.227) [-923.778] (-923.335) * (-919.829) [-921.797] (-921.616) (-921.381) -- 0:00:38
397000 -- [-922.252] (-921.483) (-922.108) (-920.837) * (-920.948) (-924.732) (-921.822) [-925.013] -- 0:00:37
397500 -- [-923.457] (-923.684) (-921.009) (-921.820) * [-921.977] (-922.149) (-919.836) (-922.702) -- 0:00:37
398000 -- (-920.950) (-932.921) (-923.946) [-920.681] * [-922.395] (-922.313) (-920.473) (-923.243) -- 0:00:37
398500 -- (-920.674) (-925.052) [-919.866] (-922.695) * (-920.713) (-921.406) [-924.589] (-920.284) -- 0:00:37
399000 -- (-923.034) (-928.151) (-922.929) [-920.677] * (-923.082) (-922.150) (-923.515) [-920.114] -- 0:00:37
399500 -- (-921.824) (-927.465) (-921.608) [-922.207] * (-919.492) (-921.522) (-920.140) [-920.688] -- 0:00:37
400000 -- (-921.185) (-927.111) (-921.943) [-922.681] * (-919.832) (-919.867) [-920.655] (-925.276) -- 0:00:37
Average standard deviation of split frequencies: 0.011216
400500 -- (-921.486) [-920.225] (-921.108) (-923.596) * (-920.833) (-919.883) (-921.978) [-924.941] -- 0:00:37
401000 -- (-923.496) [-920.872] (-921.402) (-920.242) * (-921.537) (-933.752) [-923.853] (-923.270) -- 0:00:37
401500 -- (-920.905) [-921.421] (-923.905) (-919.330) * [-923.211] (-932.066) (-922.453) (-924.296) -- 0:00:37
402000 -- (-921.333) (-921.546) [-921.073] (-922.519) * [-925.658] (-921.139) (-922.485) (-924.428) -- 0:00:37
402500 -- [-921.351] (-921.272) (-921.680) (-922.519) * (-925.456) (-919.823) (-921.592) [-919.898] -- 0:00:37
403000 -- [-922.463] (-922.013) (-922.839) (-922.611) * (-922.011) (-921.102) [-922.509] (-920.744) -- 0:00:37
403500 -- [-921.179] (-924.449) (-922.773) (-920.844) * (-923.785) [-921.734] (-926.531) (-922.029) -- 0:00:36
404000 -- [-919.816] (-922.375) (-922.998) (-921.499) * (-921.473) (-921.061) (-920.955) [-921.282] -- 0:00:36
404500 -- (-919.578) (-921.149) [-921.072] (-921.206) * (-928.404) [-919.924] (-920.438) (-921.679) -- 0:00:36
405000 -- [-919.821] (-922.276) (-921.997) (-922.260) * (-922.764) [-921.912] (-922.624) (-921.652) -- 0:00:36
Average standard deviation of split frequencies: 0.012462
405500 -- (-920.460) [-920.733] (-925.270) (-923.299) * (-919.787) [-922.207] (-920.356) (-919.531) -- 0:00:36
406000 -- (-921.434) (-922.840) [-922.952] (-921.214) * (-922.118) [-922.742] (-920.941) (-920.235) -- 0:00:36
406500 -- (-919.688) (-922.722) (-922.899) [-920.870] * (-925.001) [-922.371] (-921.133) (-926.177) -- 0:00:36
407000 -- [-922.210] (-922.111) (-920.284) (-920.240) * (-924.073) [-919.762] (-920.109) (-924.837) -- 0:00:36
407500 -- (-926.531) (-922.462) (-919.748) [-921.666] * (-924.956) [-920.493] (-922.027) (-921.883) -- 0:00:36
408000 -- (-925.376) [-922.564] (-919.636) (-922.705) * (-921.183) (-919.414) [-921.182] (-922.402) -- 0:00:36
408500 -- (-924.343) (-920.194) [-919.959] (-921.778) * (-924.375) (-920.612) [-921.841] (-921.091) -- 0:00:36
409000 -- [-922.974] (-920.626) (-930.557) (-919.455) * (-922.341) [-921.421] (-923.936) (-920.237) -- 0:00:36
409500 -- (-920.647) (-922.469) (-926.583) [-919.345] * (-922.208) (-920.251) [-924.400] (-921.404) -- 0:00:36
410000 -- [-920.828] (-920.371) (-926.888) (-920.488) * [-922.816] (-921.915) (-921.782) (-921.669) -- 0:00:35
Average standard deviation of split frequencies: 0.012168
410500 -- [-920.603] (-921.565) (-923.398) (-920.258) * (-922.753) (-920.504) [-920.732] (-923.522) -- 0:00:35
411000 -- [-921.185] (-921.173) (-924.694) (-920.288) * (-921.591) (-919.911) [-920.196] (-920.113) -- 0:00:35
411500 -- [-921.417] (-923.850) (-922.840) (-928.621) * (-922.216) (-921.080) [-920.801] (-921.119) -- 0:00:35
412000 -- (-922.830) [-921.866] (-920.497) (-921.187) * (-923.314) (-921.449) (-921.387) [-923.160] -- 0:00:35
412500 -- (-923.701) (-921.580) [-920.004] (-922.514) * (-922.217) (-920.780) (-921.804) [-920.436] -- 0:00:37
413000 -- [-922.462] (-926.283) (-922.593) (-922.431) * (-920.544) [-920.013] (-920.744) (-921.199) -- 0:00:36
413500 -- (-921.444) [-924.381] (-923.852) (-923.005) * (-922.186) (-923.025) [-920.973] (-923.591) -- 0:00:36
414000 -- (-922.387) [-921.523] (-922.429) (-922.522) * (-922.984) (-920.809) (-920.422) [-922.221] -- 0:00:36
414500 -- (-919.855) [-921.108] (-920.867) (-920.220) * (-926.201) [-921.311] (-922.697) (-921.177) -- 0:00:36
415000 -- (-920.664) [-920.435] (-920.423) (-922.467) * (-920.646) (-919.207) (-920.783) [-919.739] -- 0:00:36
Average standard deviation of split frequencies: 0.012692
415500 -- [-921.172] (-922.116) (-925.892) (-921.910) * (-922.155) [-921.020] (-920.423) (-924.942) -- 0:00:36
416000 -- [-920.313] (-922.407) (-925.906) (-921.057) * (-929.444) (-928.595) (-920.112) [-920.351] -- 0:00:36
416500 -- (-920.972) (-922.158) [-921.463] (-922.456) * (-920.437) (-922.047) [-920.841] (-922.376) -- 0:00:36
417000 -- [-920.473] (-925.316) (-922.011) (-920.013) * (-922.204) [-921.833] (-920.090) (-922.716) -- 0:00:36
417500 -- (-920.315) [-924.328] (-919.612) (-921.388) * (-925.170) (-919.417) [-921.164] (-921.518) -- 0:00:36
418000 -- (-919.959) (-922.793) [-920.700] (-922.750) * (-921.686) (-924.038) [-919.884] (-920.662) -- 0:00:36
418500 -- (-921.906) (-922.929) [-922.751] (-922.359) * [-920.745] (-922.476) (-921.084) (-922.777) -- 0:00:36
419000 -- (-924.500) (-923.974) [-920.226] (-921.916) * (-922.324) [-923.838] (-920.246) (-922.521) -- 0:00:36
419500 -- [-921.748] (-922.559) (-921.138) (-921.656) * [-922.407] (-921.140) (-920.551) (-922.960) -- 0:00:35
420000 -- (-921.166) (-923.178) [-921.333] (-925.131) * (-920.378) (-922.620) (-924.171) [-925.539] -- 0:00:35
Average standard deviation of split frequencies: 0.012999
420500 -- [-920.441] (-923.553) (-922.605) (-923.275) * [-920.989] (-923.405) (-922.889) (-922.652) -- 0:00:35
421000 -- (-919.485) [-919.599] (-921.186) (-920.220) * (-920.371) [-921.242] (-924.288) (-920.019) -- 0:00:35
421500 -- (-919.438) (-920.660) (-925.769) [-919.628] * (-921.858) [-921.600] (-924.552) (-922.672) -- 0:00:35
422000 -- (-919.806) [-919.488] (-925.152) (-921.817) * (-921.725) (-920.265) (-923.679) [-920.136] -- 0:00:35
422500 -- (-921.891) [-919.330] (-919.964) (-921.027) * (-919.486) [-921.188] (-920.846) (-922.811) -- 0:00:35
423000 -- (-923.335) (-921.675) (-920.886) [-920.202] * [-919.445] (-923.806) (-919.947) (-921.301) -- 0:00:35
423500 -- (-920.859) (-921.766) (-920.239) [-920.511] * (-922.065) (-923.734) (-919.692) [-920.353] -- 0:00:35
424000 -- (-921.498) (-920.461) (-922.165) [-921.211] * (-923.121) [-922.372] (-922.345) (-919.350) -- 0:00:35
424500 -- (-921.004) (-921.391) [-921.135] (-920.064) * (-921.748) (-925.614) (-921.197) [-919.735] -- 0:00:35
425000 -- (-919.841) [-923.203] (-922.514) (-920.388) * [-921.703] (-921.644) (-925.141) (-921.989) -- 0:00:35
Average standard deviation of split frequencies: 0.013869
425500 -- (-920.237) (-923.642) (-919.797) [-927.760] * (-920.729) (-921.337) [-921.853] (-921.830) -- 0:00:35
426000 -- [-919.754] (-922.345) (-919.627) (-923.296) * (-921.012) (-928.663) [-922.666] (-923.135) -- 0:00:35
426500 -- (-921.164) (-919.273) [-920.608] (-920.080) * (-921.500) (-922.923) [-920.866] (-923.408) -- 0:00:34
427000 -- (-921.121) (-920.322) [-920.524] (-921.381) * [-924.675] (-920.243) (-920.750) (-923.602) -- 0:00:34
427500 -- (-923.088) (-921.700) [-920.526] (-920.641) * (-920.225) (-920.125) [-920.605] (-921.589) -- 0:00:34
428000 -- (-920.034) (-922.506) [-919.750] (-921.315) * (-921.845) [-920.535] (-920.354) (-923.358) -- 0:00:34
428500 -- (-920.131) (-921.240) (-923.052) [-920.404] * (-924.809) [-921.224] (-921.256) (-922.370) -- 0:00:34
429000 -- (-920.509) [-921.211] (-925.235) (-921.769) * (-923.785) (-921.019) (-924.112) [-919.617] -- 0:00:34
429500 -- (-921.733) (-919.512) (-923.560) [-926.267] * (-920.251) [-921.849] (-922.344) (-920.676) -- 0:00:35
430000 -- (-921.476) (-920.882) [-920.872] (-923.636) * (-926.896) [-923.100] (-920.093) (-921.181) -- 0:00:35
Average standard deviation of split frequencies: 0.014084
430500 -- [-920.865] (-921.085) (-922.526) (-921.357) * (-921.226) (-921.539) (-920.349) [-919.931] -- 0:00:35
431000 -- [-920.523] (-921.446) (-926.182) (-924.357) * (-922.228) (-920.951) (-923.281) [-923.548] -- 0:00:35
431500 -- [-922.704] (-920.770) (-920.716) (-923.100) * (-921.010) (-923.823) [-921.864] (-922.400) -- 0:00:35
432000 -- (-920.255) (-920.280) (-921.827) [-924.767] * (-920.920) [-922.813] (-919.938) (-920.874) -- 0:00:35
432500 -- [-921.497] (-920.078) (-922.533) (-921.584) * (-921.466) (-921.528) [-922.145] (-921.759) -- 0:00:35
433000 -- (-926.172) (-920.516) (-921.496) [-920.051] * (-920.323) (-922.024) [-923.129] (-922.404) -- 0:00:35
433500 -- (-920.868) (-921.131) (-920.851) [-919.674] * (-924.196) (-924.586) [-919.756] (-920.022) -- 0:00:35
434000 -- (-921.229) (-920.916) [-920.380] (-922.116) * (-923.966) (-922.751) (-921.728) [-921.137] -- 0:00:35
434500 -- (-921.416) (-921.641) (-920.036) [-923.433] * [-919.728] (-923.298) (-924.025) (-921.470) -- 0:00:35
435000 -- (-923.067) (-920.555) [-920.907] (-920.850) * [-920.265] (-922.405) (-920.103) (-925.182) -- 0:00:35
Average standard deviation of split frequencies: 0.013551
435500 -- [-923.327] (-921.435) (-921.346) (-921.658) * (-920.677) (-921.183) (-920.549) [-923.601] -- 0:00:34
436000 -- (-926.404) [-922.290] (-923.101) (-922.431) * (-922.211) (-922.978) (-920.068) [-922.483] -- 0:00:34
436500 -- [-927.904] (-928.247) (-929.178) (-922.715) * (-923.372) (-921.924) [-922.106] (-921.581) -- 0:00:34
437000 -- (-921.521) [-921.700] (-925.258) (-920.551) * [-923.262] (-920.017) (-920.657) (-922.051) -- 0:00:34
437500 -- (-920.634) (-921.425) [-926.509] (-922.573) * (-927.340) (-921.222) (-919.501) [-920.211] -- 0:00:34
438000 -- [-921.209] (-921.590) (-921.862) (-923.272) * (-925.541) (-922.801) (-920.581) [-920.507] -- 0:00:34
438500 -- (-920.812) (-921.684) (-920.820) [-920.678] * (-924.898) [-923.871] (-920.565) (-922.060) -- 0:00:34
439000 -- [-920.793] (-920.901) (-920.302) (-925.083) * (-920.119) (-924.055) (-921.559) [-921.273] -- 0:00:34
439500 -- (-921.002) [-924.600] (-922.922) (-928.582) * (-921.941) [-924.421] (-922.779) (-922.520) -- 0:00:34
440000 -- (-921.840) (-922.542) (-920.664) [-927.420] * (-920.094) (-924.915) [-921.860] (-922.311) -- 0:00:34
Average standard deviation of split frequencies: 0.013336
440500 -- (-920.243) [-920.946] (-921.599) (-921.177) * (-919.712) (-925.080) (-922.348) [-926.095] -- 0:00:34
441000 -- (-922.899) (-922.959) [-920.079] (-919.811) * [-920.315] (-922.125) (-920.948) (-921.314) -- 0:00:34
441500 -- (-921.776) (-923.791) [-920.155] (-919.451) * (-922.019) (-923.279) [-921.802] (-922.007) -- 0:00:34
442000 -- (-920.675) [-921.382] (-921.995) (-922.466) * (-922.309) [-922.291] (-921.817) (-921.789) -- 0:00:34
442500 -- [-919.687] (-923.471) (-920.568) (-923.944) * [-921.914] (-921.443) (-920.837) (-921.568) -- 0:00:34
443000 -- (-925.269) (-924.907) (-923.127) [-921.463] * (-922.088) [-921.955] (-923.307) (-920.887) -- 0:00:33
443500 -- (-924.047) [-922.655] (-921.482) (-922.407) * (-924.860) (-920.079) [-920.080] (-920.834) -- 0:00:33
444000 -- (-926.108) (-925.911) (-921.398) [-923.592] * (-922.196) (-921.061) [-921.350] (-922.327) -- 0:00:33
444500 -- (-924.378) (-920.389) (-921.752) [-921.768] * (-924.743) (-921.063) [-921.261] (-922.356) -- 0:00:34
445000 -- [-923.562] (-923.244) (-924.083) (-919.262) * (-923.036) [-921.175] (-923.518) (-925.600) -- 0:00:34
Average standard deviation of split frequencies: 0.013318
445500 -- [-920.864] (-920.120) (-922.623) (-921.899) * (-921.961) [-920.956] (-920.753) (-922.233) -- 0:00:34
446000 -- (-919.713) (-920.436) [-920.193] (-920.960) * (-921.541) (-921.856) [-920.252] (-927.220) -- 0:00:34
446500 -- (-922.222) [-921.894] (-920.284) (-920.538) * (-924.047) (-924.851) (-920.169) [-921.258] -- 0:00:34
447000 -- (-920.483) [-920.759] (-921.040) (-924.260) * (-920.637) (-920.862) (-921.813) [-920.558] -- 0:00:34
447500 -- [-922.014] (-920.156) (-922.553) (-924.607) * (-919.716) [-920.510] (-922.702) (-920.558) -- 0:00:34
448000 -- (-924.210) (-922.676) [-927.385] (-922.729) * (-921.063) (-920.510) (-924.340) [-922.594] -- 0:00:34
448500 -- (-923.213) [-921.268] (-924.350) (-924.058) * (-920.319) [-920.464] (-920.897) (-922.662) -- 0:00:34
449000 -- (-920.131) (-927.154) (-926.416) [-923.051] * (-921.685) (-921.616) (-931.382) [-922.343] -- 0:00:34
449500 -- (-919.654) (-921.459) (-922.921) [-922.739] * [-920.912] (-920.043) (-925.765) (-921.047) -- 0:00:34
450000 -- (-919.992) (-920.408) (-922.082) [-919.722] * [-922.547] (-920.168) (-923.717) (-922.104) -- 0:00:34
Average standard deviation of split frequencies: 0.013319
450500 -- (-921.328) (-922.061) [-922.664] (-920.734) * [-920.643] (-922.582) (-922.112) (-921.470) -- 0:00:34
451000 -- [-923.547] (-920.662) (-923.674) (-922.619) * (-921.602) [-921.108] (-923.684) (-922.193) -- 0:00:34
451500 -- (-920.292) (-921.503) [-920.900] (-928.440) * (-921.916) [-922.279] (-925.237) (-922.670) -- 0:00:34
452000 -- (-923.423) (-922.714) (-922.377) [-924.283] * [-920.563] (-924.436) (-922.887) (-926.345) -- 0:00:33
452500 -- (-922.591) (-921.918) (-922.467) [-922.321] * (-922.773) (-926.088) (-921.485) [-923.988] -- 0:00:33
453000 -- (-921.626) (-922.728) [-922.572] (-922.154) * (-920.835) (-921.687) (-921.452) [-921.507] -- 0:00:33
453500 -- (-920.680) (-921.641) [-931.544] (-921.468) * (-924.025) [-920.847] (-920.647) (-921.155) -- 0:00:33
454000 -- [-920.849] (-919.489) (-924.685) (-920.683) * (-921.481) (-921.909) [-919.767] (-921.268) -- 0:00:33
454500 -- (-919.738) [-922.938] (-921.945) (-920.744) * [-921.244] (-921.399) (-920.773) (-920.991) -- 0:00:33
455000 -- (-919.965) (-923.418) [-920.305] (-919.927) * (-921.835) (-920.550) [-921.830] (-921.929) -- 0:00:33
Average standard deviation of split frequencies: 0.012888
455500 -- (-921.580) [-920.407] (-925.137) (-921.039) * (-921.805) [-920.357] (-921.342) (-922.309) -- 0:00:33
456000 -- (-922.662) [-920.145] (-919.752) (-921.510) * (-920.972) [-921.127] (-920.172) (-922.340) -- 0:00:33
456500 -- (-922.375) [-920.984] (-920.903) (-924.751) * (-920.557) [-920.382] (-926.373) (-924.036) -- 0:00:33
457000 -- (-922.905) (-923.619) [-922.261] (-924.895) * [-920.322] (-922.619) (-920.567) (-922.843) -- 0:00:33
457500 -- (-923.348) [-921.138] (-920.502) (-922.113) * (-920.646) [-920.707] (-921.273) (-923.635) -- 0:00:33
458000 -- [-921.779] (-920.471) (-921.119) (-919.925) * (-922.905) [-920.229] (-922.662) (-922.400) -- 0:00:33
458500 -- (-920.495) (-921.931) [-920.726] (-921.892) * (-921.449) (-923.732) (-924.602) [-923.944] -- 0:00:33
459000 -- (-922.792) (-921.993) (-921.574) [-920.562] * [-921.147] (-922.483) (-925.843) (-922.200) -- 0:00:33
459500 -- (-924.449) [-922.030] (-920.100) (-920.175) * (-921.824) [-922.285] (-923.597) (-919.379) -- 0:00:32
460000 -- [-923.902] (-922.145) (-920.362) (-920.763) * (-924.238) (-923.692) (-923.956) [-920.924] -- 0:00:32
Average standard deviation of split frequencies: 0.012553
460500 -- (-922.018) [-921.819] (-920.514) (-921.061) * (-922.092) (-920.302) [-923.120] (-923.175) -- 0:00:33
461000 -- [-921.846] (-922.133) (-924.464) (-920.650) * (-922.766) (-922.625) (-920.862) [-920.405] -- 0:00:33
461500 -- (-921.374) [-920.692] (-921.672) (-921.377) * (-922.922) (-922.195) (-920.986) [-921.246] -- 0:00:33
462000 -- (-922.904) (-921.197) [-920.654] (-920.365) * (-921.829) [-920.166] (-920.890) (-921.609) -- 0:00:33
462500 -- (-921.986) (-922.736) [-920.660] (-923.167) * [-920.226] (-921.053) (-922.941) (-924.595) -- 0:00:33
463000 -- (-920.307) (-922.978) [-919.429] (-920.904) * [-923.712] (-921.515) (-925.162) (-923.052) -- 0:00:33
463500 -- (-922.165) (-926.799) [-920.501] (-921.704) * (-920.577) [-922.058] (-922.119) (-920.050) -- 0:00:33
464000 -- (-923.171) (-922.594) (-922.590) [-921.042] * [-925.581] (-922.220) (-924.334) (-924.802) -- 0:00:33
464500 -- (-922.296) [-919.975] (-920.030) (-920.993) * [-921.507] (-921.525) (-919.487) (-923.956) -- 0:00:33
465000 -- [-922.694] (-920.177) (-922.275) (-923.399) * (-921.722) [-921.697] (-921.798) (-924.417) -- 0:00:33
Average standard deviation of split frequencies: 0.012139
465500 -- (-921.280) [-922.079] (-922.123) (-920.170) * (-922.122) (-924.922) [-921.798] (-922.115) -- 0:00:33
466000 -- (-921.238) (-923.882) (-925.513) [-921.359] * (-922.695) (-923.233) (-920.615) [-921.829] -- 0:00:33
466500 -- (-920.992) [-923.303] (-920.547) (-922.742) * (-920.691) [-920.302] (-920.828) (-923.468) -- 0:00:33
467000 -- (-920.052) [-921.442] (-920.185) (-922.740) * (-928.051) (-923.015) (-920.512) [-922.282] -- 0:00:33
467500 -- (-920.146) (-921.054) (-921.145) [-920.782] * (-927.109) (-920.840) (-920.331) [-921.264] -- 0:00:33
468000 -- (-919.707) [-919.887] (-921.801) (-920.862) * [-920.620] (-922.568) (-919.952) (-921.771) -- 0:00:32
468500 -- (-919.548) [-921.086] (-920.590) (-919.906) * (-923.547) (-922.229) (-920.773) [-919.948] -- 0:00:32
469000 -- (-922.069) [-920.706] (-922.113) (-921.003) * (-922.160) [-921.056] (-920.919) (-920.969) -- 0:00:32
469500 -- (-922.743) (-920.903) [-921.168] (-920.754) * [-921.764] (-923.130) (-919.698) (-919.528) -- 0:00:32
470000 -- (-919.473) [-923.948] (-921.216) (-921.910) * (-922.363) [-920.177] (-923.661) (-921.225) -- 0:00:32
Average standard deviation of split frequencies: 0.012086
470500 -- (-921.706) (-923.377) [-919.388] (-924.916) * (-919.681) [-919.546] (-921.173) (-920.862) -- 0:00:32
471000 -- (-924.698) (-921.537) [-920.580] (-920.797) * [-919.684] (-919.469) (-920.800) (-926.462) -- 0:00:32
471500 -- (-925.497) (-922.330) (-926.398) [-922.009] * (-922.238) (-920.240) [-919.934] (-921.693) -- 0:00:32
472000 -- (-924.946) (-920.726) [-922.251] (-923.394) * (-924.637) [-920.672] (-920.688) (-923.005) -- 0:00:32
472500 -- (-920.126) [-921.049] (-927.060) (-919.897) * [-922.282] (-924.460) (-919.966) (-921.947) -- 0:00:32
473000 -- (-924.925) [-919.735] (-925.598) (-919.535) * (-921.683) (-920.885) [-923.460] (-920.371) -- 0:00:32
473500 -- (-919.999) (-920.346) [-920.873] (-921.624) * (-921.283) (-919.898) [-920.619] (-923.171) -- 0:00:32
474000 -- (-920.445) (-920.588) (-922.199) [-924.619] * (-922.067) [-921.031] (-921.746) (-924.183) -- 0:00:32
474500 -- [-920.795] (-921.189) (-921.745) (-925.807) * [-923.500] (-920.231) (-922.218) (-921.211) -- 0:00:32
475000 -- [-920.510] (-922.724) (-921.962) (-926.322) * (-920.966) (-920.254) [-921.252] (-921.514) -- 0:00:32
Average standard deviation of split frequencies: 0.012544
475500 -- (-923.095) (-922.748) [-920.818] (-926.373) * [-922.591] (-920.870) (-920.864) (-923.768) -- 0:00:31
476000 -- (-920.901) (-923.796) (-922.808) [-920.632] * (-923.989) (-920.660) [-920.420] (-920.892) -- 0:00:31
476500 -- (-920.822) (-926.125) (-923.454) [-922.704] * (-922.884) (-922.351) [-920.825] (-919.592) -- 0:00:31
477000 -- [-921.706] (-921.410) (-921.437) (-921.526) * [-921.229] (-922.392) (-920.190) (-919.592) -- 0:00:32
477500 -- [-919.812] (-920.805) (-920.355) (-921.455) * (-919.955) [-920.467] (-921.562) (-921.350) -- 0:00:32
478000 -- (-921.266) [-920.091] (-922.229) (-922.037) * (-921.337) (-920.049) (-922.937) [-920.419] -- 0:00:32
478500 -- (-923.652) [-926.264] (-925.968) (-925.747) * [-922.839] (-921.750) (-925.321) (-923.099) -- 0:00:32
479000 -- [-920.467] (-920.139) (-922.248) (-926.598) * (-928.246) (-926.445) (-923.968) [-920.687] -- 0:00:32
479500 -- (-924.159) (-922.409) (-922.027) [-924.636] * (-921.389) (-920.833) [-924.827] (-924.853) -- 0:00:32
480000 -- (-921.408) [-921.707] (-920.033) (-922.417) * [-920.882] (-921.943) (-920.578) (-924.683) -- 0:00:32
Average standard deviation of split frequencies: 0.011703
480500 -- [-921.672] (-923.066) (-921.313) (-923.867) * (-925.531) (-922.539) [-923.169] (-921.695) -- 0:00:32
481000 -- (-923.182) (-922.829) (-924.614) [-921.250] * [-924.809] (-920.059) (-922.196) (-919.821) -- 0:00:32
481500 -- (-921.160) [-920.274] (-921.459) (-920.507) * (-927.806) (-920.039) [-922.733] (-922.712) -- 0:00:32
482000 -- (-922.274) (-921.367) [-922.031] (-920.097) * (-923.774) (-923.264) (-919.660) [-920.805] -- 0:00:32
482500 -- [-920.043] (-923.247) (-924.162) (-921.258) * (-922.093) (-920.961) (-919.514) [-921.302] -- 0:00:32
483000 -- (-920.188) (-922.913) (-923.998) [-923.050] * (-925.568) (-925.066) [-920.243] (-919.528) -- 0:00:32
483500 -- (-920.374) [-922.844] (-920.634) (-924.767) * (-924.057) (-921.487) [-921.075] (-920.715) -- 0:00:32
484000 -- [-920.605] (-922.011) (-922.665) (-919.745) * [-922.183] (-922.644) (-924.137) (-923.626) -- 0:00:31
484500 -- (-920.352) (-921.762) [-921.189] (-919.679) * (-921.107) [-920.620] (-923.344) (-922.153) -- 0:00:31
485000 -- (-921.588) [-920.980] (-922.888) (-919.310) * [-922.777] (-921.087) (-922.232) (-920.702) -- 0:00:31
Average standard deviation of split frequencies: 0.011518
485500 -- (-923.980) (-922.533) (-920.756) [-919.434] * (-922.829) [-920.946] (-919.541) (-920.491) -- 0:00:31
486000 -- (-919.475) (-924.255) (-923.491) [-920.549] * (-925.004) (-919.797) (-919.682) [-923.534] -- 0:00:31
486500 -- (-921.198) [-920.733] (-924.935) (-919.753) * (-921.568) (-922.733) (-920.903) [-919.858] -- 0:00:31
487000 -- [-921.745] (-921.478) (-920.673) (-921.745) * (-922.839) (-920.412) [-924.908] (-922.022) -- 0:00:31
487500 -- (-920.222) (-920.165) (-922.038) [-920.813] * (-925.334) [-920.610] (-926.372) (-920.896) -- 0:00:31
488000 -- (-926.837) (-920.554) [-920.336] (-924.150) * [-921.795] (-921.184) (-924.660) (-924.461) -- 0:00:31
488500 -- (-921.650) [-921.355] (-923.402) (-923.468) * (-919.939) [-921.290] (-923.470) (-923.277) -- 0:00:31
489000 -- (-921.734) (-922.419) (-923.740) [-921.869] * [-922.089] (-921.142) (-919.865) (-920.209) -- 0:00:31
489500 -- (-921.431) (-922.468) (-924.254) [-920.670] * (-922.232) (-920.451) (-921.294) [-921.000] -- 0:00:31
490000 -- [-920.504] (-919.691) (-926.287) (-920.971) * (-923.992) (-924.120) [-920.181] (-925.024) -- 0:00:31
Average standard deviation of split frequencies: 0.011081
490500 -- (-921.035) (-923.142) (-920.397) [-920.322] * [-921.008] (-927.337) (-923.802) (-921.255) -- 0:00:31
491000 -- (-921.752) [-922.587] (-923.504) (-921.640) * (-922.317) (-924.560) (-921.104) [-921.621] -- 0:00:31
491500 -- (-921.092) (-923.660) (-922.803) [-921.047] * (-924.301) (-920.396) [-921.267] (-921.547) -- 0:00:31
492000 -- (-921.144) [-925.589] (-929.021) (-920.958) * (-921.545) (-920.644) [-920.952] (-920.344) -- 0:00:30
492500 -- (-922.307) (-924.278) [-925.348] (-922.305) * (-923.524) (-923.108) [-920.332] (-920.407) -- 0:00:31
493000 -- (-924.304) [-923.427] (-920.064) (-922.881) * (-925.238) (-921.381) (-922.578) [-920.638] -- 0:00:31
493500 -- (-922.377) (-921.020) (-921.946) [-920.861] * (-920.840) (-921.428) [-920.879] (-921.695) -- 0:00:31
494000 -- (-923.344) [-924.604] (-920.103) (-923.109) * (-919.316) (-920.911) (-921.925) [-921.529] -- 0:00:31
494500 -- (-922.774) [-922.786] (-923.081) (-922.037) * [-922.617] (-921.101) (-921.511) (-922.417) -- 0:00:31
495000 -- (-923.102) [-921.707] (-924.299) (-923.265) * [-920.270] (-920.758) (-919.363) (-924.808) -- 0:00:31
Average standard deviation of split frequencies: 0.010581
495500 -- (-920.806) [-925.370] (-926.813) (-924.234) * (-921.273) (-921.107) (-919.436) [-922.524] -- 0:00:31
496000 -- (-921.052) [-923.772] (-925.597) (-921.221) * (-920.524) (-920.979) [-920.290] (-921.554) -- 0:00:31
496500 -- (-920.776) (-921.119) (-921.708) [-923.278] * [-919.957] (-922.379) (-922.985) (-924.299) -- 0:00:31
497000 -- (-921.812) [-920.409] (-921.736) (-921.448) * (-920.466) (-919.842) [-919.808] (-921.907) -- 0:00:31
497500 -- (-919.923) (-928.127) [-922.920] (-921.936) * (-920.604) [-924.726] (-920.341) (-921.920) -- 0:00:31
498000 -- (-922.515) (-923.681) [-922.746] (-922.079) * (-920.665) (-926.161) (-919.757) [-921.798] -- 0:00:31
498500 -- (-921.687) [-923.315] (-921.057) (-922.950) * (-921.240) (-920.939) [-920.721] (-922.215) -- 0:00:31
499000 -- (-920.985) [-923.959] (-921.484) (-924.331) * (-920.818) (-921.644) (-920.085) [-920.527] -- 0:00:31
499500 -- (-920.692) (-921.666) [-920.451] (-921.298) * [-922.989] (-921.591) (-923.467) (-920.776) -- 0:00:31
500000 -- [-924.190] (-920.408) (-926.473) (-920.281) * (-920.758) (-922.848) (-920.442) [-920.002] -- 0:00:31
Average standard deviation of split frequencies: 0.011004
500500 -- [-922.421] (-919.780) (-923.607) (-920.020) * (-923.282) (-921.494) [-920.402] (-921.404) -- 0:00:30
501000 -- (-921.463) (-922.240) [-921.723] (-921.499) * (-921.714) (-921.304) (-921.708) [-922.923] -- 0:00:30
501500 -- (-921.538) (-921.522) (-920.356) [-923.253] * (-921.314) (-920.698) [-923.537] (-920.854) -- 0:00:30
502000 -- [-920.761] (-919.477) (-919.861) (-921.505) * (-924.291) (-922.396) (-924.526) [-923.604] -- 0:00:30
502500 -- (-920.991) (-921.623) [-921.742] (-922.018) * (-922.135) (-924.133) [-923.619] (-919.792) -- 0:00:30
503000 -- (-922.523) (-920.505) (-922.769) [-922.792] * (-924.873) (-920.733) (-924.651) [-921.840] -- 0:00:30
503500 -- (-921.104) [-920.048] (-920.180) (-924.156) * (-922.477) (-924.928) [-920.939] (-921.219) -- 0:00:30
504000 -- (-925.552) (-919.686) (-923.887) [-920.600] * [-923.860] (-923.433) (-921.446) (-920.290) -- 0:00:30
504500 -- (-923.795) (-919.836) (-920.257) [-921.810] * (-922.873) [-922.372] (-926.188) (-922.048) -- 0:00:30
505000 -- (-921.757) (-920.843) (-919.896) [-921.751] * (-923.893) (-925.492) (-923.618) [-923.661] -- 0:00:30
Average standard deviation of split frequencies: 0.011704
505500 -- (-924.208) (-920.142) [-920.023] (-920.089) * [-923.738] (-926.319) (-920.352) (-924.232) -- 0:00:30
506000 -- (-920.182) (-922.424) [-920.195] (-923.152) * (-923.789) (-923.380) (-920.795) [-921.998] -- 0:00:30
506500 -- (-921.164) [-923.323] (-920.364) (-923.365) * (-921.255) (-919.383) [-919.921] (-922.290) -- 0:00:30
507000 -- (-921.148) (-922.204) (-920.328) [-921.658] * (-919.883) [-920.839] (-919.781) (-922.437) -- 0:00:30
507500 -- (-922.541) (-922.118) (-921.817) [-921.015] * (-923.346) (-919.576) [-919.693] (-920.283) -- 0:00:30
508000 -- (-923.436) (-921.959) [-920.643] (-920.800) * [-921.488] (-921.074) (-919.924) (-921.618) -- 0:00:30
508500 -- (-922.822) [-921.440] (-920.634) (-925.303) * (-920.632) [-921.747] (-919.637) (-927.270) -- 0:00:29
509000 -- (-920.181) [-920.098] (-921.405) (-921.620) * (-923.397) (-924.169) (-922.757) [-920.578] -- 0:00:29
509500 -- [-920.069] (-920.616) (-919.877) (-919.444) * (-923.478) (-926.275) [-919.668] (-923.459) -- 0:00:30
510000 -- (-924.744) (-919.624) [-920.080] (-920.913) * (-922.003) (-927.857) [-920.327] (-924.238) -- 0:00:30
Average standard deviation of split frequencies: 0.011135
510500 -- (-921.865) [-921.663] (-922.505) (-921.190) * (-923.139) (-920.660) (-921.097) [-920.569] -- 0:00:30
511000 -- (-921.703) (-924.043) (-921.512) [-921.556] * (-925.352) [-920.235] (-922.438) (-920.422) -- 0:00:30
511500 -- (-921.214) (-922.027) [-921.237] (-920.011) * (-920.784) (-920.698) [-920.594] (-921.402) -- 0:00:30
512000 -- (-923.638) (-922.597) (-923.808) [-920.322] * (-923.091) [-923.293] (-923.709) (-924.934) -- 0:00:30
512500 -- (-920.687) (-922.404) [-922.608] (-919.880) * (-919.916) (-920.043) [-925.994] (-923.714) -- 0:00:30
513000 -- (-920.597) (-921.422) (-921.530) [-920.337] * (-919.553) (-922.957) [-924.305] (-922.261) -- 0:00:30
513500 -- [-922.290] (-919.927) (-921.946) (-920.845) * [-919.909] (-925.724) (-921.328) (-920.514) -- 0:00:30
514000 -- (-921.432) [-920.923] (-925.337) (-926.351) * [-921.877] (-921.689) (-921.038) (-922.019) -- 0:00:30
514500 -- (-930.925) [-922.636] (-921.311) (-919.352) * (-921.092) (-921.500) (-921.185) [-919.989] -- 0:00:30
515000 -- (-922.255) [-925.529] (-926.728) (-924.430) * (-920.437) [-921.089] (-920.207) (-920.350) -- 0:00:30
Average standard deviation of split frequencies: 0.010849
515500 -- [-920.376] (-926.844) (-923.009) (-920.380) * (-924.034) (-920.045) (-919.840) [-919.648] -- 0:00:30
516000 -- [-921.443] (-932.332) (-920.723) (-920.709) * (-923.899) [-920.110] (-919.592) (-924.892) -- 0:00:30
516500 -- (-922.756) (-921.882) [-921.244] (-920.601) * (-920.965) (-920.507) [-920.618] (-922.885) -- 0:00:29
517000 -- (-922.888) [-923.961] (-922.427) (-920.517) * (-921.712) (-921.221) (-921.386) [-921.119] -- 0:00:29
517500 -- (-922.136) (-921.057) [-920.812] (-921.670) * (-921.867) [-921.650] (-920.492) (-921.067) -- 0:00:29
518000 -- (-920.794) (-921.798) (-920.644) [-923.642] * (-920.593) (-921.769) [-920.691] (-920.316) -- 0:00:29
518500 -- (-919.711) (-922.012) [-922.629] (-921.931) * (-922.493) (-920.055) (-921.753) [-919.778] -- 0:00:29
519000 -- (-922.436) (-922.758) [-923.035] (-921.584) * (-919.725) (-921.404) [-921.309] (-922.725) -- 0:00:29
519500 -- [-921.939] (-920.004) (-921.305) (-920.845) * (-921.694) (-923.133) [-920.441] (-922.983) -- 0:00:29
520000 -- [-921.273] (-922.829) (-922.153) (-920.211) * [-920.013] (-922.134) (-922.034) (-922.676) -- 0:00:29
Average standard deviation of split frequencies: 0.010321
520500 -- [-921.831] (-925.170) (-923.182) (-919.688) * [-920.547] (-924.648) (-922.281) (-928.018) -- 0:00:29
521000 -- [-921.496] (-920.905) (-920.531) (-920.884) * (-921.834) [-924.175] (-927.781) (-924.169) -- 0:00:29
521500 -- [-920.755] (-920.848) (-920.926) (-921.826) * (-928.251) [-920.392] (-921.097) (-921.741) -- 0:00:29
522000 -- [-921.786] (-923.085) (-922.435) (-926.418) * (-922.552) (-922.588) (-921.484) [-920.745] -- 0:00:29
522500 -- [-920.161] (-923.848) (-924.406) (-923.037) * (-922.386) (-924.726) [-920.791] (-919.916) -- 0:00:29
523000 -- (-920.823) (-921.413) (-921.508) [-921.191] * (-922.715) [-920.136] (-919.870) (-920.089) -- 0:00:29
523500 -- (-922.054) (-921.380) [-922.567] (-926.431) * [-922.960] (-920.729) (-920.161) (-921.153) -- 0:00:29
524000 -- (-922.793) (-922.038) [-920.849] (-929.072) * (-919.912) (-927.240) [-921.458] (-921.541) -- 0:00:29
524500 -- (-921.719) (-926.369) [-924.258] (-924.480) * (-921.454) (-923.198) [-920.306] (-922.156) -- 0:00:29
525000 -- (-922.984) [-921.152] (-920.981) (-921.004) * (-921.015) (-921.624) (-921.644) [-922.415] -- 0:00:28
Average standard deviation of split frequencies: 0.010544
525500 -- (-926.527) (-920.086) (-920.315) [-919.751] * (-921.104) (-921.720) (-921.754) [-922.330] -- 0:00:28
526000 -- [-920.584] (-921.050) (-921.829) (-920.779) * [-921.164] (-921.210) (-919.457) (-922.170) -- 0:00:29
526500 -- (-921.017) (-920.409) (-925.128) [-921.932] * (-921.537) (-920.103) (-920.633) [-923.278] -- 0:00:29
527000 -- (-919.809) (-920.798) [-922.318] (-925.817) * (-923.063) (-923.279) (-921.290) [-920.834] -- 0:00:29
527500 -- (-921.147) (-924.556) (-920.440) [-920.856] * (-923.204) [-921.466] (-926.314) (-923.612) -- 0:00:29
528000 -- [-919.815] (-922.543) (-922.503) (-919.745) * (-921.676) (-921.103) [-926.742] (-924.808) -- 0:00:29
528500 -- (-921.669) (-921.648) (-920.954) [-920.115] * (-924.441) [-920.762] (-921.693) (-925.439) -- 0:00:29
529000 -- (-925.954) (-921.894) [-919.881] (-921.664) * (-921.305) (-921.546) [-920.210] (-922.604) -- 0:00:29
529500 -- (-921.899) (-921.427) (-925.993) [-920.713] * (-920.853) (-925.672) [-919.381] (-921.215) -- 0:00:29
530000 -- (-922.010) [-920.530] (-926.466) (-921.588) * (-922.114) [-922.456] (-919.642) (-921.154) -- 0:00:29
Average standard deviation of split frequencies: 0.010549
530500 -- (-921.398) (-921.694) (-921.522) [-924.820] * [-921.184] (-920.374) (-923.713) (-922.902) -- 0:00:29
531000 -- (-925.994) [-921.563] (-923.092) (-919.946) * (-921.288) (-920.192) [-923.460] (-919.964) -- 0:00:29
531500 -- (-921.291) [-922.654] (-920.644) (-920.766) * [-925.589] (-920.921) (-921.172) (-921.340) -- 0:00:29
532000 -- (-920.386) (-921.788) [-921.050] (-920.105) * (-923.387) (-922.727) [-923.677] (-923.982) -- 0:00:29
532500 -- (-926.021) (-921.104) [-921.761] (-919.620) * (-923.557) [-924.114] (-921.004) (-921.524) -- 0:00:28
533000 -- (-920.908) (-923.530) [-921.503] (-921.117) * (-921.058) (-924.998) (-920.936) [-919.930] -- 0:00:28
533500 -- [-921.019] (-932.427) (-920.027) (-920.866) * (-920.593) (-925.458) (-921.052) [-919.678] -- 0:00:28
534000 -- (-922.128) (-921.188) (-920.569) [-920.523] * (-921.702) (-923.707) (-923.714) [-921.277] -- 0:00:28
534500 -- (-921.114) [-920.437] (-922.329) (-920.704) * (-924.878) (-923.756) [-920.932] (-922.954) -- 0:00:28
535000 -- (-926.273) (-920.463) (-921.691) [-924.751] * (-921.308) (-923.748) (-922.419) [-923.107] -- 0:00:28
Average standard deviation of split frequencies: 0.010606
535500 -- (-923.967) (-920.152) [-922.383] (-923.108) * (-921.592) (-921.881) (-922.010) [-920.346] -- 0:00:28
536000 -- (-920.026) [-920.545] (-919.574) (-920.718) * (-926.060) (-921.923) (-922.197) [-920.337] -- 0:00:28
536500 -- (-921.497) [-920.043] (-920.531) (-922.829) * (-923.475) [-919.606] (-923.065) (-921.277) -- 0:00:28
537000 -- (-920.720) [-921.979] (-923.065) (-921.720) * (-925.647) (-920.003) (-920.905) [-920.444] -- 0:00:28
537500 -- (-924.805) [-920.406] (-919.467) (-919.888) * (-923.390) (-922.605) (-921.737) [-919.706] -- 0:00:28
538000 -- (-923.086) (-921.954) (-922.953) [-920.466] * (-921.424) (-921.229) [-921.108] (-920.201) -- 0:00:28
538500 -- [-922.109] (-924.589) (-921.851) (-922.676) * (-924.214) (-922.943) [-920.732] (-930.304) -- 0:00:28
539000 -- (-923.374) (-920.104) (-922.208) [-921.391] * [-921.771] (-921.658) (-921.906) (-922.090) -- 0:00:28
539500 -- (-922.184) [-924.606] (-921.794) (-922.243) * (-921.334) (-923.622) (-920.413) [-921.626] -- 0:00:28
540000 -- (-922.783) (-923.771) [-920.246] (-931.153) * (-925.600) (-919.785) (-920.375) [-919.773] -- 0:00:28
Average standard deviation of split frequencies: 0.010719
540500 -- (-924.738) [-920.100] (-921.697) (-926.061) * (-926.772) (-921.248) (-920.677) [-924.240] -- 0:00:28
541000 -- (-921.890) (-921.304) (-921.127) [-922.099] * (-921.935) (-920.783) [-923.444] (-922.598) -- 0:00:27
541500 -- [-923.598] (-921.147) (-920.673) (-921.177) * (-923.803) (-921.832) [-920.774] (-919.560) -- 0:00:28
542000 -- (-922.526) [-921.927] (-920.748) (-923.057) * [-924.718] (-924.838) (-919.580) (-920.874) -- 0:00:28
542500 -- (-920.482) (-921.463) [-925.737] (-923.401) * (-922.747) (-923.857) (-921.070) [-922.129] -- 0:00:28
543000 -- (-919.925) (-923.365) (-921.591) [-926.237] * (-921.910) (-924.027) (-921.284) [-920.647] -- 0:00:28
543500 -- (-919.497) [-921.991] (-923.273) (-926.296) * (-925.814) [-921.311] (-920.910) (-924.201) -- 0:00:28
544000 -- (-920.674) (-920.612) [-922.588] (-927.497) * (-920.101) (-921.824) (-921.429) [-921.102] -- 0:00:28
544500 -- (-921.527) (-921.512) (-923.978) [-920.885] * [-921.312] (-921.542) (-923.944) (-920.073) -- 0:00:28
545000 -- (-920.271) (-922.947) [-921.097] (-923.659) * [-921.780] (-923.718) (-925.534) (-920.740) -- 0:00:28
Average standard deviation of split frequencies: 0.011173
545500 -- (-922.673) [-921.796] (-921.289) (-922.143) * (-921.989) (-921.086) (-921.737) [-924.879] -- 0:00:28
546000 -- (-922.739) [-922.700] (-920.237) (-924.148) * (-923.160) (-922.533) [-921.220] (-922.479) -- 0:00:28
546500 -- (-922.191) [-925.957] (-919.725) (-920.706) * (-921.742) [-921.278] (-922.501) (-921.694) -- 0:00:28
547000 -- (-921.805) (-925.639) (-924.265) [-921.147] * (-922.248) [-922.719] (-922.211) (-920.712) -- 0:00:28
547500 -- (-921.175) (-921.353) (-919.912) [-923.621] * (-922.605) (-924.990) (-922.506) [-922.682] -- 0:00:28
548000 -- [-922.912] (-924.006) (-919.920) (-924.524) * (-920.881) [-921.942] (-920.956) (-921.025) -- 0:00:28
548500 -- (-929.411) (-921.278) (-922.606) [-920.172] * (-920.407) (-921.073) [-924.257] (-923.448) -- 0:00:27
549000 -- (-922.211) (-920.480) [-920.936] (-919.881) * (-922.967) (-922.195) [-920.179] (-921.802) -- 0:00:27
549500 -- (-921.983) (-922.333) (-920.858) [-922.309] * (-924.022) (-923.202) (-922.585) [-923.758] -- 0:00:27
550000 -- (-921.166) (-921.752) [-922.291] (-924.294) * [-919.683] (-921.840) (-923.521) (-921.561) -- 0:00:27
Average standard deviation of split frequencies: 0.010701
550500 -- (-920.399) (-921.929) [-922.581] (-925.723) * (-919.777) (-922.208) [-922.213] (-920.749) -- 0:00:27
551000 -- (-920.749) (-926.319) (-921.886) [-929.310] * [-921.842] (-922.947) (-924.113) (-921.022) -- 0:00:27
551500 -- [-919.943] (-923.454) (-923.719) (-925.002) * [-922.187] (-920.379) (-922.021) (-920.559) -- 0:00:27
552000 -- (-924.219) [-919.933] (-920.556) (-922.667) * (-921.043) (-920.463) [-920.554] (-919.801) -- 0:00:27
552500 -- (-921.819) [-922.135] (-920.357) (-920.277) * (-921.907) (-923.569) (-924.376) [-924.654] -- 0:00:27
553000 -- [-920.130] (-920.255) (-920.523) (-919.886) * (-920.877) (-925.330) (-923.183) [-920.185] -- 0:00:27
553500 -- [-920.797] (-923.466) (-923.208) (-921.154) * (-922.811) (-927.305) [-921.898] (-920.163) -- 0:00:27
554000 -- (-921.415) (-921.926) [-923.779] (-922.960) * (-920.787) (-925.080) [-922.288] (-921.007) -- 0:00:27
554500 -- (-921.854) (-920.871) (-923.295) [-921.581] * (-924.999) (-922.785) [-922.240] (-920.809) -- 0:00:27
555000 -- (-920.738) [-921.098] (-921.572) (-921.861) * [-919.926] (-923.962) (-922.214) (-921.563) -- 0:00:27
Average standard deviation of split frequencies: 0.011181
555500 -- (-920.693) (-920.888) [-920.391] (-920.978) * (-920.410) (-925.711) (-921.426) [-923.834] -- 0:00:27
556000 -- (-923.732) [-922.201] (-920.701) (-921.743) * (-922.709) (-924.221) (-924.371) [-920.388] -- 0:00:27
556500 -- (-921.316) (-921.807) [-920.926] (-920.088) * (-923.183) (-921.609) (-922.410) [-922.569] -- 0:00:27
557000 -- (-920.735) (-921.527) [-920.615] (-921.662) * (-926.961) (-920.474) (-924.446) [-921.933] -- 0:00:27
557500 -- (-922.323) (-921.760) (-926.936) [-921.244] * [-923.016] (-922.562) (-920.744) (-922.130) -- 0:00:26
558000 -- (-920.858) (-923.795) [-922.336] (-921.886) * (-924.845) (-923.612) [-920.951] (-919.754) -- 0:00:27
558500 -- [-919.947] (-923.490) (-923.122) (-922.997) * (-923.274) (-921.372) (-919.835) [-919.814] -- 0:00:27
559000 -- (-920.285) (-922.069) (-924.069) [-923.826] * (-922.187) (-922.262) [-921.120] (-920.496) -- 0:00:27
559500 -- [-920.627] (-922.616) (-921.986) (-925.662) * (-922.998) (-922.531) [-921.052] (-922.445) -- 0:00:27
560000 -- (-922.746) (-921.963) (-925.227) [-922.006] * (-922.356) (-920.574) [-928.848] (-921.546) -- 0:00:27
Average standard deviation of split frequencies: 0.011771
560500 -- (-921.916) (-923.299) [-922.006] (-925.931) * (-923.862) (-924.355) [-922.649] (-921.139) -- 0:00:27
561000 -- (-921.335) (-920.931) [-919.711] (-924.625) * (-927.536) (-925.124) [-927.849] (-922.015) -- 0:00:27
561500 -- (-926.275) [-919.738] (-924.815) (-923.419) * (-921.179) (-921.240) [-920.154] (-920.855) -- 0:00:27
562000 -- (-922.658) (-920.940) [-919.919] (-923.725) * (-921.155) [-919.961] (-920.360) (-920.035) -- 0:00:27
562500 -- [-922.118] (-922.177) (-920.184) (-921.676) * [-920.579] (-920.971) (-920.149) (-921.247) -- 0:00:27
563000 -- [-923.057] (-922.413) (-926.207) (-921.186) * (-920.508) (-923.381) [-920.844] (-923.607) -- 0:00:27
563500 -- [-923.990] (-922.895) (-925.658) (-921.533) * (-920.402) (-922.194) [-922.189] (-921.478) -- 0:00:27
564000 -- (-925.902) (-922.405) [-920.477] (-922.584) * (-921.154) (-924.594) [-921.151] (-920.831) -- 0:00:27
564500 -- (-922.696) (-920.836) [-920.455] (-920.369) * (-920.690) (-922.262) (-921.970) [-920.498] -- 0:00:27
565000 -- (-923.658) [-920.770] (-920.792) (-921.142) * (-921.944) (-925.544) [-922.780] (-920.547) -- 0:00:26
Average standard deviation of split frequencies: 0.011504
565500 -- (-921.202) [-921.499] (-922.479) (-923.178) * (-921.948) [-921.956] (-919.629) (-923.491) -- 0:00:26
566000 -- (-920.260) (-922.936) (-925.693) [-921.303] * (-925.476) (-921.000) [-921.352] (-923.559) -- 0:00:26
566500 -- (-920.634) (-920.320) [-923.435] (-927.414) * (-920.347) [-920.416] (-922.578) (-919.955) -- 0:00:26
567000 -- (-923.374) [-919.251] (-923.907) (-924.736) * (-920.671) (-920.048) [-923.016] (-920.642) -- 0:00:26
567500 -- (-920.946) [-920.893] (-924.154) (-921.468) * (-924.076) (-922.424) (-919.846) [-920.691] -- 0:00:26
568000 -- (-921.479) [-921.050] (-920.312) (-923.969) * (-920.914) [-920.054] (-920.087) (-927.212) -- 0:00:26
568500 -- (-920.092) [-920.808] (-922.048) (-925.122) * (-921.634) (-920.307) [-919.987] (-926.845) -- 0:00:26
569000 -- (-921.375) (-921.006) [-923.440] (-921.428) * (-924.231) (-922.219) (-924.929) [-927.125] -- 0:00:26
569500 -- [-919.567] (-921.492) (-924.008) (-922.232) * (-923.084) (-925.646) [-921.429] (-921.032) -- 0:00:26
570000 -- (-923.734) (-920.837) (-921.148) [-921.898] * [-919.982] (-923.856) (-922.657) (-921.688) -- 0:00:26
Average standard deviation of split frequencies: 0.011565
570500 -- (-920.246) [-922.750] (-920.722) (-922.963) * [-921.025] (-928.444) (-925.685) (-921.376) -- 0:00:26
571000 -- (-919.920) (-923.237) (-919.571) [-922.403] * [-922.058] (-923.038) (-927.228) (-923.299) -- 0:00:26
571500 -- [-920.285] (-926.475) (-920.373) (-922.039) * (-928.023) [-924.494] (-928.897) (-920.387) -- 0:00:26
572000 -- [-919.937] (-923.986) (-920.209) (-921.788) * (-925.070) (-925.444) [-921.117] (-921.578) -- 0:00:26
572500 -- (-921.319) (-925.521) [-920.220] (-920.908) * (-925.258) (-926.533) (-920.706) [-920.521] -- 0:00:26
573000 -- (-920.277) (-926.133) [-920.304] (-920.055) * (-926.709) (-926.066) [-921.417] (-920.004) -- 0:00:26
573500 -- [-925.305] (-920.302) (-921.490) (-923.119) * (-920.684) (-922.353) (-924.440) [-919.910] -- 0:00:26
574000 -- [-920.805] (-922.327) (-922.719) (-920.806) * (-922.562) (-921.163) (-921.910) [-920.794] -- 0:00:25
574500 -- [-922.565] (-925.028) (-920.869) (-921.625) * (-923.643) [-924.717] (-922.057) (-921.224) -- 0:00:25
575000 -- (-922.610) (-924.275) [-921.879] (-921.196) * (-920.626) (-924.286) (-926.014) [-925.179] -- 0:00:26
Average standard deviation of split frequencies: 0.011714
575500 -- (-925.340) [-920.335] (-921.540) (-920.139) * (-921.435) (-921.417) (-919.621) [-925.108] -- 0:00:26
576000 -- (-920.815) [-922.920] (-922.484) (-920.440) * [-921.284] (-922.729) (-922.042) (-921.535) -- 0:00:26
576500 -- [-920.043] (-922.324) (-922.561) (-928.095) * [-921.616] (-920.469) (-923.147) (-920.484) -- 0:00:26
577000 -- (-920.401) (-923.926) (-921.575) [-921.746] * (-922.314) (-920.750) [-920.142] (-920.190) -- 0:00:26
577500 -- (-921.322) [-921.267] (-919.603) (-923.602) * (-921.795) (-922.092) [-919.957] (-921.476) -- 0:00:26
578000 -- (-921.490) (-921.353) [-920.438] (-921.883) * [-921.596] (-920.450) (-920.420) (-919.378) -- 0:00:26
578500 -- (-919.608) [-920.450] (-920.004) (-920.813) * (-922.634) (-920.452) [-921.980] (-921.025) -- 0:00:26
579000 -- (-920.042) [-920.228] (-922.644) (-921.787) * [-921.513] (-920.568) (-922.353) (-922.159) -- 0:00:26
579500 -- [-922.226] (-923.145) (-922.930) (-920.681) * (-920.617) (-920.266) [-920.510] (-921.418) -- 0:00:26
580000 -- (-926.519) (-922.470) [-923.264] (-923.832) * (-922.720) [-919.767] (-922.362) (-921.019) -- 0:00:26
Average standard deviation of split frequencies: 0.012127
580500 -- [-919.588] (-924.153) (-920.634) (-921.468) * [-919.849] (-921.363) (-922.041) (-920.700) -- 0:00:26
581000 -- [-921.444] (-923.677) (-921.871) (-921.334) * (-919.918) (-920.349) (-920.646) [-919.890] -- 0:00:25
581500 -- [-921.419] (-921.014) (-919.698) (-922.017) * [-920.385] (-920.810) (-921.847) (-921.716) -- 0:00:25
582000 -- (-921.018) [-922.390] (-921.612) (-922.340) * (-921.713) [-921.086] (-922.396) (-927.053) -- 0:00:25
582500 -- [-921.261] (-921.530) (-921.177) (-921.529) * [-920.195] (-919.688) (-922.222) (-923.786) -- 0:00:25
583000 -- (-922.031) (-920.100) (-925.476) [-920.102] * (-922.453) [-921.591] (-924.275) (-922.209) -- 0:00:25
583500 -- (-922.907) (-924.808) [-920.642] (-920.659) * [-921.665] (-921.239) (-922.499) (-921.915) -- 0:00:25
584000 -- (-919.646) (-924.539) (-921.036) [-921.319] * (-922.444) (-920.949) (-920.898) [-922.193] -- 0:00:25
584500 -- (-921.063) (-920.436) [-922.161] (-922.292) * (-922.398) [-923.077] (-923.600) (-923.011) -- 0:00:25
585000 -- (-920.952) (-920.277) (-924.172) [-922.291] * (-922.559) [-921.069] (-922.057) (-921.576) -- 0:00:25
Average standard deviation of split frequencies: 0.011463
585500 -- (-922.374) (-920.919) [-920.853] (-920.760) * (-921.456) [-922.911] (-921.420) (-920.033) -- 0:00:25
586000 -- (-922.941) [-922.833] (-923.316) (-921.008) * [-921.082] (-923.251) (-921.904) (-922.339) -- 0:00:25
586500 -- (-921.927) (-923.315) (-920.809) [-921.568] * (-922.147) (-921.369) [-921.440] (-923.226) -- 0:00:25
587000 -- (-920.329) [-921.384] (-919.874) (-919.353) * [-921.462] (-922.474) (-920.790) (-920.161) -- 0:00:25
587500 -- (-919.926) (-919.961) [-920.159] (-923.860) * [-920.451] (-921.805) (-922.116) (-920.621) -- 0:00:25
588000 -- (-919.631) [-920.287] (-921.236) (-924.652) * [-922.719] (-920.461) (-920.499) (-923.999) -- 0:00:25
588500 -- (-922.711) (-920.789) [-920.286] (-921.365) * (-919.347) (-920.262) (-919.173) [-920.429] -- 0:00:25
589000 -- (-920.826) [-920.848] (-925.328) (-921.729) * [-921.376] (-920.316) (-920.235) (-923.148) -- 0:00:25
589500 -- (-921.906) (-920.905) (-923.101) [-923.928] * (-922.442) (-932.044) [-923.844] (-919.821) -- 0:00:25
590000 -- (-923.598) [-921.473] (-920.652) (-921.537) * (-923.650) (-922.725) (-922.262) [-921.352] -- 0:00:25
Average standard deviation of split frequencies: 0.011073
590500 -- [-922.515] (-922.215) (-919.878) (-919.532) * [-920.221] (-926.033) (-921.449) (-924.031) -- 0:00:24
591000 -- (-920.361) (-921.165) [-920.717] (-922.639) * (-921.660) (-921.032) [-919.990] (-921.526) -- 0:00:25
591500 -- (-921.905) (-920.235) [-921.382] (-925.063) * (-920.466) (-924.317) [-921.009] (-921.745) -- 0:00:25
592000 -- [-921.926] (-921.888) (-920.258) (-927.947) * (-921.119) [-921.633] (-926.614) (-925.097) -- 0:00:25
592500 -- [-920.680] (-923.439) (-921.060) (-923.389) * (-922.968) (-922.478) [-923.347] (-924.339) -- 0:00:25
593000 -- [-919.906] (-927.232) (-920.623) (-924.854) * (-922.151) (-922.258) [-920.350] (-927.317) -- 0:00:25
593500 -- (-923.108) (-922.206) [-920.743] (-924.669) * [-924.947] (-920.941) (-922.454) (-928.249) -- 0:00:25
594000 -- (-922.472) (-920.621) (-920.717) [-923.774] * (-924.208) (-920.954) [-920.534] (-923.341) -- 0:00:25
594500 -- (-924.364) (-920.851) (-922.520) [-921.346] * (-926.851) (-921.322) (-919.287) [-923.333] -- 0:00:25
595000 -- (-921.244) (-922.107) (-921.131) [-920.057] * (-926.107) (-920.546) [-919.511] (-922.309) -- 0:00:25
Average standard deviation of split frequencies: 0.011370
595500 -- (-922.670) (-921.588) [-922.265] (-919.837) * (-921.414) [-922.354] (-922.801) (-921.041) -- 0:00:25
596000 -- [-923.216] (-922.034) (-925.749) (-923.939) * (-923.988) (-921.470) (-924.026) [-920.517] -- 0:00:25
596500 -- (-921.612) [-922.186] (-923.095) (-922.151) * (-923.973) (-922.683) (-923.944) [-920.117] -- 0:00:25
597000 -- [-919.281] (-920.702) (-923.110) (-920.644) * (-921.832) (-922.082) (-923.844) [-920.014] -- 0:00:24
597500 -- (-920.288) (-921.850) (-923.462) [-921.578] * (-921.364) (-923.218) (-920.724) [-920.222] -- 0:00:24
598000 -- (-922.299) [-920.854] (-923.250) (-922.550) * (-922.708) (-925.333) (-920.405) [-920.631] -- 0:00:24
598500 -- (-920.602) [-919.964] (-920.198) (-920.028) * (-922.022) (-921.126) (-926.607) [-921.373] -- 0:00:24
599000 -- (-924.491) [-920.920] (-924.143) (-920.027) * (-924.170) [-924.777] (-920.031) (-925.506) -- 0:00:24
599500 -- (-920.681) (-927.515) [-919.806] (-921.363) * (-919.769) [-923.784] (-921.077) (-927.059) -- 0:00:24
600000 -- (-922.350) (-920.669) [-921.345] (-921.763) * [-919.698] (-921.583) (-919.704) (-927.055) -- 0:00:24
Average standard deviation of split frequencies: 0.011183
600500 -- (-921.865) (-921.140) [-921.254] (-928.742) * (-921.184) [-920.586] (-921.262) (-921.459) -- 0:00:24
601000 -- (-924.992) (-920.939) (-922.651) [-923.613] * (-924.152) (-920.101) (-921.963) [-920.141] -- 0:00:24
601500 -- (-920.917) (-920.828) (-921.371) [-922.657] * [-922.274] (-921.223) (-920.064) (-926.948) -- 0:00:24
602000 -- (-920.214) [-921.518] (-921.934) (-923.911) * (-923.025) (-921.997) [-920.312] (-920.834) -- 0:00:24
602500 -- [-920.043] (-920.460) (-925.758) (-919.983) * [-920.436] (-924.225) (-921.829) (-922.679) -- 0:00:24
603000 -- [-921.386] (-921.544) (-922.915) (-921.420) * (-922.665) (-922.839) [-925.645] (-920.571) -- 0:00:24
603500 -- (-922.068) [-921.385] (-921.221) (-925.494) * [-925.111] (-921.651) (-922.501) (-922.588) -- 0:00:24
604000 -- (-923.449) (-924.027) (-921.756) [-921.867] * (-919.905) [-921.982] (-920.332) (-920.294) -- 0:00:24
604500 -- [-925.019] (-920.682) (-922.823) (-921.114) * (-922.788) [-920.250] (-921.487) (-920.557) -- 0:00:24
605000 -- (-928.506) (-921.322) (-919.482) [-923.698] * (-921.994) [-920.350] (-926.561) (-922.746) -- 0:00:24
Average standard deviation of split frequencies: 0.011134
605500 -- (-928.744) (-921.203) (-920.989) [-921.066] * (-922.161) (-920.627) (-923.371) [-922.373] -- 0:00:24
606000 -- (-923.170) [-921.169] (-924.529) (-921.377) * [-921.657] (-920.950) (-921.945) (-920.830) -- 0:00:24
606500 -- (-923.395) (-920.564) (-925.126) [-923.334] * [-922.408] (-919.943) (-921.998) (-920.885) -- 0:00:24
607000 -- (-922.708) (-922.519) [-920.574] (-920.940) * (-922.571) [-922.223] (-921.207) (-923.047) -- 0:00:24
607500 -- (-920.673) (-925.518) (-923.479) [-921.244] * (-922.777) [-921.144] (-919.588) (-923.285) -- 0:00:24
608000 -- (-922.991) (-925.415) [-922.277] (-920.357) * (-924.267) [-922.972] (-920.431) (-921.254) -- 0:00:24
608500 -- (-921.962) (-924.617) (-922.202) [-919.502] * (-923.276) [-923.608] (-919.870) (-922.086) -- 0:00:24
609000 -- (-920.903) (-922.823) [-922.853] (-922.136) * (-923.110) (-921.866) (-921.293) [-923.490] -- 0:00:24
609500 -- (-921.251) [-921.670] (-921.493) (-923.989) * (-920.693) (-921.632) (-920.660) [-922.991] -- 0:00:24
610000 -- [-921.960] (-922.778) (-921.641) (-923.243) * (-921.048) (-920.310) (-919.318) [-920.480] -- 0:00:24
Average standard deviation of split frequencies: 0.010470
610500 -- [-922.205] (-922.506) (-921.705) (-919.674) * (-921.882) (-921.084) [-920.419] (-923.062) -- 0:00:24
611000 -- (-923.719) (-923.441) (-923.957) [-923.125] * (-922.097) [-922.884] (-920.579) (-923.038) -- 0:00:24
611500 -- [-921.062] (-920.817) (-921.771) (-923.990) * (-921.646) [-923.762] (-920.646) (-920.282) -- 0:00:24
612000 -- (-921.372) [-921.046] (-921.394) (-920.483) * (-923.855) [-922.682] (-919.641) (-921.881) -- 0:00:24
612500 -- (-921.370) (-924.114) [-921.593] (-922.724) * (-919.649) [-924.434] (-922.192) (-923.599) -- 0:00:24
613000 -- (-923.128) (-922.572) [-921.333] (-920.838) * (-919.970) (-925.388) (-922.643) [-921.845] -- 0:00:23
613500 -- (-926.734) (-921.142) [-923.281] (-920.443) * [-920.394] (-922.257) (-921.498) (-922.400) -- 0:00:23
614000 -- (-922.545) (-921.960) (-919.540) [-920.795] * (-927.519) [-921.981] (-920.279) (-920.959) -- 0:00:23
614500 -- (-921.462) (-920.979) (-920.595) [-921.056] * (-924.394) [-921.249] (-919.425) (-919.905) -- 0:00:23
615000 -- (-920.140) (-923.386) (-920.010) [-923.255] * (-920.229) (-921.414) (-919.351) [-920.313] -- 0:00:23
Average standard deviation of split frequencies: 0.010905
615500 -- [-919.379] (-923.676) (-921.801) (-922.421) * (-920.755) [-923.402] (-920.166) (-921.156) -- 0:00:23
616000 -- (-920.208) [-922.545] (-922.485) (-919.485) * [-922.300] (-921.186) (-920.242) (-919.465) -- 0:00:23
616500 -- [-922.544] (-920.949) (-923.768) (-919.978) * [-920.461] (-924.596) (-923.981) (-920.561) -- 0:00:23
617000 -- (-928.600) (-922.563) (-920.557) [-919.989] * (-923.640) (-920.866) [-920.777] (-921.500) -- 0:00:23
617500 -- (-920.598) (-920.760) (-924.765) [-923.899] * (-928.166) [-922.825] (-920.532) (-922.928) -- 0:00:23
618000 -- (-923.444) (-921.183) [-921.580] (-922.174) * (-920.925) (-924.344) [-920.310] (-926.101) -- 0:00:23
618500 -- (-921.543) (-922.232) [-921.401] (-920.260) * (-922.212) (-922.708) [-920.975] (-923.505) -- 0:00:23
619000 -- (-922.419) (-919.870) (-923.068) [-922.706] * (-923.335) (-923.049) [-919.558] (-924.424) -- 0:00:23
619500 -- (-921.103) (-919.741) [-921.703] (-926.605) * (-923.000) [-921.873] (-920.703) (-923.572) -- 0:00:23
620000 -- (-921.747) [-920.066] (-922.873) (-922.031) * (-924.128) [-920.722] (-921.779) (-924.973) -- 0:00:23
Average standard deviation of split frequencies: 0.010443
620500 -- (-925.224) [-919.894] (-920.937) (-920.186) * (-924.346) [-923.886] (-920.804) (-920.807) -- 0:00:23
621000 -- (-921.800) (-920.015) (-921.245) [-920.492] * [-921.954] (-921.334) (-920.807) (-923.284) -- 0:00:23
621500 -- (-919.815) (-920.661) (-922.720) [-920.765] * [-921.746] (-921.688) (-923.129) (-924.937) -- 0:00:23
622000 -- (-919.566) [-921.981] (-922.728) (-919.607) * (-921.627) (-920.452) [-920.287] (-926.343) -- 0:00:23
622500 -- (-922.139) [-920.846] (-921.680) (-924.122) * (-921.311) (-920.605) [-919.734] (-920.400) -- 0:00:23
623000 -- (-920.960) (-921.017) (-921.125) [-919.959] * (-920.528) (-920.589) (-921.492) [-922.518] -- 0:00:22
623500 -- (-921.388) [-920.529] (-921.762) (-920.697) * (-920.136) (-925.041) [-923.568] (-921.682) -- 0:00:22
624000 -- (-923.753) [-927.650] (-921.154) (-924.358) * (-921.674) (-924.039) [-923.314] (-920.441) -- 0:00:23
624500 -- (-923.816) [-919.619] (-925.169) (-925.456) * (-926.035) [-920.142] (-922.467) (-920.906) -- 0:00:23
625000 -- (-922.756) [-919.518] (-921.541) (-926.543) * (-921.526) (-920.272) [-921.712] (-919.609) -- 0:00:23
Average standard deviation of split frequencies: 0.011060
625500 -- [-922.348] (-920.362) (-921.710) (-920.675) * (-924.408) (-921.935) [-921.519] (-919.753) -- 0:00:23
626000 -- [-920.775] (-921.392) (-923.158) (-920.759) * (-922.300) [-923.267] (-924.636) (-925.004) -- 0:00:23
626500 -- [-920.969] (-920.340) (-920.223) (-919.475) * (-921.716) (-920.507) [-922.351] (-922.656) -- 0:00:23
627000 -- (-920.068) (-921.059) [-921.990] (-920.284) * (-922.964) (-924.645) (-922.226) [-926.322] -- 0:00:23
627500 -- (-925.492) (-923.253) (-924.704) [-920.283] * (-923.325) (-924.678) (-919.937) [-921.353] -- 0:00:23
628000 -- (-920.796) (-921.751) [-920.462] (-922.435) * (-921.274) [-921.886] (-922.115) (-924.198) -- 0:00:23
628500 -- (-923.756) [-925.473] (-920.646) (-919.825) * [-920.706] (-919.967) (-921.772) (-922.829) -- 0:00:23
629000 -- (-921.001) [-921.524] (-922.862) (-920.045) * (-920.920) (-919.453) (-920.196) [-922.883] -- 0:00:23
629500 -- (-920.530) (-922.157) [-920.006] (-919.967) * (-921.205) [-921.472] (-924.091) (-921.983) -- 0:00:22
630000 -- (-921.126) (-924.476) [-923.143] (-919.688) * [-920.502] (-922.004) (-928.737) (-921.324) -- 0:00:22
Average standard deviation of split frequencies: 0.011446
630500 -- [-923.723] (-924.883) (-923.829) (-919.662) * (-920.119) [-922.082] (-923.444) (-921.385) -- 0:00:22
631000 -- [-919.921] (-921.213) (-922.012) (-921.809) * [-923.713] (-921.181) (-922.037) (-923.499) -- 0:00:22
631500 -- [-920.886] (-920.390) (-920.986) (-921.108) * (-920.556) [-922.940] (-921.064) (-925.817) -- 0:00:22
632000 -- (-925.115) [-921.129] (-921.562) (-921.624) * (-926.222) (-919.674) [-921.828] (-924.470) -- 0:00:22
632500 -- [-920.207] (-924.034) (-923.199) (-925.422) * (-922.152) (-921.025) (-925.680) [-921.030] -- 0:00:22
633000 -- (-922.646) (-920.270) (-921.087) [-923.211] * (-920.108) (-920.952) [-922.197] (-925.427) -- 0:00:22
633500 -- [-922.685] (-924.132) (-919.878) (-920.785) * (-922.324) [-921.766] (-925.243) (-919.697) -- 0:00:22
634000 -- (-926.759) (-924.795) [-921.538] (-920.542) * (-922.158) [-922.536] (-920.190) (-920.346) -- 0:00:22
634500 -- [-919.838] (-922.646) (-923.209) (-924.047) * (-922.765) (-923.965) [-920.170] (-921.716) -- 0:00:22
635000 -- (-920.463) [-922.153] (-920.834) (-920.703) * (-923.323) [-921.502] (-920.440) (-923.679) -- 0:00:22
Average standard deviation of split frequencies: 0.010840
635500 -- (-922.657) [-920.359] (-920.776) (-924.923) * (-922.963) (-921.556) [-921.123] (-922.045) -- 0:00:22
636000 -- (-920.764) [-919.994] (-925.565) (-920.605) * [-924.499] (-922.349) (-921.069) (-920.137) -- 0:00:22
636500 -- (-921.023) [-925.809] (-925.955) (-921.376) * [-921.796] (-930.850) (-921.238) (-920.137) -- 0:00:22
637000 -- (-920.346) (-926.540) (-920.844) [-922.441] * (-923.744) (-923.127) (-919.765) [-920.246] -- 0:00:22
637500 -- (-919.845) (-926.431) (-924.448) [-920.099] * [-920.779] (-920.833) (-919.888) (-921.560) -- 0:00:22
638000 -- [-921.175] (-920.191) (-929.309) (-919.766) * (-921.296) (-920.086) (-922.153) [-921.515] -- 0:00:22
638500 -- (-920.717) [-920.413] (-925.485) (-920.266) * (-921.274) [-919.706] (-922.354) (-921.750) -- 0:00:22
639000 -- (-921.385) (-920.170) [-922.054] (-920.514) * (-921.456) (-921.498) [-920.619] (-925.669) -- 0:00:22
639500 -- [-920.809] (-922.090) (-920.422) (-922.926) * (-919.963) [-920.473] (-920.677) (-922.508) -- 0:00:21
640000 -- (-920.145) (-920.693) [-919.735] (-920.451) * [-921.218] (-921.560) (-923.818) (-921.295) -- 0:00:21
Average standard deviation of split frequencies: 0.011221
640500 -- (-924.287) [-920.037] (-926.272) (-920.976) * (-921.432) (-925.317) (-923.675) [-921.064] -- 0:00:21
641000 -- (-923.791) (-920.025) (-922.308) [-922.838] * (-920.558) (-922.074) (-921.852) [-921.309] -- 0:00:22
641500 -- (-922.486) (-922.095) [-921.419] (-920.220) * [-920.970] (-922.504) (-921.546) (-921.774) -- 0:00:22
642000 -- (-922.499) [-919.576] (-920.764) (-923.077) * (-921.092) [-925.217] (-922.016) (-921.822) -- 0:00:22
642500 -- (-922.594) (-920.976) (-920.136) [-920.632] * (-921.330) (-923.619) [-924.925] (-923.122) -- 0:00:22
643000 -- (-921.337) [-921.092] (-921.475) (-922.251) * [-920.504] (-923.186) (-920.962) (-924.393) -- 0:00:22
643500 -- (-923.256) (-925.311) (-919.698) [-922.928] * [-919.952] (-921.423) (-922.813) (-921.845) -- 0:00:22
644000 -- (-924.326) [-919.680] (-920.208) (-925.545) * (-919.741) (-924.117) [-924.117] (-922.504) -- 0:00:22
644500 -- (-920.334) (-922.270) [-920.309] (-922.991) * (-920.573) [-921.804] (-921.030) (-924.737) -- 0:00:22
645000 -- (-920.198) (-923.473) (-919.428) [-920.512] * (-922.109) (-921.494) (-921.175) [-923.421] -- 0:00:22
Average standard deviation of split frequencies: 0.011083
645500 -- [-921.952] (-922.609) (-919.372) (-920.034) * [-924.190] (-922.210) (-922.411) (-920.985) -- 0:00:21
646000 -- (-920.759) (-920.111) (-920.925) [-923.481] * (-920.818) [-922.843] (-920.064) (-924.057) -- 0:00:21
646500 -- (-920.136) (-924.002) (-920.655) [-919.742] * [-922.999] (-921.969) (-919.866) (-919.537) -- 0:00:21
647000 -- (-920.376) (-922.217) [-919.560] (-920.413) * (-922.742) (-919.810) [-920.891] (-922.633) -- 0:00:21
647500 -- (-921.354) [-921.454] (-924.584) (-920.783) * (-920.593) [-922.084] (-924.301) (-921.358) -- 0:00:21
648000 -- (-919.315) (-921.324) [-922.121] (-920.794) * (-920.215) [-920.806] (-922.500) (-922.241) -- 0:00:21
648500 -- [-923.314] (-919.946) (-923.950) (-926.965) * (-920.510) (-920.112) (-923.474) [-921.527] -- 0:00:21
649000 -- (-923.717) [-920.657] (-923.340) (-920.128) * (-922.737) (-919.622) [-919.832] (-923.206) -- 0:00:21
649500 -- (-922.987) (-920.417) [-926.784] (-922.955) * (-925.131) (-919.622) (-921.596) [-921.742] -- 0:00:21
650000 -- (-921.766) (-920.551) [-922.419] (-925.697) * (-923.773) (-919.620) (-921.446) [-922.435] -- 0:00:21
Average standard deviation of split frequencies: 0.010550
650500 -- (-920.250) (-923.634) [-920.977] (-925.759) * (-920.907) [-919.670] (-921.289) (-923.613) -- 0:00:21
651000 -- (-919.631) (-924.937) [-922.283] (-923.344) * (-921.725) (-920.198) [-923.084] (-924.941) -- 0:00:21
651500 -- (-919.704) (-926.227) [-922.990] (-920.893) * (-925.888) [-923.808] (-924.643) (-925.042) -- 0:00:21
652000 -- [-919.593] (-924.652) (-929.901) (-919.982) * (-920.700) [-921.067] (-920.059) (-923.958) -- 0:00:21
652500 -- (-920.466) (-925.787) (-921.818) [-920.254] * (-921.443) [-922.381] (-919.950) (-929.106) -- 0:00:21
653000 -- (-920.193) (-921.053) (-922.393) [-923.095] * (-922.101) (-920.303) [-924.591] (-923.094) -- 0:00:21
653500 -- (-920.303) [-921.454] (-920.914) (-929.238) * (-930.932) (-920.882) [-920.160] (-922.154) -- 0:00:21
654000 -- (-919.606) (-925.693) (-921.130) [-920.779] * (-921.384) (-921.871) (-920.068) [-923.029] -- 0:00:21
654500 -- (-926.036) (-924.654) [-923.248] (-920.994) * (-922.370) (-921.082) [-923.702] (-922.110) -- 0:00:21
655000 -- [-922.547] (-922.955) (-927.285) (-921.575) * (-920.882) (-923.913) [-922.869] (-919.578) -- 0:00:21
Average standard deviation of split frequencies: 0.010330
655500 -- (-920.018) (-922.161) [-922.821] (-922.142) * (-919.855) (-924.155) (-923.663) [-922.773] -- 0:00:21
656000 -- (-920.165) (-919.402) (-922.727) [-921.558] * (-922.986) (-922.492) (-922.496) [-920.456] -- 0:00:20
656500 -- (-925.879) (-921.332) (-921.937) [-921.860] * (-920.778) (-921.672) [-919.713] (-920.546) -- 0:00:20
657000 -- (-922.972) (-923.201) [-919.981] (-922.311) * (-922.724) [-924.055] (-920.946) (-925.259) -- 0:00:20
657500 -- (-927.569) (-921.108) [-922.526] (-923.051) * (-920.584) (-924.776) [-920.098] (-927.539) -- 0:00:21
658000 -- (-924.682) [-922.193] (-921.449) (-924.471) * (-919.575) (-921.867) [-920.840] (-924.200) -- 0:00:21
658500 -- (-923.069) (-921.319) (-921.706) [-920.973] * (-922.227) (-919.779) [-924.605] (-922.809) -- 0:00:21
659000 -- (-923.447) [-920.000] (-919.912) (-924.613) * (-924.766) [-919.386] (-922.355) (-922.043) -- 0:00:21
659500 -- (-920.241) [-921.557] (-920.489) (-924.032) * (-920.323) (-919.642) (-924.038) [-923.800] -- 0:00:21
660000 -- (-920.297) (-920.440) (-921.848) [-924.424] * (-920.678) (-921.861) (-921.443) [-922.254] -- 0:00:21
Average standard deviation of split frequencies: 0.010480
660500 -- [-920.463] (-922.545) (-923.014) (-922.252) * [-921.150] (-921.472) (-923.393) (-924.079) -- 0:00:21
661000 -- [-920.685] (-921.061) (-921.926) (-922.237) * (-921.331) [-921.688] (-920.825) (-925.772) -- 0:00:21
661500 -- (-921.448) (-923.092) (-925.065) [-919.427] * (-922.499) (-920.410) (-920.643) [-922.181] -- 0:00:20
662000 -- (-923.091) (-920.443) (-921.017) [-924.365] * (-920.506) (-920.571) (-920.714) [-921.241] -- 0:00:20
662500 -- (-922.589) (-920.319) [-921.091] (-924.390) * (-919.710) (-920.130) (-920.855) [-919.798] -- 0:00:20
663000 -- (-922.071) (-919.791) [-920.595] (-922.748) * [-921.790] (-922.280) (-921.442) (-921.081) -- 0:00:20
663500 -- [-919.601] (-919.569) (-920.389) (-920.864) * (-920.272) [-920.730] (-921.815) (-921.801) -- 0:00:20
664000 -- (-920.934) [-922.199] (-923.105) (-925.217) * (-920.414) (-920.210) [-923.104] (-921.595) -- 0:00:20
664500 -- (-923.412) (-926.322) (-924.601) [-921.715] * (-922.606) [-922.484] (-921.508) (-919.684) -- 0:00:20
665000 -- (-924.945) [-921.091] (-921.815) (-922.577) * (-922.096) [-922.360] (-920.859) (-922.384) -- 0:00:20
Average standard deviation of split frequencies: 0.010042
665500 -- [-920.096] (-923.849) (-923.073) (-921.367) * [-920.379] (-924.457) (-920.304) (-921.177) -- 0:00:20
666000 -- (-919.421) [-923.745] (-925.487) (-920.200) * [-924.022] (-922.328) (-920.228) (-921.951) -- 0:00:20
666500 -- (-921.361) [-920.347] (-922.313) (-921.820) * (-921.800) [-922.774] (-919.790) (-922.389) -- 0:00:20
667000 -- [-921.443] (-923.716) (-921.774) (-919.580) * (-922.109) (-921.778) [-919.462] (-922.385) -- 0:00:20
667500 -- [-921.506] (-926.038) (-924.607) (-921.237) * (-921.123) [-924.085] (-919.724) (-921.801) -- 0:00:20
668000 -- (-921.998) (-920.394) (-921.530) [-922.001] * (-923.984) (-923.244) [-919.954] (-923.986) -- 0:00:20
668500 -- (-922.400) (-920.844) (-921.041) [-920.044] * (-923.562) (-921.199) (-922.325) [-923.021] -- 0:00:20
669000 -- [-920.231] (-920.993) (-921.800) (-920.540) * (-922.967) (-920.729) [-919.830] (-920.623) -- 0:00:20
669500 -- (-921.385) (-920.566) [-921.659] (-920.257) * (-921.646) (-921.326) (-922.286) [-921.580] -- 0:00:20
670000 -- (-920.703) (-921.820) (-924.134) [-920.794] * [-921.264] (-923.174) (-920.715) (-920.704) -- 0:00:20
Average standard deviation of split frequencies: 0.010543
670500 -- (-921.802) (-921.041) (-920.454) [-920.777] * (-919.928) (-919.753) (-923.871) [-919.532] -- 0:00:20
671000 -- (-921.741) (-923.543) (-920.565) [-920.833] * (-920.515) (-920.118) (-924.640) [-920.809] -- 0:00:20
671500 -- [-920.184] (-923.090) (-920.749) (-921.457) * [-921.196] (-920.398) (-922.276) (-920.535) -- 0:00:20
672000 -- (-921.077) (-926.071) [-922.819] (-925.826) * (-920.299) (-920.419) (-922.679) [-921.025] -- 0:00:20
672500 -- (-920.874) (-925.825) [-922.756] (-921.848) * (-922.173) (-920.502) (-923.531) [-922.804] -- 0:00:19
673000 -- (-920.727) (-921.330) [-922.158] (-920.476) * (-921.999) (-921.484) [-919.701] (-924.305) -- 0:00:19
673500 -- (-922.156) (-921.143) (-924.968) [-920.606] * (-923.104) (-923.026) [-921.324] (-920.883) -- 0:00:19
674000 -- (-919.924) (-920.848) (-923.632) [-921.492] * (-920.619) (-923.424) [-920.957] (-921.585) -- 0:00:19
674500 -- (-920.388) (-920.203) (-925.550) [-919.682] * (-921.664) (-920.351) [-920.294] (-923.255) -- 0:00:20
675000 -- (-920.924) (-920.800) (-924.824) [-919.686] * [-922.723] (-920.254) (-923.703) (-920.853) -- 0:00:20
Average standard deviation of split frequencies: 0.010373
675500 -- (-925.035) [-920.382] (-927.125) (-920.464) * (-922.347) (-923.982) [-921.422] (-920.300) -- 0:00:20
676000 -- (-920.893) [-920.348] (-929.036) (-921.344) * (-924.367) (-923.413) [-920.956] (-920.930) -- 0:00:20
676500 -- (-925.860) (-923.079) (-920.794) [-920.555] * (-923.057) (-923.836) [-921.612] (-920.982) -- 0:00:20
677000 -- (-922.780) (-921.567) [-922.278] (-921.593) * [-921.405] (-925.435) (-922.985) (-920.271) -- 0:00:20
677500 -- [-921.958] (-922.815) (-920.362) (-920.939) * (-923.512) (-921.529) (-920.107) [-919.683] -- 0:00:19
678000 -- (-919.950) [-920.093] (-921.932) (-922.686) * [-923.337] (-921.807) (-919.861) (-924.438) -- 0:00:19
678500 -- (-923.943) (-922.568) [-920.084] (-921.695) * (-923.910) [-921.139] (-920.938) (-923.443) -- 0:00:19
679000 -- (-924.046) [-919.530] (-919.543) (-920.410) * (-926.018) (-920.867) [-919.895] (-926.569) -- 0:00:19
679500 -- (-921.838) (-922.763) (-920.595) [-921.952] * (-924.575) (-920.441) [-919.334] (-926.604) -- 0:00:19
680000 -- [-920.179] (-921.403) (-921.295) (-921.845) * (-920.757) [-920.232] (-924.188) (-925.019) -- 0:00:19
Average standard deviation of split frequencies: 0.010259
680500 -- (-920.865) (-923.012) [-920.779] (-922.052) * (-919.506) (-920.997) [-928.597] (-921.254) -- 0:00:19
681000 -- (-922.811) (-921.878) (-920.436) [-921.925] * (-920.214) (-921.615) (-922.408) [-919.786] -- 0:00:19
681500 -- (-921.652) [-920.911] (-921.495) (-925.114) * [-921.198] (-920.140) (-921.790) (-919.630) -- 0:00:19
682000 -- (-922.107) [-920.517] (-923.817) (-922.605) * (-921.575) [-928.228] (-919.830) (-920.165) -- 0:00:19
682500 -- (-923.118) [-919.448] (-925.218) (-919.609) * (-923.362) (-923.622) [-919.672] (-923.911) -- 0:00:19
683000 -- (-920.037) (-919.830) (-922.689) [-919.606] * (-923.956) (-924.125) [-920.238] (-919.930) -- 0:00:19
683500 -- (-922.607) (-922.970) (-922.647) [-924.035] * [-922.440] (-922.574) (-920.649) (-922.435) -- 0:00:19
684000 -- (-922.891) (-921.166) [-920.868] (-921.676) * (-922.798) (-926.722) (-920.234) [-922.101] -- 0:00:19
684500 -- [-921.822] (-922.002) (-920.795) (-924.360) * (-923.429) [-924.215] (-920.828) (-922.433) -- 0:00:19
685000 -- [-921.088] (-921.533) (-921.284) (-923.942) * (-921.446) (-922.674) [-925.038] (-922.239) -- 0:00:19
Average standard deviation of split frequencies: 0.010136
685500 -- (-919.860) (-922.556) (-922.253) [-924.151] * [-923.380] (-928.422) (-922.192) (-920.223) -- 0:00:19
686000 -- (-921.372) (-924.418) (-921.442) [-920.096] * [-920.350] (-924.305) (-923.039) (-919.860) -- 0:00:19
686500 -- [-920.585] (-921.635) (-920.342) (-925.544) * (-921.818) (-922.167) (-920.166) [-920.007] -- 0:00:19
687000 -- (-921.020) (-923.288) [-921.448] (-921.091) * [-920.605] (-919.790) (-920.890) (-921.564) -- 0:00:19
687500 -- (-920.857) (-921.470) [-925.281] (-921.019) * [-922.206] (-920.239) (-920.074) (-920.803) -- 0:00:19
688000 -- (-923.803) [-921.795] (-922.019) (-919.985) * [-923.004] (-921.948) (-924.430) (-921.264) -- 0:00:19
688500 -- [-923.114] (-923.158) (-921.425) (-920.923) * (-926.569) (-921.525) [-924.950] (-921.261) -- 0:00:19
689000 -- (-921.328) (-920.816) [-921.627] (-921.124) * (-920.917) [-921.433] (-925.305) (-925.863) -- 0:00:18
689500 -- [-922.471] (-920.063) (-922.569) (-919.849) * [-921.796] (-920.607) (-922.174) (-922.133) -- 0:00:18
690000 -- (-921.021) [-921.876] (-920.426) (-920.892) * (-924.119) [-919.578] (-923.427) (-921.491) -- 0:00:18
Average standard deviation of split frequencies: 0.009854
690500 -- [-922.927] (-920.889) (-920.333) (-922.539) * [-921.527] (-920.411) (-924.910) (-923.555) -- 0:00:18
691000 -- (-923.164) (-921.217) [-924.911] (-922.392) * (-920.584) (-921.447) (-920.619) [-921.079] -- 0:00:19
691500 -- (-922.935) (-919.717) [-919.965] (-920.241) * (-919.997) (-921.321) (-921.134) [-923.905] -- 0:00:19
692000 -- (-923.068) (-921.270) [-920.291] (-919.741) * (-921.314) [-920.865] (-922.761) (-922.822) -- 0:00:19
692500 -- (-921.324) (-920.657) [-920.535] (-922.369) * [-921.647] (-921.132) (-920.452) (-921.556) -- 0:00:19
693000 -- [-922.825] (-921.588) (-921.732) (-921.757) * (-923.614) (-920.052) (-923.040) [-920.999] -- 0:00:19
693500 -- (-923.747) [-921.196] (-919.938) (-921.912) * (-920.684) [-922.839] (-920.359) (-921.229) -- 0:00:19
694000 -- (-925.067) [-925.304] (-924.850) (-920.431) * [-921.147] (-920.156) (-921.599) (-921.886) -- 0:00:18
694500 -- (-922.111) (-922.583) (-921.713) [-921.292] * (-921.487) [-919.784] (-920.589) (-922.606) -- 0:00:18
695000 -- (-923.179) (-926.001) [-920.512] (-923.307) * (-923.485) [-919.712] (-922.599) (-921.351) -- 0:00:18
Average standard deviation of split frequencies: 0.009990
695500 -- (-921.386) (-920.557) (-921.134) [-920.694] * [-924.542] (-920.901) (-922.090) (-922.205) -- 0:00:18
696000 -- [-921.341] (-921.070) (-923.154) (-923.284) * (-920.838) (-924.387) [-922.821] (-921.927) -- 0:00:18
696500 -- [-921.021] (-919.602) (-921.978) (-920.510) * (-921.045) (-921.698) (-920.693) [-921.689] -- 0:00:18
697000 -- (-922.727) [-919.513] (-927.216) (-920.967) * [-922.751] (-921.062) (-920.210) (-927.071) -- 0:00:18
697500 -- (-920.819) (-920.725) (-920.403) [-921.780] * (-925.673) [-921.048] (-922.735) (-920.664) -- 0:00:18
698000 -- (-920.871) (-919.473) (-920.503) [-919.988] * (-921.766) (-920.936) (-924.211) [-919.514] -- 0:00:18
698500 -- [-921.297] (-920.088) (-924.560) (-919.975) * (-921.873) (-921.549) (-921.780) [-920.537] -- 0:00:18
699000 -- (-920.506) (-919.406) (-919.853) [-920.084] * (-921.121) (-919.778) (-919.811) [-920.592] -- 0:00:18
699500 -- [-920.798] (-919.939) (-921.137) (-922.694) * [-920.559] (-921.891) (-920.224) (-921.117) -- 0:00:18
700000 -- [-922.501] (-920.040) (-922.193) (-921.397) * (-922.289) (-920.155) [-920.224] (-924.903) -- 0:00:18
Average standard deviation of split frequencies: 0.008957
700500 -- (-924.273) [-924.686] (-922.321) (-921.821) * (-925.637) [-923.092] (-920.331) (-922.928) -- 0:00:18
701000 -- (-922.737) [-922.175] (-919.977) (-920.369) * (-920.819) (-921.601) (-922.352) [-920.915] -- 0:00:18
701500 -- (-921.729) [-920.755] (-921.897) (-921.282) * [-921.777] (-923.323) (-921.616) (-921.873) -- 0:00:18
702000 -- (-921.049) [-922.062] (-922.305) (-923.916) * (-920.269) (-923.061) (-920.501) [-921.318] -- 0:00:18
702500 -- [-921.766] (-922.904) (-922.406) (-928.970) * (-922.808) (-921.623) (-923.678) [-921.903] -- 0:00:18
703000 -- (-921.811) [-920.535] (-921.549) (-924.071) * (-920.113) (-921.870) [-922.470] (-921.380) -- 0:00:18
703500 -- (-920.263) (-921.352) [-919.234] (-923.156) * (-919.557) [-923.282] (-923.465) (-923.989) -- 0:00:18
704000 -- [-919.856] (-920.931) (-921.185) (-921.868) * [-919.557] (-921.264) (-919.735) (-920.639) -- 0:00:18
704500 -- (-920.954) (-921.387) (-923.653) [-921.782] * [-919.690] (-919.897) (-921.238) (-921.792) -- 0:00:18
705000 -- (-922.762) [-920.137] (-922.763) (-920.760) * (-920.870) (-927.563) [-923.113] (-922.096) -- 0:00:17
Average standard deviation of split frequencies: 0.009390
705500 -- (-923.123) (-921.413) [-923.943] (-920.767) * (-920.255) [-924.024] (-920.213) (-927.770) -- 0:00:17
706000 -- [-924.573] (-920.055) (-924.391) (-920.280) * [-920.177] (-920.657) (-919.860) (-925.086) -- 0:00:17
706500 -- (-924.496) [-921.388] (-920.708) (-921.223) * (-926.776) (-921.985) [-919.926] (-923.426) -- 0:00:17
707000 -- (-920.006) (-921.811) (-923.081) [-919.913] * (-921.408) (-920.023) (-919.757) [-923.569] -- 0:00:17
707500 -- (-920.692) (-922.961) (-920.193) [-920.030] * (-922.726) (-920.302) [-921.796] (-924.044) -- 0:00:18
708000 -- (-922.410) (-921.853) (-921.545) [-920.029] * (-922.308) (-922.199) (-921.706) [-920.128] -- 0:00:18
708500 -- (-923.514) [-924.926] (-922.706) (-920.848) * (-920.531) (-920.410) (-922.761) [-921.108] -- 0:00:18
709000 -- (-926.989) [-923.389] (-921.702) (-920.572) * (-919.915) (-919.891) (-921.984) [-919.402] -- 0:00:18
709500 -- [-926.666] (-924.414) (-919.797) (-920.610) * (-920.187) (-922.744) [-921.232] (-920.656) -- 0:00:18
710000 -- (-927.484) (-923.050) (-924.391) [-919.960] * (-920.816) (-921.244) (-923.538) [-920.227] -- 0:00:17
Average standard deviation of split frequencies: 0.008955
710500 -- (-922.399) [-922.793] (-924.852) (-919.920) * (-920.040) [-920.489] (-921.798) (-919.845) -- 0:00:17
711000 -- (-920.921) [-919.957] (-920.929) (-921.894) * (-921.670) [-921.392] (-920.928) (-920.445) -- 0:00:17
711500 -- (-920.165) [-920.882] (-920.711) (-921.545) * (-921.630) (-919.632) [-922.707] (-925.272) -- 0:00:17
712000 -- (-923.804) (-922.888) [-920.209] (-922.421) * (-925.020) [-920.996] (-921.588) (-923.491) -- 0:00:17
712500 -- (-921.838) [-919.677] (-923.338) (-921.965) * (-920.624) [-921.344] (-924.041) (-925.130) -- 0:00:17
713000 -- (-920.923) [-924.161] (-922.023) (-924.888) * (-921.461) (-920.950) [-920.404] (-920.797) -- 0:00:17
713500 -- (-920.662) [-924.826] (-922.188) (-921.497) * (-920.720) (-920.855) [-921.114] (-919.750) -- 0:00:17
714000 -- (-922.848) (-921.405) (-922.171) [-921.840] * (-922.070) (-921.558) (-921.295) [-921.315] -- 0:00:17
714500 -- (-919.953) [-924.339] (-921.113) (-926.011) * [-920.254] (-920.080) (-925.393) (-922.842) -- 0:00:17
715000 -- [-920.310] (-921.495) (-921.891) (-927.261) * [-921.527] (-920.706) (-926.052) (-922.443) -- 0:00:17
Average standard deviation of split frequencies: 0.008765
715500 -- (-920.540) [-921.614] (-921.816) (-922.233) * (-923.365) (-925.295) (-927.066) [-920.351] -- 0:00:17
716000 -- (-923.164) [-921.609] (-920.463) (-920.641) * (-922.775) (-919.320) (-919.908) [-920.415] -- 0:00:17
716500 -- (-921.322) (-921.233) [-920.433] (-920.719) * (-920.327) (-922.528) [-921.107] (-919.628) -- 0:00:17
717000 -- [-920.829] (-920.619) (-923.918) (-922.467) * (-921.272) [-919.833] (-921.261) (-919.879) -- 0:00:17
717500 -- (-921.834) [-920.623] (-920.197) (-925.327) * [-923.064] (-922.035) (-921.795) (-920.725) -- 0:00:17
718000 -- (-924.337) (-920.985) [-923.902] (-921.569) * (-921.688) [-923.511] (-923.765) (-919.957) -- 0:00:17
718500 -- (-919.985) (-922.084) (-921.527) [-920.815] * (-920.427) [-921.304] (-923.394) (-919.243) -- 0:00:17
719000 -- (-922.122) (-922.269) (-923.599) [-922.100] * (-921.222) [-920.332] (-924.564) (-922.495) -- 0:00:17
719500 -- (-922.714) (-921.316) (-922.951) [-924.393] * [-921.778] (-922.233) (-925.279) (-920.380) -- 0:00:17
720000 -- (-920.181) (-921.031) [-920.278] (-924.010) * (-920.426) [-920.902] (-922.697) (-920.581) -- 0:00:17
Average standard deviation of split frequencies: 0.008953
720500 -- (-919.865) (-920.962) [-922.257] (-921.912) * (-922.776) (-922.329) [-920.252] (-923.043) -- 0:00:17
721000 -- (-920.145) [-921.461] (-921.405) (-923.217) * (-922.753) (-921.711) [-921.155] (-922.659) -- 0:00:17
721500 -- (-921.415) [-920.779] (-924.240) (-923.165) * [-923.343] (-919.412) (-923.936) (-923.493) -- 0:00:16
722000 -- (-921.808) [-920.610] (-919.886) (-922.075) * (-923.653) (-919.681) [-920.909] (-921.356) -- 0:00:16
722500 -- [-921.142] (-919.443) (-922.905) (-922.122) * (-920.665) (-919.477) (-921.472) [-921.032] -- 0:00:16
723000 -- (-920.656) (-921.539) [-920.403] (-922.315) * (-920.615) [-919.637] (-923.971) (-923.099) -- 0:00:16
723500 -- (-921.361) [-921.344] (-921.341) (-920.760) * (-921.971) (-921.906) [-925.223] (-922.795) -- 0:00:16
724000 -- (-919.835) [-920.825] (-921.567) (-921.526) * [-923.979] (-921.859) (-921.606) (-920.289) -- 0:00:16
724500 -- (-920.272) (-921.082) (-923.274) [-921.575] * (-923.205) [-922.323] (-923.616) (-923.878) -- 0:00:17
725000 -- (-920.683) (-921.497) (-924.938) [-919.963] * (-924.748) (-921.450) [-921.563] (-924.819) -- 0:00:17
Average standard deviation of split frequencies: 0.008806
725500 -- [-920.241] (-920.013) (-921.029) (-923.320) * (-923.624) (-924.247) (-921.792) [-920.139] -- 0:00:17
726000 -- (-920.054) (-920.795) [-920.866] (-923.942) * (-922.161) (-921.857) (-921.533) [-922.682] -- 0:00:16
726500 -- (-920.442) [-921.698] (-924.073) (-920.942) * (-926.001) [-921.282] (-924.326) (-924.889) -- 0:00:16
727000 -- (-920.783) (-919.574) [-919.533] (-920.518) * (-925.927) (-921.928) [-921.270] (-922.539) -- 0:00:16
727500 -- (-922.178) (-924.535) (-921.081) [-919.809] * (-921.925) (-923.202) [-920.197] (-921.287) -- 0:00:16
728000 -- [-920.685] (-922.338) (-920.882) (-923.688) * [-920.368] (-924.036) (-922.863) (-920.912) -- 0:00:16
728500 -- (-921.686) (-926.663) [-920.717] (-923.820) * [-921.211] (-923.281) (-925.200) (-921.675) -- 0:00:16
729000 -- (-921.198) (-924.374) (-920.360) [-919.981] * [-922.071] (-924.148) (-921.128) (-920.171) -- 0:00:16
729500 -- (-921.783) (-922.453) [-920.170] (-921.034) * (-920.351) [-923.184] (-926.646) (-920.540) -- 0:00:16
730000 -- [-924.358] (-921.376) (-919.889) (-919.981) * (-923.106) [-921.501] (-923.425) (-922.141) -- 0:00:16
Average standard deviation of split frequencies: 0.008992
730500 -- (-920.847) [-922.380] (-921.657) (-921.838) * (-923.373) (-921.419) [-927.187] (-922.459) -- 0:00:16
731000 -- (-921.289) [-920.263] (-920.185) (-921.918) * (-923.146) (-921.501) (-926.159) [-923.699] -- 0:00:16
731500 -- [-921.272] (-920.423) (-919.881) (-922.985) * [-920.691] (-921.826) (-921.996) (-922.129) -- 0:00:16
732000 -- (-921.910) (-921.575) [-920.284] (-922.118) * (-927.495) [-921.838] (-920.779) (-922.213) -- 0:00:16
732500 -- (-925.810) (-921.260) [-922.427] (-922.264) * (-928.325) (-921.311) (-920.085) [-921.912] -- 0:00:16
733000 -- [-921.073] (-921.144) (-920.955) (-921.825) * (-921.442) (-920.486) [-920.358] (-920.929) -- 0:00:16
733500 -- [-923.171] (-923.427) (-924.263) (-921.928) * (-921.449) (-919.545) [-921.389] (-921.678) -- 0:00:16
734000 -- (-921.784) [-920.751] (-924.402) (-920.651) * (-921.922) (-923.247) (-921.193) [-923.907] -- 0:00:16
734500 -- (-926.014) [-921.994] (-923.513) (-919.271) * [-920.302] (-927.928) (-920.308) (-927.980) -- 0:00:16
735000 -- (-929.729) (-922.710) (-919.588) [-924.248] * (-921.555) (-923.899) [-921.534] (-921.051) -- 0:00:16
Average standard deviation of split frequencies: 0.008447
735500 -- [-922.406] (-925.908) (-920.743) (-922.168) * (-920.953) (-921.461) (-921.011) [-920.363] -- 0:00:16
736000 -- (-927.226) (-920.236) (-920.329) [-923.219] * (-921.020) (-921.818) (-924.211) [-920.068] -- 0:00:16
736500 -- (-923.116) [-924.446] (-921.164) (-922.531) * (-920.510) [-921.209] (-922.193) (-927.349) -- 0:00:16
737000 -- (-921.541) (-922.595) (-928.358) [-921.412] * (-925.408) [-922.210] (-922.042) (-922.558) -- 0:00:16
737500 -- (-919.985) (-923.094) [-923.369] (-920.752) * (-929.228) (-922.580) [-922.338] (-921.505) -- 0:00:16
738000 -- (-924.268) (-923.451) [-921.128] (-924.056) * (-924.497) (-920.295) [-920.350] (-921.505) -- 0:00:15
738500 -- (-920.376) [-921.127] (-921.828) (-923.918) * (-930.346) (-922.598) [-919.821] (-921.348) -- 0:00:15
739000 -- (-922.000) (-920.179) [-923.799] (-921.699) * (-923.020) (-922.354) (-924.305) [-920.288] -- 0:00:15
739500 -- [-922.070] (-921.757) (-923.961) (-920.849) * (-922.479) (-922.160) (-924.632) [-921.190] -- 0:00:15
740000 -- (-924.215) (-924.013) [-921.599] (-927.213) * (-926.863) (-921.188) [-919.844] (-924.802) -- 0:00:15
Average standard deviation of split frequencies: 0.008075
740500 -- (-924.943) (-920.661) [-920.906] (-923.969) * (-922.558) [-921.232] (-919.802) (-926.349) -- 0:00:15
741000 -- [-922.643] (-921.761) (-925.008) (-919.884) * (-927.874) (-920.048) (-921.193) [-925.822] -- 0:00:16
741500 -- (-920.579) (-926.221) [-922.286] (-920.910) * (-921.877) [-920.013] (-920.311) (-922.232) -- 0:00:16
742000 -- [-922.112] (-923.733) (-923.734) (-921.270) * (-923.110) (-922.830) (-923.211) [-921.275] -- 0:00:15
742500 -- (-923.556) (-921.542) (-920.190) [-921.273] * (-920.044) (-921.382) [-922.453] (-921.756) -- 0:00:15
743000 -- (-923.353) (-920.552) (-921.063) [-921.019] * (-922.270) (-921.987) (-922.108) [-922.159] -- 0:00:15
743500 -- [-923.244] (-922.619) (-923.830) (-921.238) * (-920.664) (-922.578) (-921.587) [-921.216] -- 0:00:15
744000 -- (-922.567) (-921.714) (-921.751) [-920.040] * (-921.705) (-926.699) (-922.529) [-919.944] -- 0:00:15
744500 -- [-924.778] (-919.470) (-922.757) (-919.246) * (-921.240) (-921.761) (-921.834) [-920.250] -- 0:00:15
745000 -- (-922.136) [-919.764] (-924.217) (-920.167) * (-920.794) [-920.279] (-921.065) (-921.919) -- 0:00:15
Average standard deviation of split frequencies: 0.008175
745500 -- [-921.511] (-919.941) (-924.713) (-924.008) * (-920.344) (-920.412) (-922.173) [-921.024] -- 0:00:15
746000 -- (-921.127) (-926.158) (-922.288) [-921.088] * (-920.255) (-919.850) (-920.790) [-919.771] -- 0:00:15
746500 -- [-922.003] (-921.640) (-920.334) (-921.067) * (-919.535) (-920.678) [-925.931] (-919.932) -- 0:00:15
747000 -- (-923.333) [-921.968] (-921.030) (-920.337) * [-920.268] (-920.471) (-920.986) (-922.659) -- 0:00:15
747500 -- [-921.241] (-919.879) (-923.764) (-920.453) * (-923.903) (-922.823) [-921.014] (-922.369) -- 0:00:15
748000 -- (-922.254) (-923.509) [-923.110] (-920.763) * (-919.707) (-922.004) (-925.552) [-922.913] -- 0:00:15
748500 -- (-921.293) (-923.648) [-922.940] (-920.864) * [-919.596] (-925.120) (-927.739) (-921.483) -- 0:00:15
749000 -- [-921.849] (-920.509) (-928.020) (-925.106) * (-921.503) (-921.604) (-919.490) [-922.004] -- 0:00:15
749500 -- (-924.171) [-922.592] (-921.890) (-923.315) * [-922.295] (-921.433) (-920.337) (-921.189) -- 0:00:15
750000 -- (-922.706) (-921.519) [-922.038] (-919.660) * (-928.702) [-920.731] (-920.264) (-923.036) -- 0:00:15
Average standard deviation of split frequencies: 0.008321
750500 -- (-920.794) (-919.855) [-921.531] (-921.468) * [-922.111] (-922.603) (-920.875) (-921.711) -- 0:00:15
751000 -- (-922.089) [-922.522] (-924.380) (-919.328) * (-921.303) (-924.189) [-920.270] (-922.874) -- 0:00:15
751500 -- [-920.898] (-922.706) (-926.342) (-923.373) * [-920.881] (-924.831) (-923.374) (-921.278) -- 0:00:15
752000 -- (-922.407) (-920.897) (-922.528) [-920.165] * (-923.417) [-924.221] (-922.037) (-923.290) -- 0:00:15
752500 -- (-923.083) (-923.373) (-923.337) [-920.424] * (-921.559) [-921.233] (-920.309) (-920.131) -- 0:00:15
753000 -- (-921.420) (-922.113) [-922.927] (-920.654) * (-922.216) (-920.849) [-923.163] (-923.449) -- 0:00:15
753500 -- (-923.138) (-922.022) (-922.798) [-921.465] * [-921.482] (-921.471) (-923.711) (-921.664) -- 0:00:15
754000 -- (-922.082) [-921.898] (-922.216) (-921.617) * (-920.129) (-926.254) (-923.266) [-920.919] -- 0:00:15
754500 -- (-922.749) (-924.491) [-921.624] (-923.479) * [-920.147] (-920.105) (-924.101) (-923.839) -- 0:00:14
755000 -- (-922.387) [-921.356] (-922.164) (-923.602) * (-920.846) (-920.411) [-920.841] (-923.923) -- 0:00:14
Average standard deviation of split frequencies: 0.008067
755500 -- (-923.750) [-920.294] (-923.265) (-921.339) * (-920.300) (-923.473) [-920.986] (-924.617) -- 0:00:14
756000 -- (-923.269) (-921.578) (-922.213) [-921.265] * (-920.500) [-922.614] (-920.977) (-920.462) -- 0:00:14
756500 -- (-920.984) (-922.880) (-919.677) [-921.840] * (-920.992) (-921.773) [-919.980] (-922.347) -- 0:00:14
757000 -- (-921.379) (-928.472) [-920.287] (-923.221) * [-920.183] (-921.158) (-920.528) (-927.913) -- 0:00:14
757500 -- (-922.151) (-929.624) [-922.280] (-923.281) * (-922.451) (-920.753) [-921.273] (-924.501) -- 0:00:15
758000 -- (-923.497) (-920.866) [-920.808] (-920.763) * (-921.512) [-921.261] (-925.659) (-921.049) -- 0:00:15
758500 -- (-920.544) [-926.702] (-926.204) (-920.284) * (-919.372) [-921.286] (-924.917) (-920.561) -- 0:00:14
759000 -- [-921.771] (-921.213) (-923.077) (-927.820) * [-920.084] (-921.933) (-921.199) (-920.829) -- 0:00:14
759500 -- (-924.197) (-919.977) [-920.208] (-920.848) * (-920.904) (-922.642) [-921.243] (-921.563) -- 0:00:14
760000 -- [-922.958] (-920.087) (-921.565) (-921.420) * (-920.202) (-921.344) (-921.724) [-920.165] -- 0:00:14
Average standard deviation of split frequencies: 0.007785
760500 -- (-919.889) (-921.942) (-923.367) [-922.362] * (-921.673) (-927.283) (-921.380) [-919.274] -- 0:00:14
761000 -- (-921.075) [-922.088] (-923.340) (-921.944) * (-921.017) (-921.948) [-920.738] (-920.221) -- 0:00:14
761500 -- (-920.095) [-923.926] (-921.220) (-921.261) * (-923.155) (-926.934) [-920.362] (-923.121) -- 0:00:14
762000 -- [-921.627] (-921.927) (-923.379) (-919.598) * (-922.394) [-923.364] (-921.447) (-922.146) -- 0:00:14
762500 -- (-924.124) (-920.007) (-923.854) [-920.639] * [-921.371] (-922.922) (-920.674) (-923.316) -- 0:00:14
763000 -- (-922.479) (-919.731) [-922.226] (-920.113) * (-920.979) [-921.060] (-920.746) (-923.499) -- 0:00:14
763500 -- (-922.311) [-919.621] (-919.790) (-924.847) * [-920.060] (-920.643) (-920.330) (-920.150) -- 0:00:14
764000 -- (-923.976) [-920.261] (-920.217) (-921.959) * [-924.810] (-923.333) (-919.817) (-922.853) -- 0:00:14
764500 -- [-921.428] (-920.794) (-924.003) (-927.374) * (-919.694) (-921.845) (-920.693) [-922.407] -- 0:00:14
765000 -- (-919.994) (-923.461) [-923.371] (-920.606) * (-922.355) [-927.728] (-921.897) (-920.616) -- 0:00:14
Average standard deviation of split frequencies: 0.008308
765500 -- [-920.146] (-919.786) (-924.512) (-921.253) * (-920.182) [-926.361] (-929.382) (-928.047) -- 0:00:14
766000 -- (-922.523) (-924.363) [-921.313] (-920.753) * (-922.958) [-923.941] (-925.786) (-925.751) -- 0:00:14
766500 -- (-923.160) [-921.584] (-922.084) (-919.307) * (-921.298) [-921.126] (-923.617) (-926.933) -- 0:00:14
767000 -- (-921.996) [-922.566] (-923.634) (-920.444) * [-920.366] (-922.364) (-923.490) (-921.117) -- 0:00:14
767500 -- (-922.070) (-920.654) (-920.157) [-920.106] * [-921.082] (-924.710) (-921.473) (-925.692) -- 0:00:14
768000 -- (-921.344) [-919.858] (-920.251) (-920.430) * (-923.109) [-920.934] (-921.312) (-922.486) -- 0:00:14
768500 -- [-923.021] (-925.271) (-920.165) (-921.231) * (-923.627) [-920.998] (-924.743) (-921.873) -- 0:00:14
769000 -- [-922.514] (-924.521) (-919.542) (-922.024) * [-920.669] (-922.640) (-921.116) (-920.497) -- 0:00:14
769500 -- (-923.063) (-922.295) [-921.079] (-920.850) * [-921.194] (-921.759) (-921.613) (-921.790) -- 0:00:14
770000 -- [-920.607] (-923.961) (-921.921) (-921.898) * [-921.524] (-919.943) (-921.903) (-921.370) -- 0:00:14
Average standard deviation of split frequencies: 0.008678
770500 -- [-919.804] (-920.943) (-921.181) (-921.374) * [-921.068] (-921.470) (-920.392) (-922.566) -- 0:00:13
771000 -- (-919.884) (-922.333) [-921.588] (-922.082) * [-921.391] (-923.759) (-922.564) (-922.296) -- 0:00:13
771500 -- (-923.493) (-922.373) (-923.034) [-920.989] * (-921.674) [-921.145] (-926.001) (-921.092) -- 0:00:13
772000 -- [-921.931] (-921.076) (-922.950) (-926.580) * (-920.350) (-923.053) [-920.772] (-928.089) -- 0:00:13
772500 -- (-928.187) (-923.138) (-920.582) [-921.989] * (-919.665) [-921.647] (-920.779) (-923.861) -- 0:00:13
773000 -- (-919.676) [-921.907] (-921.011) (-921.056) * (-922.060) (-924.575) (-919.356) [-922.819] -- 0:00:13
773500 -- (-922.082) [-920.763] (-921.008) (-925.637) * (-923.149) (-923.365) [-921.164] (-921.569) -- 0:00:13
774000 -- [-920.183] (-922.005) (-923.029) (-923.733) * [-920.939] (-919.742) (-920.745) (-922.364) -- 0:00:13
774500 -- [-920.423] (-921.961) (-924.168) (-923.420) * (-921.719) [-921.888] (-919.987) (-921.540) -- 0:00:13
775000 -- (-926.723) (-924.082) (-926.586) [-922.192] * [-925.889] (-923.866) (-921.005) (-923.099) -- 0:00:13
Average standard deviation of split frequencies: 0.008467
775500 -- (-922.746) (-923.730) [-920.260] (-923.574) * (-919.515) [-920.661] (-922.446) (-921.400) -- 0:00:13
776000 -- (-922.326) (-923.393) (-920.001) [-920.311] * (-920.141) (-923.638) [-919.903] (-920.979) -- 0:00:13
776500 -- (-921.720) (-924.283) [-922.685] (-920.650) * [-920.035] (-922.592) (-919.721) (-924.179) -- 0:00:13
777000 -- (-922.541) (-922.688) [-921.210] (-920.655) * [-920.599] (-921.135) (-920.030) (-920.854) -- 0:00:13
777500 -- (-923.109) (-919.914) [-921.050] (-921.619) * [-921.966] (-920.514) (-923.250) (-921.757) -- 0:00:13
778000 -- (-922.490) (-919.586) (-921.711) [-922.909] * (-920.484) [-922.256] (-921.762) (-920.036) -- 0:00:13
778500 -- (-925.242) (-921.107) (-919.501) [-920.606] * (-921.800) [-922.272] (-922.023) (-919.524) -- 0:00:13
779000 -- (-924.688) [-919.989] (-920.703) (-923.481) * (-921.005) (-921.500) (-922.128) [-919.351] -- 0:00:13
779500 -- (-921.342) [-921.257] (-922.495) (-920.804) * (-920.943) (-924.273) [-922.285] (-922.423) -- 0:00:13
780000 -- (-924.807) (-921.036) [-921.126] (-921.304) * (-921.507) (-922.222) [-920.471] (-920.108) -- 0:00:13
Average standard deviation of split frequencies: 0.008567
780500 -- (-920.596) (-921.543) [-919.627] (-921.662) * [-920.188] (-921.425) (-923.405) (-920.242) -- 0:00:13
781000 -- (-919.837) (-920.190) [-921.473] (-922.978) * (-920.760) [-921.565] (-926.725) (-920.375) -- 0:00:13
781500 -- (-920.085) [-921.326] (-923.927) (-920.737) * (-920.955) [-921.549] (-924.078) (-921.620) -- 0:00:13
782000 -- (-920.430) (-924.481) (-923.245) [-926.255] * (-919.930) (-922.764) (-919.908) [-920.631] -- 0:00:13
782500 -- [-920.181] (-921.993) (-922.100) (-921.477) * (-924.025) [-919.583] (-922.571) (-924.901) -- 0:00:13
783000 -- (-924.863) (-922.210) [-919.871] (-921.120) * (-923.779) (-920.292) [-919.454] (-923.500) -- 0:00:13
783500 -- (-921.653) (-923.180) (-921.977) [-924.049] * [-922.608] (-922.526) (-921.139) (-922.003) -- 0:00:13
784000 -- (-922.362) (-921.692) [-920.819] (-921.323) * (-921.712) [-920.387] (-921.139) (-921.331) -- 0:00:13
784500 -- (-921.156) [-923.619] (-925.167) (-923.969) * (-920.685) [-919.893] (-923.324) (-919.810) -- 0:00:13
785000 -- [-921.593] (-920.904) (-923.355) (-923.858) * (-920.641) (-921.761) [-923.398] (-921.441) -- 0:00:13
Average standard deviation of split frequencies: 0.008509
785500 -- (-920.579) (-922.634) [-919.665] (-923.860) * (-922.376) (-920.450) (-922.847) [-920.762] -- 0:00:13
786000 -- [-920.486] (-921.345) (-924.628) (-928.175) * [-921.027] (-923.374) (-923.618) (-921.784) -- 0:00:13
786500 -- [-923.680] (-927.203) (-921.200) (-925.713) * [-920.595] (-920.754) (-926.605) (-921.788) -- 0:00:13
787000 -- (-922.710) (-921.741) (-923.635) [-921.252] * (-924.263) [-922.085] (-921.409) (-922.333) -- 0:00:12
787500 -- (-924.136) [-922.448] (-923.289) (-921.224) * [-920.166] (-919.563) (-922.819) (-919.796) -- 0:00:12
788000 -- (-930.500) (-925.165) [-922.411] (-922.016) * (-921.692) (-920.232) [-921.465] (-920.286) -- 0:00:12
788500 -- (-926.295) (-921.816) (-923.765) [-923.707] * [-920.493] (-922.489) (-920.435) (-921.158) -- 0:00:12
789000 -- (-922.329) (-924.046) [-923.044] (-922.046) * (-920.460) [-922.273] (-920.883) (-921.958) -- 0:00:12
789500 -- (-924.434) (-922.474) [-921.640] (-920.886) * (-920.368) (-921.175) [-919.642] (-919.897) -- 0:00:12
790000 -- (-921.407) (-923.461) [-925.520] (-923.607) * (-921.574) (-925.380) [-922.008] (-920.882) -- 0:00:12
Average standard deviation of split frequencies: 0.008533
790500 -- (-921.293) (-923.649) (-928.305) [-921.296] * (-922.334) [-924.464] (-921.651) (-920.742) -- 0:00:12
791000 -- [-922.904] (-925.727) (-924.140) (-922.531) * (-922.978) (-920.647) [-924.511] (-921.535) -- 0:00:12
791500 -- (-921.706) (-922.247) (-921.437) [-923.430] * (-925.641) (-921.944) [-920.201] (-924.486) -- 0:00:12
792000 -- (-923.109) (-922.225) [-920.586] (-921.549) * [-919.658] (-919.450) (-921.443) (-921.278) -- 0:00:12
792500 -- (-920.436) [-921.075] (-919.708) (-926.953) * (-921.536) [-920.618] (-922.662) (-924.105) -- 0:00:12
793000 -- [-919.921] (-921.075) (-921.428) (-919.428) * (-924.163) [-924.889] (-922.449) (-927.582) -- 0:00:12
793500 -- [-920.136] (-922.437) (-925.122) (-919.428) * [-920.649] (-920.150) (-922.293) (-927.053) -- 0:00:12
794000 -- (-927.228) [-922.148] (-922.316) (-921.778) * [-923.222] (-926.333) (-920.196) (-922.370) -- 0:00:12
794500 -- (-927.492) (-921.260) [-920.028] (-922.815) * (-921.555) [-925.719] (-920.852) (-921.757) -- 0:00:12
795000 -- (-923.485) [-919.611] (-919.918) (-920.418) * (-925.507) (-922.116) [-921.790] (-923.868) -- 0:00:12
Average standard deviation of split frequencies: 0.008328
795500 -- (-920.842) (-920.525) (-924.091) [-920.569] * (-924.204) (-922.574) (-921.129) [-922.939] -- 0:00:12
796000 -- (-919.972) [-921.975] (-925.151) (-920.118) * [-925.761] (-922.633) (-920.692) (-920.564) -- 0:00:12
796500 -- (-923.665) [-919.402] (-922.876) (-922.022) * (-919.674) (-919.390) [-920.233] (-926.399) -- 0:00:12
797000 -- (-923.363) [-919.874] (-921.635) (-922.210) * (-919.891) (-920.832) [-922.179] (-924.731) -- 0:00:12
797500 -- (-921.174) (-922.712) (-923.619) [-920.238] * (-922.727) (-920.531) [-922.220] (-921.481) -- 0:00:12
798000 -- [-921.981] (-922.343) (-922.060) (-921.597) * (-925.203) (-920.906) [-921.120] (-923.407) -- 0:00:12
798500 -- [-920.375] (-930.389) (-923.069) (-920.315) * (-925.833) [-921.695] (-920.899) (-924.053) -- 0:00:12
799000 -- (-920.605) (-922.909) (-922.244) [-920.153] * (-923.607) [-922.206] (-924.492) (-921.006) -- 0:00:12
799500 -- (-921.249) (-921.799) (-920.331) [-920.556] * [-920.121] (-920.462) (-922.319) (-920.294) -- 0:00:12
800000 -- (-920.567) (-925.158) (-926.447) [-920.441] * [-921.509] (-922.142) (-923.127) (-920.756) -- 0:00:12
Average standard deviation of split frequencies: 0.008059
800500 -- (-920.271) (-923.465) [-920.362] (-920.528) * (-920.191) (-921.029) (-924.724) [-920.773] -- 0:00:12
801000 -- (-920.734) (-920.817) [-920.843] (-920.640) * (-919.404) (-921.256) [-920.583] (-920.867) -- 0:00:12
801500 -- (-921.677) [-920.242] (-920.012) (-920.041) * (-920.943) (-922.040) [-923.836] (-923.762) -- 0:00:12
802000 -- (-926.639) (-920.866) [-921.279] (-922.868) * (-920.308) [-923.707] (-923.453) (-923.792) -- 0:00:12
802500 -- (-920.729) (-922.575) [-922.178] (-924.993) * (-921.825) [-920.977] (-920.409) (-921.587) -- 0:00:12
803000 -- [-920.528] (-919.681) (-921.114) (-922.602) * (-922.073) (-923.911) [-922.542] (-921.766) -- 0:00:12
803500 -- (-920.743) [-920.306] (-922.006) (-921.846) * (-923.437) (-920.712) [-923.578] (-920.825) -- 0:00:11
804000 -- (-921.730) [-920.366] (-922.060) (-920.699) * (-923.113) [-919.847] (-920.020) (-920.275) -- 0:00:11
804500 -- (-925.913) (-920.378) [-922.993] (-927.721) * (-920.750) [-920.191] (-920.439) (-920.677) -- 0:00:11
805000 -- (-920.388) (-920.077) (-923.037) [-923.153] * (-921.614) (-920.560) (-921.217) [-921.534] -- 0:00:11
Average standard deviation of split frequencies: 0.008079
805500 -- [-922.942] (-925.636) (-921.392) (-925.026) * (-925.992) (-921.700) (-922.350) [-921.780] -- 0:00:11
806000 -- (-920.592) (-920.485) (-921.001) [-922.366] * (-923.151) (-920.304) [-921.647] (-921.291) -- 0:00:11
806500 -- (-921.035) [-921.199] (-921.113) (-921.237) * (-925.428) [-919.879] (-920.320) (-920.494) -- 0:00:11
807000 -- (-920.797) (-920.489) (-921.174) [-926.249] * (-922.762) [-919.837] (-921.400) (-921.378) -- 0:00:11
807500 -- (-920.316) [-923.616] (-920.234) (-922.035) * [-923.168] (-920.360) (-922.330) (-921.576) -- 0:00:11
808000 -- (-923.055) (-923.603) [-921.066] (-923.315) * (-922.346) (-919.967) [-922.740] (-922.319) -- 0:00:11
808500 -- (-921.895) [-920.430] (-920.311) (-925.966) * (-921.204) [-921.843] (-924.037) (-920.220) -- 0:00:11
809000 -- (-921.230) (-921.323) (-923.131) [-922.506] * (-924.822) [-920.641] (-920.967) (-923.152) -- 0:00:11
809500 -- [-923.322] (-920.976) (-921.104) (-929.688) * (-920.521) [-923.047] (-924.813) (-920.782) -- 0:00:11
810000 -- (-926.481) (-925.044) [-920.018] (-929.382) * (-920.624) (-923.729) (-924.216) [-920.772] -- 0:00:11
Average standard deviation of split frequencies: 0.008468
810500 -- [-920.411] (-924.179) (-919.886) (-924.567) * (-921.103) (-920.997) [-921.674] (-921.293) -- 0:00:11
811000 -- (-923.227) (-923.382) (-922.162) [-921.196] * (-920.995) (-921.399) (-921.938) [-923.098] -- 0:00:11
811500 -- (-927.530) (-922.053) [-929.061] (-919.689) * (-921.723) [-920.977] (-923.654) (-922.822) -- 0:00:11
812000 -- (-920.654) (-921.158) (-924.241) [-925.182] * (-923.315) (-922.032) (-923.207) [-921.221] -- 0:00:11
812500 -- (-919.686) [-920.938] (-920.159) (-920.971) * (-922.573) (-921.862) (-920.799) [-921.833] -- 0:00:11
813000 -- (-919.765) (-920.120) [-920.936] (-927.451) * (-919.678) (-927.209) (-921.798) [-924.293] -- 0:00:11
813500 -- (-920.573) (-920.255) [-924.384] (-924.624) * (-919.891) (-919.934) [-920.371] (-922.354) -- 0:00:11
814000 -- (-924.951) (-921.224) [-920.699] (-921.186) * (-919.820) (-920.709) [-924.284] (-923.388) -- 0:00:11
814500 -- [-928.908] (-921.649) (-921.266) (-923.003) * (-920.200) (-919.861) [-923.395] (-925.483) -- 0:00:11
815000 -- [-922.066] (-920.913) (-924.016) (-922.158) * [-919.852] (-920.352) (-921.105) (-924.355) -- 0:00:11
Average standard deviation of split frequencies: 0.008268
815500 -- [-919.873] (-920.820) (-919.907) (-922.378) * [-921.622] (-922.436) (-919.681) (-922.792) -- 0:00:11
816000 -- (-921.957) (-919.939) (-920.553) [-922.339] * (-922.515) [-920.293] (-920.172) (-922.187) -- 0:00:11
816500 -- (-920.669) (-920.969) [-919.934] (-920.744) * (-925.965) (-920.425) [-920.484] (-921.174) -- 0:00:11
817000 -- (-920.130) [-921.139] (-920.461) (-921.446) * (-922.374) (-925.084) [-920.652] (-924.570) -- 0:00:11
817500 -- [-919.207] (-920.204) (-925.568) (-921.801) * (-921.918) (-921.566) (-923.808) [-924.324] -- 0:00:11
818000 -- (-924.083) (-920.684) [-923.879] (-923.556) * [-919.932] (-925.134) (-922.018) (-921.836) -- 0:00:11
818500 -- (-922.919) (-920.838) [-923.505] (-923.677) * (-922.653) (-921.020) [-923.540] (-922.028) -- 0:00:11
819000 -- (-925.863) (-922.190) [-922.068] (-920.447) * (-921.698) (-922.062) (-925.603) [-920.772] -- 0:00:11
819500 -- [-922.650] (-920.730) (-920.809) (-921.229) * (-924.758) [-923.908] (-926.572) (-922.203) -- 0:00:11
820000 -- (-919.675) (-919.940) (-920.021) [-920.196] * (-920.667) (-921.448) (-922.444) [-920.305] -- 0:00:10
Average standard deviation of split frequencies: 0.008114
820500 -- [-922.005] (-924.813) (-919.783) (-921.423) * [-923.489] (-921.394) (-923.178) (-922.503) -- 0:00:10
821000 -- [-919.331] (-921.508) (-919.992) (-922.024) * (-922.575) (-922.092) (-922.830) [-921.038] -- 0:00:10
821500 -- [-922.583] (-923.461) (-920.708) (-920.096) * (-923.441) (-921.104) (-921.105) [-920.070] -- 0:00:10
822000 -- (-920.495) (-919.338) (-920.927) [-920.772] * [-921.826] (-923.449) (-922.542) (-922.243) -- 0:00:10
822500 -- (-921.781) (-920.083) [-921.849] (-920.338) * (-925.709) (-919.983) (-921.611) [-923.224] -- 0:00:10
823000 -- (-921.165) (-919.902) (-921.439) [-920.490] * (-921.462) (-922.359) [-922.894] (-923.186) -- 0:00:10
823500 -- (-921.830) [-920.092] (-919.714) (-921.560) * (-922.720) [-922.418] (-919.549) (-919.480) -- 0:00:10
824000 -- (-920.893) [-920.451] (-920.829) (-922.131) * [-921.117] (-924.647) (-919.929) (-921.117) -- 0:00:10
824500 -- (-919.887) [-920.726] (-919.922) (-923.160) * (-920.664) [-920.790] (-921.440) (-921.132) -- 0:00:10
825000 -- (-919.643) [-921.184] (-921.168) (-922.106) * (-921.864) [-919.584] (-921.997) (-920.696) -- 0:00:10
Average standard deviation of split frequencies: 0.008204
825500 -- (-919.553) (-921.265) (-926.076) [-919.755] * (-922.297) [-920.651] (-920.014) (-921.672) -- 0:00:10
826000 -- (-919.316) (-923.127) (-926.259) [-921.728] * (-925.428) (-924.274) (-921.272) [-920.775] -- 0:00:10
826500 -- (-922.116) [-920.585] (-925.623) (-920.991) * (-923.301) (-920.279) (-921.092) [-920.733] -- 0:00:10
827000 -- (-921.943) (-921.425) (-924.517) [-920.326] * (-920.272) (-920.944) [-920.041] (-920.329) -- 0:00:10
827500 -- (-920.916) [-920.466] (-919.643) (-920.741) * (-920.321) [-920.323] (-921.923) (-922.260) -- 0:00:10
828000 -- [-920.028] (-920.042) (-921.716) (-921.663) * [-920.107] (-923.869) (-920.558) (-920.598) -- 0:00:10
828500 -- (-922.597) [-920.011] (-921.660) (-922.619) * [-920.469] (-923.203) (-920.542) (-921.663) -- 0:00:10
829000 -- (-922.984) (-919.383) [-921.630] (-924.863) * (-920.329) [-922.237] (-923.471) (-921.042) -- 0:00:10
829500 -- (-924.182) (-921.691) [-923.052] (-925.080) * (-920.659) (-924.961) [-921.240] (-921.308) -- 0:00:10
830000 -- (-922.458) (-926.639) [-921.814] (-924.653) * (-920.856) (-923.417) (-921.079) [-921.543] -- 0:00:10
Average standard deviation of split frequencies: 0.008399
830500 -- [-920.005] (-923.248) (-922.406) (-920.110) * (-920.979) (-920.600) [-920.871] (-920.612) -- 0:00:10
831000 -- (-920.017) (-921.991) [-922.143] (-921.780) * [-922.999] (-921.648) (-919.784) (-920.729) -- 0:00:10
831500 -- (-921.037) (-921.306) (-922.158) [-920.190] * [-919.956] (-922.559) (-920.278) (-920.350) -- 0:00:10
832000 -- [-920.745] (-923.085) (-921.086) (-920.522) * (-920.773) (-926.066) [-921.563] (-919.889) -- 0:00:10
832500 -- [-922.676] (-919.925) (-921.129) (-921.067) * (-921.850) (-925.434) (-926.056) [-919.514] -- 0:00:10
833000 -- (-923.492) [-920.732] (-921.026) (-923.834) * (-921.780) (-920.199) (-921.875) [-921.297] -- 0:00:10
833500 -- [-921.552] (-921.261) (-922.232) (-920.149) * [-921.115] (-920.200) (-924.456) (-920.542) -- 0:00:10
834000 -- [-920.529] (-921.148) (-926.194) (-920.384) * (-921.650) [-920.546] (-924.166) (-921.537) -- 0:00:10
834500 -- [-922.548] (-919.661) (-922.831) (-920.281) * [-922.908] (-928.326) (-923.362) (-920.086) -- 0:00:10
835000 -- (-919.784) [-921.891] (-926.240) (-920.491) * (-920.750) [-923.073] (-924.819) (-920.147) -- 0:00:10
Average standard deviation of split frequencies: 0.008421
835500 -- (-921.758) (-922.243) [-922.059] (-921.452) * (-922.687) (-922.029) [-920.400] (-919.463) -- 0:00:10
836000 -- (-921.974) [-928.002] (-922.615) (-924.710) * (-924.675) (-921.699) (-924.532) [-921.639] -- 0:00:10
836500 -- [-922.350] (-925.340) (-921.308) (-921.312) * (-923.135) [-920.907] (-924.433) (-923.740) -- 0:00:09
837000 -- (-921.085) [-920.461] (-920.025) (-921.011) * (-921.026) (-922.589) [-923.709] (-922.848) -- 0:00:09
837500 -- (-921.193) (-921.727) (-919.530) [-920.245] * (-919.388) [-919.841] (-922.670) (-920.853) -- 0:00:09
838000 -- [-921.940] (-926.816) (-923.374) (-920.979) * (-919.418) [-920.344] (-921.812) (-922.440) -- 0:00:09
838500 -- [-920.369] (-922.248) (-921.313) (-920.970) * [-923.192] (-923.141) (-921.502) (-924.727) -- 0:00:09
839000 -- (-926.903) (-923.928) [-921.320] (-923.773) * (-922.226) (-919.912) [-921.339] (-924.207) -- 0:00:09
839500 -- (-922.319) (-921.562) (-921.786) [-920.808] * (-922.040) (-922.452) (-921.246) [-921.014] -- 0:00:09
840000 -- [-920.703] (-919.791) (-921.145) (-922.249) * (-926.952) (-921.946) [-919.557] (-921.350) -- 0:00:09
Average standard deviation of split frequencies: 0.008411
840500 -- (-923.799) (-919.893) (-921.987) [-922.397] * (-919.841) (-921.066) (-921.500) [-920.199] -- 0:00:09
841000 -- (-921.781) (-920.623) [-925.684] (-920.979) * (-920.035) (-922.482) [-920.582] (-920.895) -- 0:00:09
841500 -- [-922.873] (-921.184) (-925.030) (-920.751) * (-921.116) (-924.985) [-920.416] (-920.345) -- 0:00:09
842000 -- (-923.665) (-920.593) (-924.138) [-921.637] * (-921.642) [-920.220] (-920.005) (-923.050) -- 0:00:09
842500 -- [-922.742] (-919.316) (-923.416) (-919.737) * (-924.268) (-920.970) (-921.017) [-920.863] -- 0:00:09
843000 -- (-922.158) [-919.961] (-920.237) (-920.768) * (-921.814) [-923.564] (-922.473) (-922.162) -- 0:00:09
843500 -- (-920.451) (-924.559) (-919.541) [-921.568] * (-921.929) [-922.846] (-920.198) (-924.746) -- 0:00:09
844000 -- [-921.142] (-924.093) (-928.628) (-919.671) * (-924.825) (-924.450) [-920.187] (-923.699) -- 0:00:09
844500 -- [-922.932] (-922.631) (-924.961) (-921.052) * [-921.419] (-920.559) (-921.206) (-920.415) -- 0:00:09
845000 -- (-921.776) [-919.392] (-932.283) (-921.638) * (-922.412) (-920.754) [-921.460] (-922.481) -- 0:00:09
Average standard deviation of split frequencies: 0.008358
845500 -- [-921.099] (-923.202) (-920.478) (-922.323) * (-920.134) [-920.504] (-920.712) (-921.537) -- 0:00:09
846000 -- (-928.288) (-922.730) [-924.528] (-919.679) * (-920.669) (-920.582) [-919.901] (-921.094) -- 0:00:09
846500 -- (-927.927) (-923.679) [-921.520] (-920.598) * [-919.267] (-920.439) (-922.980) (-920.469) -- 0:00:09
847000 -- [-923.041] (-921.271) (-921.472) (-920.989) * [-919.833] (-920.756) (-920.353) (-921.631) -- 0:00:09
847500 -- (-923.970) (-919.840) (-925.722) [-921.911] * (-921.438) (-921.507) [-920.292] (-924.049) -- 0:00:09
848000 -- (-923.974) (-920.347) [-929.035] (-921.070) * [-922.584] (-922.884) (-919.794) (-921.644) -- 0:00:09
848500 -- (-923.388) (-921.622) (-922.639) [-922.936] * (-925.475) [-922.075] (-920.831) (-924.314) -- 0:00:09
849000 -- (-921.157) [-920.386] (-920.115) (-924.026) * (-925.036) [-922.556] (-919.594) (-921.296) -- 0:00:09
849500 -- [-922.475] (-921.393) (-920.760) (-922.236) * [-920.779] (-920.051) (-920.643) (-921.030) -- 0:00:09
850000 -- (-924.628) [-921.388] (-924.976) (-920.455) * (-920.877) [-924.467] (-919.575) (-922.395) -- 0:00:09
Average standard deviation of split frequencies: 0.008497
850500 -- (-924.150) [-923.120] (-921.257) (-920.060) * (-925.708) (-923.057) (-922.247) [-920.466] -- 0:00:09
851000 -- (-922.466) [-922.499] (-921.448) (-919.794) * (-923.847) (-920.806) [-919.876] (-921.461) -- 0:00:09
851500 -- [-922.673] (-921.008) (-923.629) (-921.340) * (-924.117) (-920.328) [-919.938] (-922.434) -- 0:00:09
852000 -- (-924.509) (-920.287) [-922.644] (-920.332) * (-921.357) (-920.986) [-921.427] (-921.254) -- 0:00:09
852500 -- (-923.187) (-921.084) [-921.233] (-922.411) * (-926.142) [-921.702] (-922.577) (-920.240) -- 0:00:08
853000 -- (-923.262) [-922.318] (-919.687) (-922.627) * (-924.610) (-920.853) (-922.922) [-919.652] -- 0:00:08
853500 -- (-921.465) (-926.488) (-921.432) [-921.490] * (-924.401) (-925.067) [-923.208] (-924.318) -- 0:00:08
854000 -- (-925.719) (-926.668) (-920.641) [-921.400] * (-925.267) (-921.308) (-922.393) [-923.083] -- 0:00:08
854500 -- (-920.578) [-921.949] (-919.984) (-923.666) * (-922.111) [-920.831] (-925.375) (-921.779) -- 0:00:08
855000 -- (-920.543) [-921.517] (-920.450) (-920.085) * (-921.976) [-923.315] (-920.233) (-922.196) -- 0:00:08
Average standard deviation of split frequencies: 0.008518
855500 -- (-919.878) [-923.164] (-920.648) (-923.617) * (-920.955) (-926.460) (-920.392) [-920.274] -- 0:00:08
856000 -- (-920.330) [-922.172] (-920.532) (-922.882) * [-921.173] (-923.842) (-924.155) (-924.865) -- 0:00:08
856500 -- (-919.589) [-919.532] (-920.557) (-920.960) * (-924.187) [-928.799] (-920.423) (-921.185) -- 0:00:08
857000 -- (-921.550) (-920.412) (-921.788) [-921.409] * [-923.408] (-923.542) (-922.296) (-920.508) -- 0:00:08
857500 -- (-920.096) [-920.258] (-923.646) (-926.009) * (-922.811) (-920.383) (-923.573) [-919.710] -- 0:00:08
858000 -- (-923.640) [-923.285] (-920.845) (-930.139) * (-921.748) [-920.082] (-924.328) (-919.671) -- 0:00:08
858500 -- (-922.275) (-920.776) [-920.946] (-928.094) * (-921.965) (-924.191) (-920.581) [-921.377] -- 0:00:08
859000 -- (-922.813) (-919.872) (-923.645) [-922.953] * [-921.315] (-921.444) (-921.983) (-920.442) -- 0:00:08
859500 -- (-923.152) [-920.414] (-921.687) (-921.702) * (-921.807) (-921.748) (-923.615) [-920.367] -- 0:00:08
860000 -- (-925.385) (-923.475) [-921.928] (-921.610) * (-923.264) (-920.995) (-921.573) [-921.141] -- 0:00:08
Average standard deviation of split frequencies: 0.008508
860500 -- (-922.930) (-920.706) (-921.250) [-922.474] * (-921.703) [-921.448] (-920.640) (-925.562) -- 0:00:08
861000 -- (-921.968) [-921.682] (-923.961) (-920.610) * (-921.508) (-922.742) (-927.815) [-923.388] -- 0:00:08
861500 -- (-922.211) (-922.220) [-921.772] (-922.528) * [-923.027] (-921.246) (-922.738) (-921.491) -- 0:00:08
862000 -- (-922.307) (-921.326) (-920.467) [-923.710] * (-923.489) [-921.552] (-920.396) (-922.865) -- 0:00:08
862500 -- [-922.312] (-921.359) (-923.030) (-919.876) * (-925.568) (-922.920) [-922.191] (-924.840) -- 0:00:08
863000 -- [-920.188] (-921.430) (-921.725) (-922.268) * (-921.908) (-923.061) [-924.270] (-924.787) -- 0:00:08
863500 -- (-920.482) [-921.935] (-920.957) (-924.665) * (-921.171) (-922.495) [-921.045] (-920.454) -- 0:00:08
864000 -- [-920.229] (-920.215) (-920.652) (-921.650) * (-923.471) [-924.153] (-920.167) (-921.123) -- 0:00:08
864500 -- [-925.571] (-921.605) (-920.412) (-922.197) * (-921.863) (-927.083) [-920.291] (-920.422) -- 0:00:08
865000 -- (-922.082) [-922.088] (-920.584) (-925.397) * (-922.630) [-920.682] (-921.642) (-919.813) -- 0:00:08
Average standard deviation of split frequencies: 0.008201
865500 -- [-920.419] (-921.434) (-921.622) (-920.378) * [-921.390] (-922.302) (-922.167) (-922.474) -- 0:00:08
866000 -- (-925.841) (-922.605) (-922.236) [-920.920] * (-924.523) (-920.652) (-926.016) [-923.008] -- 0:00:08
866500 -- [-924.786] (-920.956) (-921.940) (-921.388) * (-923.076) (-920.650) (-920.837) [-922.600] -- 0:00:08
867000 -- (-922.387) [-921.076] (-923.106) (-921.536) * (-926.681) (-922.007) (-921.084) [-922.548] -- 0:00:08
867500 -- (-920.685) [-926.548] (-920.917) (-920.331) * (-919.903) (-919.501) [-920.249] (-920.983) -- 0:00:08
868000 -- (-924.414) (-926.672) (-921.945) [-927.781] * [-919.425] (-921.837) (-923.991) (-921.920) -- 0:00:08
868500 -- (-924.178) (-924.139) [-921.227] (-922.292) * (-920.109) (-925.233) (-923.222) [-924.628] -- 0:00:08
869000 -- (-924.423) (-923.748) [-921.004] (-919.352) * (-921.411) (-921.871) [-920.531] (-925.799) -- 0:00:07
869500 -- (-920.835) (-920.542) (-921.482) [-921.110] * (-920.539) (-922.161) [-924.020] (-924.996) -- 0:00:07
870000 -- (-923.549) (-920.280) [-920.897] (-919.992) * (-920.600) [-919.221] (-921.268) (-920.911) -- 0:00:07
Average standard deviation of split frequencies: 0.008302
870500 -- (-922.396) (-920.630) (-920.468) [-920.772] * (-921.125) [-919.443] (-922.642) (-920.625) -- 0:00:07
871000 -- (-923.941) (-920.330) (-922.272) [-920.683] * (-920.085) [-920.104] (-924.198) (-924.601) -- 0:00:07
871500 -- (-925.589) [-920.742] (-924.128) (-921.571) * (-921.754) [-923.678] (-921.238) (-923.121) -- 0:00:07
872000 -- (-925.453) (-921.816) (-920.020) [-921.473] * (-922.627) (-923.349) [-919.671] (-922.268) -- 0:00:07
872500 -- (-923.908) [-919.943] (-925.488) (-921.009) * (-920.987) [-922.796] (-920.841) (-923.995) -- 0:00:07
873000 -- (-924.457) (-925.289) [-922.082] (-923.153) * (-924.090) (-921.983) [-921.169] (-920.196) -- 0:00:07
873500 -- (-922.239) (-920.723) (-922.445) [-924.038] * [-921.976] (-924.788) (-924.769) (-921.492) -- 0:00:07
874000 -- (-925.119) (-924.828) (-925.854) [-921.909] * [-921.553] (-923.219) (-922.836) (-924.691) -- 0:00:07
874500 -- [-920.962] (-920.691) (-920.672) (-922.746) * (-922.336) [-920.412] (-922.299) (-921.352) -- 0:00:07
875000 -- [-921.085] (-925.026) (-922.183) (-922.190) * (-929.465) (-925.641) (-924.886) [-922.904] -- 0:00:07
Average standard deviation of split frequencies: 0.008467
875500 -- (-922.881) (-923.126) (-925.586) [-923.250] * (-920.755) (-920.594) [-920.535] (-921.734) -- 0:00:07
876000 -- (-920.719) (-920.554) (-922.149) [-922.136] * (-921.127) (-919.809) [-922.522] (-920.480) -- 0:00:07
876500 -- (-922.041) [-921.616] (-924.760) (-921.439) * (-920.299) (-921.605) (-924.210) [-920.762] -- 0:00:07
877000 -- (-922.101) (-922.978) (-920.059) [-920.975] * (-923.919) [-921.205] (-923.114) (-921.803) -- 0:00:07
877500 -- (-921.836) [-922.325] (-928.793) (-922.883) * (-923.523) (-923.311) (-921.014) [-921.070] -- 0:00:07
878000 -- (-921.917) (-921.224) (-928.120) [-922.590] * [-921.991] (-920.604) (-921.937) (-922.101) -- 0:00:07
878500 -- [-919.494] (-922.178) (-923.005) (-920.525) * (-920.353) [-920.631] (-924.223) (-920.919) -- 0:00:07
879000 -- (-922.024) [-923.675] (-922.286) (-920.904) * (-922.759) (-925.260) (-921.034) [-919.877] -- 0:00:07
879500 -- (-921.679) (-923.604) [-921.907] (-922.352) * (-921.269) [-924.701] (-922.758) (-922.718) -- 0:00:07
880000 -- (-920.791) (-922.331) [-923.856] (-921.529) * [-922.542] (-922.160) (-923.206) (-922.947) -- 0:00:07
Average standard deviation of split frequencies: 0.008886
880500 -- (-922.098) (-923.241) [-921.347] (-920.407) * (-921.427) (-921.152) (-921.282) [-921.939] -- 0:00:07
881000 -- (-922.613) (-923.152) [-921.321] (-924.006) * [-921.814] (-923.139) (-921.312) (-919.742) -- 0:00:07
881500 -- (-929.129) (-922.865) [-921.684] (-927.029) * (-923.089) (-924.102) (-921.421) [-922.463] -- 0:00:07
882000 -- [-925.525] (-921.387) (-923.094) (-922.520) * (-919.704) [-921.538] (-923.502) (-919.638) -- 0:00:07
882500 -- (-920.948) [-920.830] (-920.309) (-920.359) * (-923.009) (-922.824) [-920.427] (-920.586) -- 0:00:07
883000 -- (-919.764) (-919.646) (-921.734) [-920.197] * [-920.705] (-919.430) (-922.562) (-920.535) -- 0:00:07
883500 -- [-920.303] (-919.607) (-922.793) (-920.427) * [-922.511] (-920.649) (-922.498) (-919.811) -- 0:00:07
884000 -- (-920.030) (-920.859) [-921.392] (-923.788) * (-922.462) (-921.223) [-922.432] (-920.024) -- 0:00:07
884500 -- (-920.337) (-922.687) [-921.644] (-925.101) * (-924.411) (-920.704) (-921.415) [-919.459] -- 0:00:07
885000 -- (-920.304) (-921.213) (-919.596) [-926.023] * (-924.662) (-920.901) [-924.746] (-921.987) -- 0:00:07
Average standard deviation of split frequencies: 0.008868
885500 -- (-920.567) (-921.739) [-919.593] (-920.635) * (-924.026) (-921.781) (-924.915) [-920.916] -- 0:00:06
886000 -- (-919.383) (-922.926) [-922.131] (-920.470) * (-922.818) (-921.913) (-922.516) [-920.923] -- 0:00:06
886500 -- [-923.524] (-927.406) (-921.004) (-922.858) * [-924.669] (-920.360) (-920.944) (-921.611) -- 0:00:06
887000 -- (-922.481) (-929.889) [-927.461] (-922.126) * (-923.607) [-921.462] (-920.999) (-922.669) -- 0:00:06
887500 -- (-920.027) (-935.341) (-924.174) [-923.453] * (-922.717) (-924.874) (-921.756) [-919.746] -- 0:00:06
888000 -- (-921.088) (-933.568) [-923.455] (-925.486) * (-923.247) [-919.890] (-922.417) (-923.024) -- 0:00:06
888500 -- (-922.291) [-925.557] (-923.201) (-925.395) * (-923.014) [-921.852] (-922.758) (-924.466) -- 0:00:06
889000 -- (-920.257) [-921.193] (-924.399) (-920.622) * [-925.176] (-924.517) (-921.671) (-925.801) -- 0:00:06
889500 -- (-921.359) [-919.626] (-921.757) (-924.708) * (-924.558) (-920.745) [-919.880] (-920.993) -- 0:00:06
890000 -- (-920.661) (-919.450) (-920.623) [-922.424] * [-921.500] (-922.437) (-921.231) (-921.350) -- 0:00:06
Average standard deviation of split frequencies: 0.008398
890500 -- (-923.130) [-919.397] (-920.237) (-921.356) * [-923.537] (-920.102) (-922.949) (-924.468) -- 0:00:06
891000 -- [-923.800] (-921.341) (-921.646) (-921.575) * (-923.571) (-923.837) (-922.922) [-920.629] -- 0:00:06
891500 -- [-923.205] (-922.572) (-919.848) (-919.776) * (-922.207) [-920.734] (-923.945) (-920.889) -- 0:00:06
892000 -- (-921.851) (-920.470) [-922.215] (-925.800) * (-926.320) [-919.444] (-921.199) (-921.544) -- 0:00:06
892500 -- (-920.896) [-921.331] (-923.055) (-921.307) * (-921.110) [-921.038] (-922.659) (-924.045) -- 0:00:06
893000 -- [-921.439] (-920.305) (-922.725) (-922.045) * (-922.303) [-919.680] (-922.668) (-920.422) -- 0:00:06
893500 -- [-919.891] (-924.233) (-925.068) (-922.097) * (-921.872) (-919.703) [-924.010] (-920.997) -- 0:00:06
894000 -- (-920.406) [-919.815] (-920.242) (-928.567) * (-921.717) [-919.265] (-923.023) (-923.900) -- 0:00:06
894500 -- (-920.517) [-921.426] (-921.322) (-921.780) * [-920.205] (-920.967) (-922.841) (-921.234) -- 0:00:06
895000 -- (-922.830) (-921.042) [-919.934] (-921.648) * [-922.197] (-922.929) (-921.720) (-924.521) -- 0:00:06
Average standard deviation of split frequencies: 0.008453
895500 -- (-921.120) (-922.297) (-922.022) [-921.601] * (-922.626) (-919.510) (-921.877) [-923.529] -- 0:00:06
896000 -- (-920.822) (-921.812) [-921.941] (-922.368) * (-923.362) (-919.492) (-920.945) [-923.145] -- 0:00:06
896500 -- [-924.025] (-923.556) (-922.055) (-922.666) * (-921.034) (-920.158) [-919.916] (-921.577) -- 0:00:06
897000 -- [-921.809] (-922.983) (-921.540) (-921.728) * (-922.414) (-920.348) (-923.758) [-921.284] -- 0:00:06
897500 -- [-922.615] (-923.811) (-920.863) (-920.760) * (-922.415) [-920.820] (-921.126) (-920.077) -- 0:00:06
898000 -- (-920.135) [-920.725] (-923.126) (-920.544) * (-919.940) (-921.246) (-925.932) [-922.091] -- 0:00:06
898500 -- (-921.773) [-921.837] (-922.625) (-923.552) * (-919.602) [-920.240] (-924.019) (-923.297) -- 0:00:06
899000 -- [-922.000] (-920.564) (-921.847) (-920.991) * (-921.631) (-920.321) (-921.444) [-919.682] -- 0:00:06
899500 -- (-922.210) [-921.901] (-921.603) (-921.992) * (-923.173) (-922.737) [-921.986] (-922.132) -- 0:00:06
900000 -- (-921.069) [-921.074] (-920.807) (-921.808) * (-919.900) (-924.686) [-920.926] (-920.431) -- 0:00:06
Average standard deviation of split frequencies: 0.008688
900500 -- [-922.203] (-920.988) (-921.347) (-921.264) * (-919.900) (-922.484) [-922.263] (-920.547) -- 0:00:06
901000 -- (-920.758) (-920.252) (-924.547) [-922.004] * [-921.047] (-923.869) (-922.975) (-921.713) -- 0:00:06
901500 -- (-921.397) (-921.478) [-922.780] (-921.705) * (-921.667) [-920.731] (-922.354) (-920.278) -- 0:00:06
902000 -- [-921.891] (-921.813) (-921.309) (-920.228) * [-919.384] (-921.014) (-923.917) (-922.110) -- 0:00:05
902500 -- (-919.604) [-921.497] (-921.450) (-921.756) * [-923.377] (-921.509) (-927.786) (-922.760) -- 0:00:05
903000 -- (-921.154) (-921.990) (-921.994) [-923.663] * [-921.724] (-921.900) (-925.080) (-920.099) -- 0:00:05
903500 -- [-920.615] (-926.721) (-923.673) (-922.270) * (-920.810) (-921.092) (-920.788) [-921.662] -- 0:00:05
904000 -- (-920.890) (-922.282) (-920.386) [-921.467] * (-919.759) [-923.011] (-923.374) (-922.576) -- 0:00:05
904500 -- (-923.118) (-921.284) [-924.523] (-923.412) * (-919.920) (-921.359) (-922.923) [-925.440] -- 0:00:05
905000 -- [-921.133] (-919.943) (-921.768) (-920.419) * (-919.983) (-921.210) [-921.529] (-922.999) -- 0:00:05
Average standard deviation of split frequencies: 0.008949
905500 -- (-920.441) (-921.126) (-920.356) [-919.696] * (-923.331) (-922.325) [-925.358] (-922.589) -- 0:00:05
906000 -- (-923.507) (-921.615) [-922.079] (-923.346) * (-920.575) (-921.544) [-923.304] (-924.872) -- 0:00:05
906500 -- [-920.947] (-927.876) (-922.755) (-920.429) * (-920.370) (-922.114) [-921.159] (-922.202) -- 0:00:05
907000 -- (-924.673) (-923.696) [-923.589] (-921.403) * [-921.833] (-921.255) (-925.491) (-924.080) -- 0:00:05
907500 -- (-920.538) [-920.093] (-924.184) (-922.227) * (-922.214) (-921.275) (-921.669) [-921.451] -- 0:00:05
908000 -- (-922.436) (-920.076) (-920.598) [-925.838] * (-919.872) (-921.711) (-920.943) [-920.122] -- 0:00:05
908500 -- [-921.919] (-922.148) (-921.745) (-923.986) * (-920.917) (-921.662) [-921.271] (-921.067) -- 0:00:05
909000 -- (-920.762) (-920.866) [-919.234] (-922.433) * (-921.482) [-921.738] (-920.796) (-920.359) -- 0:00:05
909500 -- (-922.618) (-921.257) [-919.234] (-922.252) * [-922.435] (-920.730) (-920.197) (-921.023) -- 0:00:05
910000 -- (-922.709) (-920.939) (-920.345) [-920.979] * [-924.899] (-921.134) (-921.964) (-922.647) -- 0:00:05
Average standard deviation of split frequencies: 0.008593
910500 -- (-922.090) [-920.364] (-920.351) (-921.034) * (-922.471) [-922.222] (-924.493) (-923.630) -- 0:00:05
911000 -- (-923.136) [-920.654] (-920.781) (-920.842) * (-922.680) [-919.923] (-921.834) (-922.109) -- 0:00:05
911500 -- (-924.109) [-919.810] (-919.654) (-921.608) * (-923.678) (-921.353) (-923.293) [-921.313] -- 0:00:05
912000 -- (-919.606) (-921.675) [-920.402] (-923.835) * (-922.002) (-923.230) [-922.033] (-920.755) -- 0:00:05
912500 -- (-919.442) [-921.206] (-922.865) (-923.140) * [-921.963] (-921.868) (-928.148) (-922.943) -- 0:00:05
913000 -- (-919.743) [-919.943] (-921.675) (-920.661) * (-919.981) (-923.611) [-924.626] (-923.620) -- 0:00:05
913500 -- (-924.103) (-920.112) [-921.637] (-922.292) * (-919.763) [-922.076] (-924.395) (-926.200) -- 0:00:05
914000 -- (-920.919) (-920.348) [-923.950] (-920.501) * (-920.981) (-919.855) (-924.191) [-920.607] -- 0:00:05
914500 -- (-920.899) [-920.612] (-925.848) (-922.487) * (-920.752) (-921.546) (-920.111) [-922.504] -- 0:00:05
915000 -- (-923.681) (-921.991) [-920.564] (-925.267) * (-924.019) (-921.383) (-920.445) [-924.170] -- 0:00:05
Average standard deviation of split frequencies: 0.008646
915500 -- (-920.787) [-920.779] (-921.797) (-926.443) * (-922.005) (-920.287) [-921.330] (-924.302) -- 0:00:05
916000 -- (-921.033) [-924.149] (-923.220) (-921.385) * [-921.390] (-921.527) (-924.033) (-925.507) -- 0:00:05
916500 -- [-921.212] (-920.503) (-920.657) (-921.655) * (-923.262) (-920.549) (-922.798) [-921.133] -- 0:00:05
917000 -- (-919.588) (-924.280) (-922.731) [-921.317] * (-925.943) (-922.390) [-921.487] (-921.952) -- 0:00:05
917500 -- (-922.893) (-922.344) [-922.358] (-922.270) * (-921.612) [-923.180] (-921.339) (-921.165) -- 0:00:05
918000 -- (-920.086) (-924.359) (-922.472) [-920.792] * (-922.005) (-923.546) (-923.396) [-920.516] -- 0:00:05
918500 -- (-919.857) [-920.864] (-921.494) (-923.612) * (-921.954) [-923.609] (-924.604) (-921.611) -- 0:00:04
919000 -- (-921.058) [-922.448] (-921.724) (-919.980) * [-920.479] (-932.000) (-922.926) (-922.799) -- 0:00:04
919500 -- (-919.985) (-922.611) [-921.460] (-920.290) * (-922.220) (-924.143) (-922.180) [-923.134] -- 0:00:04
920000 -- (-920.263) (-921.773) [-921.192] (-920.627) * (-921.444) (-924.605) (-922.710) [-921.881] -- 0:00:04
Average standard deviation of split frequencies: 0.008909
920500 -- (-919.408) [-919.480] (-920.110) (-921.480) * [-922.431] (-923.202) (-923.163) (-921.712) -- 0:00:04
921000 -- (-920.706) (-920.011) (-919.987) [-920.345] * (-921.342) (-923.306) (-928.086) [-924.075] -- 0:00:04
921500 -- (-923.483) (-921.386) (-922.011) [-919.967] * [-921.113] (-923.936) (-922.473) (-922.226) -- 0:00:04
922000 -- [-927.700] (-920.855) (-920.369) (-922.702) * [-920.333] (-926.811) (-924.578) (-919.674) -- 0:00:04
922500 -- (-923.721) (-920.528) (-923.364) [-922.117] * (-920.235) [-920.527] (-921.559) (-922.786) -- 0:00:04
923000 -- (-922.568) (-921.722) [-921.969] (-926.829) * (-920.111) [-922.564] (-921.086) (-924.362) -- 0:00:04
923500 -- (-922.460) (-919.670) (-920.597) [-924.502] * (-920.838) (-923.941) [-921.900] (-920.680) -- 0:00:04
924000 -- (-921.863) (-920.733) (-921.343) [-926.509] * (-921.012) (-921.431) [-925.374] (-924.347) -- 0:00:04
924500 -- [-923.883] (-921.499) (-927.235) (-923.109) * [-921.262] (-922.985) (-923.444) (-925.350) -- 0:00:04
925000 -- (-926.652) (-920.844) [-921.450] (-920.421) * [-923.664] (-919.445) (-923.694) (-923.845) -- 0:00:04
Average standard deviation of split frequencies: 0.008722
925500 -- (-921.603) [-923.436] (-920.739) (-919.457) * (-921.534) [-919.266] (-921.634) (-921.670) -- 0:00:04
926000 -- (-921.095) (-922.205) [-921.133] (-923.092) * (-922.841) (-921.941) [-919.687] (-925.162) -- 0:00:04
926500 -- [-922.323] (-923.295) (-919.872) (-923.475) * (-919.750) [-925.315] (-922.556) (-921.662) -- 0:00:04
927000 -- (-923.785) (-920.943) (-920.413) [-923.028] * [-921.121] (-920.634) (-922.656) (-922.394) -- 0:00:04
927500 -- (-922.335) [-920.285] (-921.511) (-922.542) * (-921.121) (-920.873) [-920.313] (-924.435) -- 0:00:04
928000 -- (-921.265) (-922.666) [-920.665] (-920.672) * (-921.677) [-923.815] (-920.125) (-925.251) -- 0:00:04
928500 -- (-921.923) [-920.963] (-923.323) (-920.127) * [-921.615] (-924.086) (-919.883) (-920.987) -- 0:00:04
929000 -- [-923.075] (-922.561) (-920.338) (-920.466) * (-924.895) (-922.432) (-924.006) [-923.348] -- 0:00:04
929500 -- (-921.610) [-923.489] (-923.569) (-922.735) * (-922.893) (-923.712) [-923.942] (-924.880) -- 0:00:04
930000 -- (-920.946) (-921.036) [-919.784] (-920.549) * (-920.131) (-919.927) [-922.802] (-923.685) -- 0:00:04
Average standard deviation of split frequencies: 0.009016
930500 -- [-920.039] (-922.593) (-921.570) (-925.088) * (-922.678) (-922.769) [-919.673] (-920.510) -- 0:00:04
931000 -- (-921.965) (-922.918) [-920.751] (-922.339) * [-922.215] (-921.271) (-921.662) (-922.053) -- 0:00:04
931500 -- (-919.448) (-923.002) [-920.017] (-920.126) * (-926.280) (-921.274) [-922.588] (-922.809) -- 0:00:04
932000 -- (-920.858) [-922.344] (-920.670) (-920.242) * [-920.835] (-921.266) (-920.626) (-920.604) -- 0:00:04
932500 -- (-920.410) (-922.004) (-921.283) [-921.364] * (-923.208) (-922.348) (-924.649) [-927.881] -- 0:00:04
933000 -- (-921.115) [-925.762] (-921.860) (-920.188) * (-923.428) [-921.048] (-924.409) (-927.889) -- 0:00:04
933500 -- (-922.385) [-923.370] (-921.279) (-925.885) * (-921.465) [-922.255] (-923.464) (-934.929) -- 0:00:04
934000 -- (-925.113) (-924.576) (-922.839) [-920.275] * (-921.134) [-922.422] (-923.695) (-923.246) -- 0:00:04
934500 -- (-923.324) [-921.017] (-921.953) (-921.457) * (-923.452) (-923.935) [-921.946] (-922.986) -- 0:00:03
935000 -- (-922.851) (-922.330) (-922.274) [-919.980] * (-919.958) (-921.361) [-921.588] (-927.007) -- 0:00:03
Average standard deviation of split frequencies: 0.008931
935500 -- (-923.363) (-923.043) [-921.193] (-922.769) * [-921.355] (-923.353) (-922.657) (-921.306) -- 0:00:03
936000 -- (-921.448) [-923.199] (-925.200) (-920.829) * [-922.452] (-920.810) (-921.292) (-921.312) -- 0:00:03
936500 -- (-920.294) (-922.165) (-921.938) [-920.742] * (-921.244) (-920.286) [-920.265] (-920.752) -- 0:00:03
937000 -- (-923.395) (-924.153) [-922.624] (-924.508) * (-921.284) (-922.005) [-919.990] (-922.258) -- 0:00:03
937500 -- (-922.498) (-919.739) (-922.649) [-921.102] * (-920.818) [-922.569] (-923.162) (-920.496) -- 0:00:03
938000 -- (-925.284) (-921.568) [-922.349] (-920.688) * (-922.016) [-920.654] (-919.616) (-919.969) -- 0:00:03
938500 -- (-927.564) (-923.393) [-922.404] (-922.485) * (-923.181) (-921.146) [-922.042] (-920.153) -- 0:00:03
939000 -- (-921.409) [-922.466] (-920.306) (-919.867) * (-924.871) (-923.853) [-922.492] (-922.516) -- 0:00:03
939500 -- [-921.733] (-920.184) (-924.196) (-919.493) * (-926.968) (-921.528) [-922.449] (-920.020) -- 0:00:03
940000 -- (-922.345) [-920.926] (-922.199) (-920.697) * (-920.982) (-922.803) (-922.874) [-921.095] -- 0:00:03
Average standard deviation of split frequencies: 0.009154
940500 -- (-921.457) (-920.611) [-921.641] (-920.461) * (-924.308) (-922.412) [-927.988] (-929.611) -- 0:00:03
941000 -- [-920.028] (-923.121) (-924.182) (-921.979) * (-921.282) (-920.362) (-923.459) [-920.373] -- 0:00:03
941500 -- [-921.159] (-920.215) (-920.852) (-922.232) * [-920.432] (-919.787) (-919.673) (-920.420) -- 0:00:03
942000 -- (-921.653) (-920.734) (-921.277) [-922.270] * [-926.792] (-919.784) (-921.264) (-923.848) -- 0:00:03
942500 -- (-920.103) (-922.640) [-922.222] (-921.743) * [-925.901] (-920.284) (-923.306) (-927.706) -- 0:00:03
943000 -- (-920.185) [-921.147] (-923.446) (-921.375) * (-925.263) (-922.278) (-920.455) [-924.486] -- 0:00:03
943500 -- [-921.227] (-923.109) (-922.235) (-920.297) * (-922.174) (-922.044) [-919.958] (-920.103) -- 0:00:03
944000 -- (-923.086) [-922.200] (-919.444) (-919.283) * (-921.400) (-922.344) [-919.518] (-922.664) -- 0:00:03
944500 -- (-923.101) (-921.898) (-921.702) [-919.520] * (-929.345) [-921.700] (-919.954) (-921.502) -- 0:00:03
945000 -- (-921.056) (-921.340) (-922.303) [-921.041] * (-924.014) (-922.726) (-921.859) [-922.454] -- 0:00:03
Average standard deviation of split frequencies: 0.009103
945500 -- (-920.633) [-921.605] (-922.138) (-921.054) * (-923.820) [-924.011] (-919.251) (-921.281) -- 0:00:03
946000 -- (-920.647) (-920.595) [-920.419] (-921.033) * (-921.261) (-921.386) [-919.556] (-920.835) -- 0:00:03
946500 -- [-921.390] (-920.848) (-924.094) (-925.116) * (-923.574) (-921.846) [-921.152] (-919.493) -- 0:00:03
947000 -- (-923.951) (-923.778) (-922.019) [-921.041] * (-922.355) (-920.104) [-921.519] (-920.268) -- 0:00:03
947500 -- [-921.980] (-921.661) (-920.349) (-925.145) * (-921.975) [-920.245] (-921.042) (-919.783) -- 0:00:03
948000 -- (-921.210) (-921.301) (-921.669) [-921.283] * (-920.723) [-920.154] (-920.524) (-920.201) -- 0:00:03
948500 -- [-922.856] (-920.258) (-923.010) (-923.068) * [-919.359] (-920.465) (-919.708) (-920.045) -- 0:00:03
949000 -- (-922.047) (-920.361) [-923.576] (-920.647) * (-922.645) (-922.687) [-919.443] (-922.952) -- 0:00:03
949500 -- (-921.694) [-921.222] (-920.104) (-921.586) * (-919.837) (-923.557) (-920.411) [-922.288] -- 0:00:03
950000 -- (-921.270) (-921.672) (-920.513) [-924.187] * (-920.363) [-919.828] (-921.436) (-921.496) -- 0:00:03
Average standard deviation of split frequencies: 0.009124
950500 -- [-921.835] (-920.747) (-920.692) (-929.296) * [-921.431] (-923.865) (-922.410) (-922.926) -- 0:00:03
951000 -- (-920.145) [-921.030] (-921.695) (-921.530) * (-925.030) (-923.157) (-923.415) [-921.423] -- 0:00:02
951500 -- (-922.413) (-924.128) (-922.441) [-923.145] * (-928.192) (-928.787) (-923.954) [-921.593] -- 0:00:02
952000 -- [-924.366] (-922.468) (-925.012) (-920.267) * (-920.645) (-928.248) [-921.718] (-924.923) -- 0:00:02
952500 -- [-924.827] (-921.131) (-921.408) (-921.839) * (-921.268) (-922.570) (-920.276) [-920.618] -- 0:00:02
953000 -- (-924.363) (-920.097) [-923.994] (-922.431) * (-920.447) (-921.769) [-920.020] (-925.389) -- 0:00:02
953500 -- (-925.115) (-919.803) (-921.258) [-920.985] * (-921.445) [-922.345] (-920.018) (-921.844) -- 0:00:02
954000 -- (-923.717) (-924.896) (-922.554) [-920.408] * (-923.124) [-920.514] (-921.998) (-923.214) -- 0:00:02
954500 -- [-924.302] (-925.672) (-925.086) (-920.730) * (-922.231) [-921.867] (-921.302) (-921.690) -- 0:00:02
955000 -- (-923.241) (-920.671) [-922.455] (-920.536) * (-921.579) (-921.520) [-922.846] (-921.118) -- 0:00:02
Average standard deviation of split frequencies: 0.008711
955500 -- (-921.020) (-920.524) (-921.051) [-919.837] * (-923.442) (-920.484) [-923.281] (-919.806) -- 0:00:02
956000 -- [-920.480] (-921.159) (-920.897) (-921.237) * [-920.560] (-924.551) (-921.461) (-919.513) -- 0:00:02
956500 -- [-920.522] (-922.594) (-919.464) (-925.157) * (-922.196) (-920.983) (-922.236) [-920.900] -- 0:00:02
957000 -- [-919.764] (-919.270) (-920.186) (-921.227) * [-920.205] (-922.688) (-919.843) (-920.687) -- 0:00:02
957500 -- (-920.582) (-920.321) [-920.116] (-921.459) * (-922.490) (-920.768) (-921.006) [-920.788] -- 0:00:02
958000 -- [-920.273] (-926.261) (-922.149) (-924.667) * (-921.754) (-919.734) [-921.026] (-920.437) -- 0:00:02
958500 -- (-921.807) [-921.919] (-921.917) (-923.443) * (-922.108) (-921.762) [-925.927] (-922.389) -- 0:00:02
959000 -- (-922.692) [-920.671] (-920.607) (-925.604) * (-920.139) (-924.187) (-921.898) [-921.291] -- 0:00:02
959500 -- (-923.670) (-922.816) (-922.206) [-921.450] * (-922.274) (-925.379) (-922.679) [-920.509] -- 0:00:02
960000 -- [-923.102] (-922.112) (-921.627) (-926.306) * [-922.819] (-920.715) (-925.001) (-921.314) -- 0:00:02
Average standard deviation of split frequencies: 0.008931
960500 -- (-926.580) (-920.552) [-921.344] (-921.989) * (-924.057) [-920.779] (-923.679) (-921.189) -- 0:00:02
961000 -- (-926.268) (-919.685) [-921.018] (-925.096) * (-921.394) (-923.404) [-924.675] (-920.082) -- 0:00:02
961500 -- (-924.452) (-919.787) (-923.845) [-920.968] * [-920.521] (-921.139) (-921.922) (-919.992) -- 0:00:02
962000 -- (-921.280) [-923.352] (-920.903) (-921.043) * (-920.525) (-920.651) [-920.902] (-922.810) -- 0:00:02
962500 -- (-919.683) (-921.535) [-921.086] (-922.207) * (-923.528) (-920.544) [-920.823] (-923.181) -- 0:00:02
963000 -- (-926.292) (-920.151) [-925.303] (-922.162) * [-922.422] (-923.933) (-921.119) (-921.044) -- 0:00:02
963500 -- (-921.791) [-919.776] (-920.657) (-921.375) * (-920.409) (-925.054) [-921.652] (-921.043) -- 0:00:02
964000 -- (-921.620) (-922.028) [-922.681] (-922.908) * (-920.363) (-925.571) (-924.183) [-923.143] -- 0:00:02
964500 -- (-922.399) (-922.462) (-923.127) [-923.972] * (-921.125) (-922.330) (-923.770) [-923.266] -- 0:00:02
965000 -- (-922.869) (-921.354) (-926.328) [-919.645] * (-920.632) (-920.895) (-923.809) [-922.564] -- 0:00:02
Average standard deviation of split frequencies: 0.008882
965500 -- (-926.054) [-921.784] (-923.068) (-919.734) * [-920.594] (-923.438) (-921.138) (-928.588) -- 0:00:02
966000 -- (-920.762) (-921.571) [-921.469] (-921.018) * [-920.513] (-926.038) (-919.762) (-923.676) -- 0:00:02
966500 -- (-923.371) (-921.237) [-925.449] (-922.146) * [-919.579] (-926.871) (-922.021) (-921.300) -- 0:00:02
967000 -- (-920.559) [-919.503] (-925.107) (-920.363) * (-921.343) (-922.433) (-921.242) [-920.387] -- 0:00:02
967500 -- (-919.962) [-920.403] (-922.397) (-921.039) * [-922.664] (-923.686) (-924.081) (-919.477) -- 0:00:01
968000 -- (-920.308) (-923.785) (-921.598) [-920.239] * (-924.467) [-920.238] (-922.882) (-921.218) -- 0:00:01
968500 -- (-921.651) [-920.673] (-922.904) (-922.427) * (-921.257) (-922.121) [-921.521] (-919.764) -- 0:00:01
969000 -- (-923.402) (-923.694) (-921.917) [-919.901] * (-921.807) (-926.590) (-921.305) [-920.129] -- 0:00:01
969500 -- (-925.290) [-921.722] (-921.237) (-920.404) * (-921.393) (-923.891) (-921.889) [-921.991] -- 0:00:01
970000 -- (-919.583) (-921.455) [-920.240] (-921.294) * [-921.245] (-921.087) (-921.581) (-921.449) -- 0:00:01
Average standard deviation of split frequencies: 0.009130
970500 -- (-920.817) [-921.260] (-921.839) (-922.536) * [-921.550] (-920.048) (-922.012) (-923.831) -- 0:00:01
971000 -- [-919.341] (-923.572) (-920.032) (-920.407) * (-921.395) (-919.919) [-922.631] (-921.170) -- 0:00:01
971500 -- (-919.627) (-923.964) (-920.545) [-922.443] * [-920.054] (-920.385) (-921.245) (-923.132) -- 0:00:01
972000 -- [-921.646] (-921.354) (-922.774) (-922.650) * (-924.510) (-921.487) [-921.524] (-922.210) -- 0:00:01
972500 -- (-923.692) (-922.733) (-923.375) [-921.895] * (-920.299) [-920.546] (-920.614) (-921.999) -- 0:00:01
973000 -- [-923.177] (-920.528) (-920.646) (-920.953) * (-920.552) [-920.718] (-920.360) (-921.243) -- 0:00:01
973500 -- [-921.300] (-921.566) (-923.660) (-920.631) * (-931.962) [-921.494] (-923.228) (-921.106) -- 0:00:01
974000 -- (-920.570) [-922.430] (-928.614) (-921.494) * (-923.022) (-924.981) (-922.850) [-922.463] -- 0:00:01
974500 -- (-924.286) (-924.144) (-921.478) [-922.340] * (-922.273) (-926.736) (-920.470) [-921.064] -- 0:00:01
975000 -- (-923.105) (-921.535) [-920.044] (-921.065) * [-921.306] (-924.858) (-920.419) (-922.453) -- 0:00:01
Average standard deviation of split frequencies: 0.009080
975500 -- [-921.970] (-924.426) (-919.802) (-921.961) * (-926.171) (-923.283) [-921.109] (-922.274) -- 0:00:01
976000 -- (-920.827) (-920.664) (-922.031) [-924.335] * [-920.374] (-924.151) (-924.658) (-921.402) -- 0:00:01
976500 -- (-924.156) (-923.772) [-923.839] (-920.250) * (-923.807) (-920.347) (-921.680) [-922.864] -- 0:00:01
977000 -- (-922.356) [-922.542] (-921.468) (-919.765) * (-926.003) [-920.532] (-920.659) (-920.894) -- 0:00:01
977500 -- [-923.683] (-921.246) (-919.611) (-920.591) * (-921.826) [-921.978] (-924.564) (-921.082) -- 0:00:01
978000 -- [-920.610] (-923.272) (-920.680) (-922.232) * (-920.263) (-924.711) [-921.241] (-920.737) -- 0:00:01
978500 -- [-920.568] (-924.245) (-928.996) (-921.230) * [-920.553] (-919.778) (-920.864) (-919.569) -- 0:00:01
979000 -- (-924.093) [-920.426] (-923.773) (-920.731) * (-922.580) (-922.165) (-925.475) [-919.680] -- 0:00:01
979500 -- (-920.728) [-920.625] (-921.835) (-928.881) * (-926.578) (-921.486) (-920.636) [-922.210] -- 0:00:01
980000 -- (-919.600) [-921.427] (-920.525) (-924.230) * (-924.018) (-922.151) (-920.102) [-921.523] -- 0:00:01
Average standard deviation of split frequencies: 0.009422
980500 -- (-921.155) (-923.409) [-921.204] (-923.266) * (-922.121) [-923.264] (-924.218) (-920.392) -- 0:00:01
981000 -- (-923.245) (-921.441) (-922.180) [-923.954] * (-920.331) (-922.704) (-923.768) [-921.029] -- 0:00:01
981500 -- [-920.714] (-921.960) (-921.469) (-921.942) * [-921.268] (-920.691) (-924.087) (-922.216) -- 0:00:01
982000 -- (-922.418) [-921.755] (-919.699) (-925.992) * (-920.967) (-922.661) (-928.070) [-925.065] -- 0:00:01
982500 -- (-920.561) (-924.079) (-919.512) [-920.293] * (-920.577) (-923.800) [-924.651] (-921.684) -- 0:00:01
983000 -- (-924.235) (-922.839) (-919.844) [-921.669] * (-920.728) (-925.452) [-924.410] (-920.844) -- 0:00:01
983500 -- (-921.424) [-921.589] (-920.271) (-922.551) * (-921.584) [-923.389] (-921.828) (-923.009) -- 0:00:01
984000 -- (-920.513) [-922.865] (-919.368) (-921.423) * (-920.685) [-920.228] (-923.431) (-920.868) -- 0:00:00
984500 -- (-921.398) (-923.779) (-919.220) [-921.189] * [-921.592] (-921.475) (-923.292) (-920.262) -- 0:00:00
985000 -- (-921.837) [-928.995] (-922.926) (-920.586) * (-920.372) [-922.371] (-921.757) (-924.691) -- 0:00:00
Average standard deviation of split frequencies: 0.009658
985500 -- [-921.019] (-924.660) (-920.653) (-920.413) * (-922.079) [-923.642] (-927.295) (-927.692) -- 0:00:00
986000 -- (-921.656) (-924.833) [-920.251] (-921.570) * (-921.321) (-921.539) [-927.089] (-921.034) -- 0:00:00
986500 -- (-920.842) (-923.118) [-926.270] (-919.628) * (-920.753) [-923.374] (-919.506) (-921.268) -- 0:00:00
987000 -- (-924.337) (-921.076) [-919.910] (-921.436) * (-921.703) (-922.492) (-920.047) [-922.424] -- 0:00:00
987500 -- (-921.707) (-922.714) (-920.369) [-924.298] * (-919.531) (-923.149) [-919.978] (-923.847) -- 0:00:00
988000 -- (-922.429) (-922.632) (-923.629) [-921.038] * (-921.719) (-922.049) [-919.456] (-921.547) -- 0:00:00
988500 -- (-919.655) [-920.300] (-927.015) (-920.758) * (-926.388) (-919.865) [-919.771] (-920.464) -- 0:00:00
989000 -- (-920.947) [-920.007] (-921.781) (-920.499) * (-922.609) (-922.929) [-920.820] (-926.696) -- 0:00:00
989500 -- (-925.176) [-920.599] (-920.971) (-920.408) * (-920.086) (-926.185) (-920.723) [-920.550] -- 0:00:00
990000 -- (-920.861) [-920.832] (-926.579) (-926.540) * [-920.563] (-921.082) (-921.656) (-923.949) -- 0:00:00
Average standard deviation of split frequencies: 0.009517
990500 -- (-922.503) [-921.448] (-921.120) (-923.618) * (-920.841) (-921.168) [-923.650] (-920.958) -- 0:00:00
991000 -- [-920.691] (-920.564) (-919.747) (-920.020) * (-920.758) (-920.328) (-923.099) [-919.309] -- 0:00:00
991500 -- (-922.690) (-919.729) [-919.815] (-921.290) * (-922.447) [-919.742] (-920.810) (-919.589) -- 0:00:00
992000 -- (-920.945) (-923.798) (-921.582) [-922.074] * (-920.251) (-923.619) (-921.362) [-920.424] -- 0:00:00
992500 -- (-922.267) (-920.990) (-925.469) [-921.328] * (-921.851) [-921.982] (-920.391) (-920.163) -- 0:00:00
993000 -- (-923.794) (-921.127) [-920.721] (-920.555) * (-924.083) [-922.593] (-920.804) (-921.694) -- 0:00:00
993500 -- [-919.715] (-919.926) (-919.986) (-921.705) * (-924.715) [-922.624] (-920.322) (-921.283) -- 0:00:00
994000 -- (-923.162) [-921.497] (-924.564) (-922.690) * (-922.278) (-923.116) (-922.782) [-921.925] -- 0:00:00
994500 -- (-921.097) (-920.776) [-921.367] (-921.660) * (-921.628) (-925.525) (-927.669) [-921.107] -- 0:00:00
995000 -- (-920.883) [-920.979] (-922.879) (-922.403) * (-923.342) (-922.940) [-922.436] (-921.630) -- 0:00:00
Average standard deviation of split frequencies: 0.009466
995500 -- (-920.928) (-921.655) [-922.226] (-921.236) * (-924.941) (-921.200) (-924.426) [-921.112] -- 0:00:00
996000 -- (-921.986) [-920.173] (-923.023) (-925.582) * [-922.261] (-921.520) (-922.728) (-921.154) -- 0:00:00
996500 -- [-928.651] (-920.612) (-922.315) (-925.279) * (-920.519) [-921.920] (-920.253) (-921.027) -- 0:00:00
997000 -- [-922.239] (-921.772) (-921.822) (-923.668) * [-920.688] (-920.692) (-921.851) (-920.999) -- 0:00:00
997500 -- (-920.404) (-925.095) (-920.081) [-925.583] * [-921.621] (-920.873) (-925.133) (-921.695) -- 0:00:00
998000 -- (-921.929) (-922.241) (-920.501) [-921.369] * [-920.237] (-921.671) (-923.768) (-921.758) -- 0:00:00
998500 -- (-923.978) (-921.439) [-919.621] (-921.085) * (-921.077) (-923.223) [-922.698] (-920.458) -- 0:00:00
999000 -- (-926.089) (-920.036) (-921.370) [-920.778] * (-920.985) (-922.042) (-926.874) [-921.963] -- 0:00:00
999500 -- [-921.633] (-923.816) (-920.480) (-920.725) * (-925.983) (-921.102) [-921.388] (-920.547) -- 0:00:00
1000000 -- (-922.190) (-921.973) [-920.662] (-924.056) * (-925.863) [-920.339] (-923.537) (-920.593) -- 0:00:00
Average standard deviation of split frequencies: 0.009328
Analysis completed in 1 mins 1 seconds
Analysis used 59.43 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -919.17
Likelihood of best state for "cold" chain of run 2 was -919.17
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.6 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.0 % ( 26 %) Dirichlet(Pi{all})
29.5 % ( 31 %) Slider(Pi{all})
78.0 % ( 53 %) Multiplier(Alpha{1,2})
78.2 % ( 66 %) Multiplier(Alpha{3})
21.8 % ( 23 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 18 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 69 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.0 % ( 27 %) Dirichlet(Pi{all})
29.5 % ( 33 %) Slider(Pi{all})
78.6 % ( 54 %) Multiplier(Alpha{1,2})
77.9 % ( 58 %) Multiplier(Alpha{3})
21.5 % ( 30 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 19 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.6 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166382 0.82 0.67
3 | 166304 167163 0.84
4 | 167098 166206 166847
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167056 0.82 0.67
3 | 166139 166462 0.84
4 | 166530 167005 166808
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -920.97
| 1 1 2 |
| 2 1 2 2 2 |
| 1 1 1 2 2 1 1 2 2|
| 1 2 1 1 1 1 2 2 2 |
|2 1 22 21 2 2 1 1 2 |
| 2 11 1 11 2 1 1 1 1 121 1|
| 22 2 2 2 2 21 1 * 12 21 2 1 |
|1 11 2 2 2 1 2 2 |
| 2 2 2 1 2 1 2 1 1 |
| 1 2 2 1 2 2 1 2 2 1 2 2 |
| 2 1 1 1 2 2 2 1 1 1 12 1 |
| 2 |
| 2 1 1 1 2 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -922.53
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -920.90 -924.93
2 -920.89 -923.99
--------------------------------------
TOTAL -920.89 -924.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894771 0.088898 0.361350 1.471543 0.860063 1501.00 1501.00 1.000
r(A<->C){all} 0.176307 0.022031 0.000052 0.480513 0.139062 214.32 241.92 1.001
r(A<->G){all} 0.155149 0.017759 0.000139 0.420763 0.117156 194.57 279.31 1.000
r(A<->T){all} 0.167377 0.020931 0.000010 0.459369 0.128008 165.91 245.43 1.003
r(C<->G){all} 0.157962 0.019130 0.000062 0.442071 0.116358 219.58 225.42 1.001
r(C<->T){all} 0.167236 0.019564 0.000022 0.453303 0.132070 148.38 167.41 1.004
r(G<->T){all} 0.175970 0.023102 0.000056 0.489803 0.130335 188.58 197.94 1.000
pi(A){all} 0.154462 0.000185 0.128601 0.181132 0.154464 1243.31 1301.84 1.000
pi(C){all} 0.350868 0.000339 0.317021 0.388595 0.350766 1158.57 1189.86 1.000
pi(G){all} 0.325424 0.000306 0.291762 0.360163 0.325176 1131.64 1169.94 1.000
pi(T){all} 0.169246 0.000197 0.141500 0.195829 0.168893 1417.72 1426.50 1.000
alpha{1,2} 0.409849 0.226189 0.000122 1.364214 0.248427 1099.83 1196.27 1.000
alpha{3} 0.462440 0.268430 0.000154 1.468652 0.290598 1123.76 1136.58 1.000
pinvar{all} 0.997735 0.000007 0.992527 1.000000 0.998599 1199.23 1216.83 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- .*..*.
9 -- ...*.*
10 -- .*.***
11 -- ..*.*.
12 -- ....**
13 -- .**...
14 -- ..****
15 -- ..*..*
16 -- .****.
17 -- .*...*
18 -- ..**..
19 -- ...**.
20 -- .*.*..
21 -- .***.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 458 0.152565 0.011306 0.144570 0.160560 2
8 447 0.148901 0.019315 0.135243 0.162558 2
9 446 0.148568 0.013191 0.139241 0.157895 2
10 438 0.145903 0.019786 0.131912 0.159893 2
11 437 0.145570 0.006124 0.141239 0.149900 2
12 436 0.145237 0.005653 0.141239 0.149234 2
13 434 0.144570 0.013191 0.135243 0.153897 2
14 433 0.144237 0.006124 0.139907 0.148568 2
15 429 0.142905 0.001413 0.141905 0.143904 2
16 427 0.142239 0.008009 0.136576 0.147901 2
17 426 0.141905 0.000942 0.141239 0.142572 2
18 415 0.138241 0.007066 0.133245 0.143238 2
19 414 0.137908 0.011306 0.129913 0.145903 2
20 413 0.137575 0.003298 0.135243 0.139907 2
21 412 0.137242 0.013191 0.127915 0.146569 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096865 0.009171 0.000016 0.288473 0.067786 1.000 2
length{all}[2] 0.102891 0.010817 0.000019 0.294939 0.073952 1.000 2
length{all}[3] 0.100530 0.009635 0.000044 0.293910 0.070293 1.000 2
length{all}[4] 0.098765 0.009788 0.000017 0.297082 0.066319 1.000 2
length{all}[5] 0.097115 0.009291 0.000026 0.288032 0.067208 1.000 2
length{all}[6] 0.102152 0.011121 0.000227 0.300367 0.070942 1.000 2
length{all}[7] 0.096132 0.008239 0.000051 0.279317 0.072328 1.004 2
length{all}[8] 0.090310 0.009227 0.000010 0.294948 0.060390 1.016 2
length{all}[9] 0.104343 0.009751 0.000031 0.307289 0.075654 0.998 2
length{all}[10] 0.098608 0.010573 0.000230 0.304446 0.066717 0.998 2
length{all}[11] 0.103293 0.008442 0.000061 0.283791 0.080914 0.998 2
length{all}[12] 0.099330 0.010671 0.000206 0.304012 0.064362 0.998 2
length{all}[13] 0.095257 0.008660 0.000032 0.252173 0.067314 0.998 2
length{all}[14] 0.095558 0.008367 0.000007 0.267098 0.069022 0.999 2
length{all}[15] 0.099199 0.012232 0.000079 0.305786 0.065980 0.999 2
length{all}[16] 0.099071 0.010342 0.000025 0.298210 0.066379 0.998 2
length{all}[17] 0.102891 0.011163 0.000158 0.335033 0.063872 0.999 2
length{all}[18] 0.097546 0.010873 0.000414 0.289302 0.070315 0.998 2
length{all}[19] 0.101434 0.009125 0.000071 0.296992 0.078087 1.000 2
length{all}[20] 0.093996 0.008177 0.000197 0.277054 0.064593 0.998 2
length{all}[21] 0.090588 0.010209 0.000773 0.275019 0.063023 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009328
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.016
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 47 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 696
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 232 / 232 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 232 / 232 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039889 0.107695 0.082780 0.079557 0.050546 0.076805 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -988.325692
Iterating by ming2
Initial: fx= 988.325692
x= 0.03989 0.10769 0.08278 0.07956 0.05055 0.07680 0.30000 1.30000
1 h-m-p 0.0000 0.0002 551.8523 +++ 934.562427 m 0.0002 14 | 1/8
2 h-m-p 0.0010 0.0051 64.2446 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 507.3312 ++ 922.431408 m 0.0000 45 | 2/8
4 h-m-p 0.0005 0.0078 44.1445 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 454.0956 ++ 898.309556 m 0.0001 76 | 3/8
6 h-m-p 0.0015 0.0118 31.1248 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 395.1806 ++ 896.398309 m 0.0000 107 | 4/8
8 h-m-p 0.0002 0.0201 20.4322 ----------.. | 4/8
9 h-m-p 0.0000 0.0000 322.4927 ++ 894.906569 m 0.0000 137 | 5/8
10 h-m-p 0.0002 0.0287 14.0575 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 227.5859 ++ 889.119801 m 0.0001 167 | 6/8
12 h-m-p 0.5712 8.0000 0.0000 ++ 889.119801 m 8.0000 178 | 6/8
13 h-m-p 0.3531 8.0000 0.0002 +++ 889.119801 m 8.0000 192 | 6/8
14 h-m-p 0.0014 0.5317 0.8757 ------C 889.119801 0 0.0000 211 | 6/8
15 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 889.119801 m 8.0000 251 | 6/8
17 h-m-p 0.0013 0.6598 0.7204 +++++ 889.119791 m 0.6598 267 | 7/8
18 h-m-p 1.3126 8.0000 0.2806 ++ 889.119781 m 8.0000 280 | 7/8
19 h-m-p 1.6000 8.0000 0.7003 ++ 889.119776 m 8.0000 292 | 7/8
20 h-m-p 1.6000 8.0000 1.3338 ++ 889.119773 m 8.0000 304 | 7/8
21 h-m-p 1.6000 8.0000 5.4490 ++ 889.119772 m 8.0000 315 | 7/8
22 h-m-p 1.6000 8.0000 18.6659 ++ 889.119772 m 8.0000 326 | 7/8
23 h-m-p 1.6000 8.0000 56.6560 ++ 889.119771 m 8.0000 337 | 7/8
24 h-m-p 1.6000 8.0000 51.5505 ------Y 889.119771 0 0.0001 354 | 7/8
25 h-m-p 0.2000 8.0000 0.0190 C 889.119771 0 0.0500 365 | 7/8
26 h-m-p 1.6000 8.0000 0.0001 -C 889.119771 0 0.1000 378 | 7/8
27 h-m-p 0.0667 8.0000 0.0001 --Y 889.119771 0 0.0010 392
Out..
lnL = -889.119771
393 lfun, 393 eigenQcodon, 2358 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052231 0.086307 0.073152 0.073302 0.096108 0.018322 0.000100 0.887222 0.366952
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.088455
np = 9
lnL0 = -978.637440
Iterating by ming2
Initial: fx= 978.637440
x= 0.05223 0.08631 0.07315 0.07330 0.09611 0.01832 0.00011 0.88722 0.36695
1 h-m-p 0.0000 0.0000 538.5590 ++ 978.039456 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 454.5017 +++ 954.272796 m 0.0002 27 | 2/9
3 h-m-p 0.0001 0.0004 281.4986 ++ 919.400272 m 0.0004 39 | 3/9
4 h-m-p 0.0001 0.0004 468.4336 ++ 893.508691 m 0.0004 51 | 4/9
5 h-m-p 0.0000 0.0000 345.2521 ++ 893.478867 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 1084.0642 ++ 892.583249 m 0.0001 75 | 6/9
7 h-m-p 0.0001 0.0008 96.0508 ++ 890.126314 m 0.0008 87 | 7/9
8 h-m-p 0.0013 0.0064 8.2537 -----------.. | 7/9
9 h-m-p 0.0000 0.0000 229.8690 ++ 889.119853 m 0.0000 120 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 ++ 889.119853 m 8.0000 132 | 7/9
11 h-m-p 0.0160 8.0000 0.0004 +++++ 889.119852 m 8.0000 148 | 7/9
12 h-m-p 0.0178 7.4213 0.1834 +++++ 889.119800 m 7.4213 165 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 N 889.119800 0 1.6000 179 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 Y 889.119800 0 0.0160 192
Out..
lnL = -889.119800
193 lfun, 579 eigenQcodon, 2316 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027617 0.073173 0.020193 0.051081 0.099300 0.105655 0.000100 0.963195 0.464097 0.339624 730.783593
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.077634
np = 11
lnL0 = -928.086017
Iterating by ming2
Initial: fx= 928.086017
x= 0.02762 0.07317 0.02019 0.05108 0.09930 0.10566 0.00011 0.96320 0.46410 0.33962 730.78359
1 h-m-p 0.0000 0.0000 100.0030 ++ 928.053945 m 0.0000 16 | 1/11
2 h-m-p 0.0001 0.0462 27.1208 +++++ 901.223287 m 0.0462 33 | 2/11
3 h-m-p 0.0000 0.0000 7267.8878 ++ 898.847725 m 0.0000 47 | 3/11
4 h-m-p 0.0004 0.0042 217.9633 ++ 890.525335 m 0.0042 61 | 4/11
5 h-m-p 0.0000 0.0000 32951.0991 ++ 890.381554 m 0.0000 75 | 5/11
6 h-m-p 0.0000 0.0000 47106.7989 ++ 889.972065 m 0.0000 89 | 6/11
7 h-m-p 0.0000 0.0000 1593.2340 ++ 889.119771 m 0.0000 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0000 --C 889.119771 0 0.0250 119
Out..
lnL = -889.119771
120 lfun, 480 eigenQcodon, 2160 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -889.115056 S = -889.114442 -0.000234
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:02
did 20 / 49 patterns 0:02
did 30 / 49 patterns 0:02
did 40 / 49 patterns 0:02
did 49 / 49 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052053 0.066089 0.109039 0.014727 0.107189 0.062905 0.000100 0.418009 1.632950
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.371744
np = 9
lnL0 = -979.560971
Iterating by ming2
Initial: fx= 979.560971
x= 0.05205 0.06609 0.10904 0.01473 0.10719 0.06291 0.00011 0.41801 1.63295
1 h-m-p 0.0000 0.0000 517.6118 ++ 979.232907 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0270 23.6344 ---------.. | 1/9
3 h-m-p 0.0000 0.0001 517.7574 ++ 961.298626 m 0.0001 45 | 2/9
4 h-m-p 0.0015 0.0338 21.2006 -----------.. | 2/9
5 h-m-p 0.0000 0.0002 477.7467 +++ 920.881257 m 0.0002 79 | 3/9
6 h-m-p 0.0054 0.0448 13.7469 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 443.8662 ++ 911.036028 m 0.0000 113 | 4/9
8 h-m-p 0.0029 0.1001 6.6297 ------------.. | 4/9
9 h-m-p 0.0000 0.0000 387.0482 ++ 908.856693 m 0.0000 147 | 5/9
10 h-m-p 0.0008 0.0951 5.4227 -----------.. | 5/9
11 h-m-p 0.0000 0.0002 314.3684 +++ 889.572089 m 0.0002 181 | 6/9
12 h-m-p 0.0177 0.2426 2.4134 -------------.. | 6/9
13 h-m-p 0.0000 0.0000 229.8821 ++ 889.119835 m 0.0000 216 | 7/9
14 h-m-p 0.0584 8.0000 0.0000 Y 889.119835 0 0.0584 228 | 7/9
15 h-m-p 0.0525 8.0000 0.0000 N 889.119835 0 0.0525 242 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 ----Y 889.119835 0 0.0000 260
Out..
lnL = -889.119835
261 lfun, 2871 eigenQcodon, 15660 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032710 0.094160 0.030597 0.016114 0.082934 0.065733 0.000100 0.900000 0.562943 1.102327 666.352059
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.162614
np = 11
lnL0 = -911.919726
Iterating by ming2
Initial: fx= 911.919726
x= 0.03271 0.09416 0.03060 0.01611 0.08293 0.06573 0.00011 0.90000 0.56294 1.10233 666.35206
1 h-m-p 0.0000 0.0000 182.5105 ++ 911.691977 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 889.9785 ++ 902.221967 m 0.0001 30 | 2/11
3 h-m-p 0.0001 0.0005 103.4540 +YYYCCCC 896.368821 6 0.0004 54 | 2/11
4 h-m-p 0.0112 0.0560 2.6480 ++ 895.722237 m 0.0560 68 | 3/11
5 h-m-p 0.0031 0.0156 15.4706 ++ 893.578293 m 0.0156 82 | 4/11
6 h-m-p 0.0000 0.0000 3178.6753 ++ 893.396478 m 0.0000 96 | 5/11
7 h-m-p 0.0003 0.0016 36.6877 ++ 892.959149 m 0.0016 110 | 6/11
8 h-m-p 0.0013 0.0086 46.0129 ++ 890.709945 m 0.0086 124 | 7/11
9 h-m-p 1.5983 8.0000 0.2000 ----------------.. | 7/11
10 h-m-p 0.0000 0.0002 455.6695 CYCCCCC 890.415249 6 0.0000 181 | 7/11
11 h-m-p 0.0000 0.0003 47.8578 ++ 889.119773 m 0.0003 195 | 8/11
12 h-m-p 1.6000 8.0000 0.0000 ++ 889.119773 m 8.0000 209
Out..
lnL = -889.119773
210 lfun, 2520 eigenQcodon, 13860 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -889.125250 S = -889.115858 -0.004119
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:10
did 20 / 49 patterns 0:10
did 30 / 49 patterns 0:10
did 40 / 49 patterns 0:10
did 49 / 49 patterns 0:10
Time used: 0:11
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232
NC_011896_1_WP_010908087_1_1065_MLBR_RS05015 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
NC_002677_1_NP_301763_1_635_ML1030 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID
**************************************************
NC_011896_1_WP_010908087_1_1065_MLBR_RS05015 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
NC_002677_1_NP_301763_1_635_ML1030 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610 GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG
**************************************************
NC_011896_1_WP_010908087_1_1065_MLBR_RS05015 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
NC_002677_1_NP_301763_1_635_ML1030 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610 APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW
**************************************************
NC_011896_1_WP_010908087_1_1065_MLBR_RS05015 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
NC_002677_1_NP_301763_1_635_ML1030 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610 PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA
**************************************************
NC_011896_1_WP_010908087_1_1065_MLBR_RS05015 APHAALQTVTLNQIGTNAAALGTACLAALALT
NC_002677_1_NP_301763_1_635_ML1030 APHAALQTVTLNQIGTNAAALGTACLAALALT
NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770 APHAALQTVTLNQIGTNAAALGTACLAALALT
NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225 APHAALQTVTLNQIGTNAAALGTACLAALALT
NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505 APHAALQTVTLNQIGTNAAALGTACLAALALT
NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610 APHAALQTVTLNQIGTNAAALGTACLAALALT
********************************
>NC_011896_1_WP_010908087_1_1065_MLBR_RS05015 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC >NC_002677_1_NP_301763_1_635_ML1030 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC >NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC >NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC >NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC >NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610 GTGGCTGTCGATTTACGCAATGTGACAACCGTGTTGCTGCCTGGAACCGG ATCCGATGACGACTACGTTTATCGGGCATTTTCGGGCCCCCTGCACCGAG TGGGCGCAGCTGTGCTGACGCCGCCACCCCAGCCGAATCGGCTGATCGAC GGCTATCTGTCCGCCTTGGACGACGCAGCACGCGCAGGTCCGATCGGCGT CGGCGGTGTCTCGATCGGTGCCGCGGTGGCCGCCGCGTGGGCACTCGCTC ATCCCGAGCGCGCCGTGGCCGTCCTAGCCGCGCTGCCAGCCTGGAACGGG GCACCAGAATCAGCGCCCGCCGCTCTAGCGGCACGGTATTCGGCATCGCA TCTACGTCGCGACGGCCTGGCGGCGACTACGCTACAGATGCAGGCATCAA GCCCACCTTGGTTGGCCGACGAACTGGCCCGCTCGTGGTGCGGCCAGTGG CCACTGCTGCCCGACGCGATGGAGGAAGCGGCGGCATACATCGCACCGAG CTGCGCCGAGCTAGCCCGGTTAGCCACGCCACTGGGGGTGGCCGCCGCGG TCGATGATCCGATCCACCCTCTGCAGGTCGGCGTCGATTGGGTGACCGCC GCGCCACACGCCGCATTGCAGACGGTGACACTCAACCAGATAGGCACGAA CGCCGCCGCGCTGGGTACTGCCTGCCTGGCTGCTCTCGCTCTCACC
>NC_011896_1_WP_010908087_1_1065_MLBR_RS05015 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA APHAALQTVTLNQIGTNAAALGTACLAALALT >NC_002677_1_NP_301763_1_635_ML1030 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA APHAALQTVTLNQIGTNAAALGTACLAALALT >NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA APHAALQTVTLNQIGTNAAALGTACLAALALT >NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA APHAALQTVTLNQIGTNAAALGTACLAALALT >NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA APHAALQTVTLNQIGTNAAALGTACLAALALT >NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610 VAVDLRNVTTVLLPGTGSDDDYVYRAFSGPLHRVGAAVLTPPPQPNRLID GYLSALDDAARAGPIGVGGVSIGAAVAAAWALAHPERAVAVLAALPAWNG APESAPAALAARYSASHLRRDGLAATTLQMQASSPPWLADELARSWCGQW PLLPDAMEEAAAYIAPSCAELARLATPLGVAAAVDDPIHPLQVGVDWVTA APHAALQTVTLNQIGTNAAALGTACLAALALT
#NEXUS
[ID: 0222716257]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908087_1_1065_MLBR_RS05015
NC_002677_1_NP_301763_1_635_ML1030
NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770
NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225
NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505
NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908087_1_1065_MLBR_RS05015,
2 NC_002677_1_NP_301763_1_635_ML1030,
3 NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770,
4 NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225,
5 NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505,
6 NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06778622,2:0.07395184,3:0.07029291,4:0.06631865,5:0.06720764,6:0.07094245);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06778622,2:0.07395184,3:0.07029291,4:0.06631865,5:0.06720764,6:0.07094245);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -920.90 -924.93
2 -920.89 -923.99
--------------------------------------
TOTAL -920.89 -924.57
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1030/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894771 0.088898 0.361350 1.471543 0.860063 1501.00 1501.00 1.000
r(A<->C){all} 0.176307 0.022031 0.000052 0.480513 0.139062 214.32 241.92 1.001
r(A<->G){all} 0.155149 0.017759 0.000139 0.420763 0.117156 194.57 279.31 1.000
r(A<->T){all} 0.167377 0.020931 0.000010 0.459369 0.128008 165.91 245.43 1.003
r(C<->G){all} 0.157962 0.019130 0.000062 0.442071 0.116358 219.58 225.42 1.001
r(C<->T){all} 0.167236 0.019564 0.000022 0.453303 0.132070 148.38 167.41 1.004
r(G<->T){all} 0.175970 0.023102 0.000056 0.489803 0.130335 188.58 197.94 1.000
pi(A){all} 0.154462 0.000185 0.128601 0.181132 0.154464 1243.31 1301.84 1.000
pi(C){all} 0.350868 0.000339 0.317021 0.388595 0.350766 1158.57 1189.86 1.000
pi(G){all} 0.325424 0.000306 0.291762 0.360163 0.325176 1131.64 1169.94 1.000
pi(T){all} 0.169246 0.000197 0.141500 0.195829 0.168893 1417.72 1426.50 1.000
alpha{1,2} 0.409849 0.226189 0.000122 1.364214 0.248427 1099.83 1196.27 1.000
alpha{3} 0.462440 0.268430 0.000154 1.468652 0.290598 1123.76 1136.58 1.000
pinvar{all} 0.997735 0.000007 0.992527 1.000000 0.998599 1199.23 1216.83 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML1030/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 232
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 3 3 3 3 3 3
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 3 3 3 3 3 3 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 4 4 4 4 4 4 | CCC 5 5 5 5 5 5 | CAC 3 3 3 3 3 3 | CGC 5 5 5 5 5 5
CTA 5 5 5 5 5 5 | CCA 7 7 7 7 7 7 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 14 14 14 14 14 14 | CCG 5 5 5 5 5 5 | CAG 7 7 7 7 7 7 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 2 2 2 2 2 2 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 5 5 5 5 5 5 | ACC 4 4 4 4 4 4 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 5 5 5 5 5 5 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 7 7 7 7 7 7 | Asp GAT 5 5 5 5 5 5 | Gly GGT 4 4 4 4 4 4
GTC 7 7 7 7 7 7 | GCC 21 21 21 21 21 21 | GAC 8 8 8 8 8 8 | GGC 9 9 9 9 9 9
GTA 0 0 0 0 0 0 | GCA 13 13 13 13 13 13 | Glu GAA 3 3 3 3 3 3 | GGA 2 2 2 2 2 2
GTG 10 10 10 10 10 10 | GCG 13 13 13 13 13 13 | GAG 3 3 3 3 3 3 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908087_1_1065_MLBR_RS05015
position 1: T:0.12931 C:0.28448 A:0.12069 G:0.46552
position 2: T:0.24138 C:0.41379 A:0.17672 G:0.16810
position 3: T:0.13362 C:0.35776 A:0.16379 G:0.34483
Average T:0.16810 C:0.35201 A:0.15374 G:0.32615
#2: NC_002677_1_NP_301763_1_635_ML1030
position 1: T:0.12931 C:0.28448 A:0.12069 G:0.46552
position 2: T:0.24138 C:0.41379 A:0.17672 G:0.16810
position 3: T:0.13362 C:0.35776 A:0.16379 G:0.34483
Average T:0.16810 C:0.35201 A:0.15374 G:0.32615
#3: NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770
position 1: T:0.12931 C:0.28448 A:0.12069 G:0.46552
position 2: T:0.24138 C:0.41379 A:0.17672 G:0.16810
position 3: T:0.13362 C:0.35776 A:0.16379 G:0.34483
Average T:0.16810 C:0.35201 A:0.15374 G:0.32615
#4: NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225
position 1: T:0.12931 C:0.28448 A:0.12069 G:0.46552
position 2: T:0.24138 C:0.41379 A:0.17672 G:0.16810
position 3: T:0.13362 C:0.35776 A:0.16379 G:0.34483
Average T:0.16810 C:0.35201 A:0.15374 G:0.32615
#5: NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505
position 1: T:0.12931 C:0.28448 A:0.12069 G:0.46552
position 2: T:0.24138 C:0.41379 A:0.17672 G:0.16810
position 3: T:0.13362 C:0.35776 A:0.16379 G:0.34483
Average T:0.16810 C:0.35201 A:0.15374 G:0.32615
#6: NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610
position 1: T:0.12931 C:0.28448 A:0.12069 G:0.46552
position 2: T:0.24138 C:0.41379 A:0.17672 G:0.16810
position 3: T:0.13362 C:0.35776 A:0.16379 G:0.34483
Average T:0.16810 C:0.35201 A:0.15374 G:0.32615
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 0
TTC 0 | TCC 12 | TAC 12 | TGC 18
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 30 | TAG 0 | Trp W TGG 36
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 18 | His H CAT 12 | Arg R CGT 6
CTC 24 | CCC 30 | CAC 18 | CGC 30
CTA 30 | CCA 42 | Gln Q CAA 0 | CGA 6
CTG 84 | CCG 30 | CAG 42 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 12 | Asn N AAT 12 | Ser S AGT 0
ATC 30 | ACC 24 | AAC 18 | AGC 12
ATA 6 | ACA 12 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 12 | ACG 30 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 42 | Asp D GAT 30 | Gly G GGT 24
GTC 42 | GCC 126 | GAC 48 | GGC 54
GTA 0 | GCA 78 | Glu E GAA 18 | GGA 12
GTG 60 | GCG 78 | GAG 18 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12931 C:0.28448 A:0.12069 G:0.46552
position 2: T:0.24138 C:0.41379 A:0.17672 G:0.16810
position 3: T:0.13362 C:0.35776 A:0.16379 G:0.34483
Average T:0.16810 C:0.35201 A:0.15374 G:0.32615
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -889.119771 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 666.352059
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908087_1_1065_MLBR_RS05015: 0.000004, NC_002677_1_NP_301763_1_635_ML1030: 0.000004, NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770: 0.000004, NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225: 0.000004, NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505: 0.000004, NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 666.35206
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 474.0 222.0 666.3521 0.0000 0.0000 0.0 0.0
7..2 0.000 474.0 222.0 666.3521 0.0000 0.0000 0.0 0.0
7..3 0.000 474.0 222.0 666.3521 0.0000 0.0000 0.0 0.0
7..4 0.000 474.0 222.0 666.3521 0.0000 0.0000 0.0 0.0
7..5 0.000 474.0 222.0 666.3521 0.0000 0.0000 0.0 0.0
7..6 0.000 474.0 222.0 666.3521 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -889.119800 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.019778 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908087_1_1065_MLBR_RS05015: 0.000004, NC_002677_1_NP_301763_1_635_ML1030: 0.000004, NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770: 0.000004, NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225: 0.000004, NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505: 0.000004, NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.01978 0.98022
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 474.0 222.0 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 474.0 222.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 474.0 222.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 474.0 222.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 474.0 222.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 474.0 222.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -889.119771 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.788658 0.182704 0.275509 730.783741
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908087_1_1065_MLBR_RS05015: 0.000004, NC_002677_1_NP_301763_1_635_ML1030: 0.000004, NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770: 0.000004, NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225: 0.000004, NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505: 0.000004, NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.78866 0.18270 0.02864
w: 0.27551 1.00000 730.78374
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 474.0 222.0 21.3280 0.0000 0.0000 0.0 0.0
7..2 0.000 474.0 222.0 21.3280 0.0000 0.0000 0.0 0.0
7..3 0.000 474.0 222.0 21.3280 0.0000 0.0000 0.0 0.0
7..4 0.000 474.0 222.0 21.3280 0.0000 0.0000 0.0 0.0
7..5 0.000 474.0 222.0 21.3280 0.0000 0.0000 0.0 0.0
7..6 0.000 474.0 222.0 21.3280 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908087_1_1065_MLBR_RS05015)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908087_1_1065_MLBR_RS05015)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -889.119835 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.417861 1.632794
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908087_1_1065_MLBR_RS05015: 0.000004, NC_002677_1_NP_301763_1_635_ML1030: 0.000004, NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770: 0.000004, NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225: 0.000004, NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505: 0.000004, NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.41786 q = 1.63279
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00042 0.00587 0.02007 0.04541 0.08435 0.13994 0.21656 0.32152 0.46963 0.70695
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 474.0 222.0 0.2011 0.0000 0.0000 0.0 0.0
7..2 0.000 474.0 222.0 0.2011 0.0000 0.0000 0.0 0.0
7..3 0.000 474.0 222.0 0.2011 0.0000 0.0000 0.0 0.0
7..4 0.000 474.0 222.0 0.2011 0.0000 0.0000 0.0 0.0
7..5 0.000 474.0 222.0 0.2011 0.0000 0.0000 0.0 0.0
7..6 0.000 474.0 222.0 0.2011 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -889.119773 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.997917 0.005000 1.768459 666.355430
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908087_1_1065_MLBR_RS05015: 0.000004, NC_002677_1_NP_301763_1_635_ML1030: 0.000004, NZ_LVXE01000017_1_WP_010908087_1_659_A3216_RS06770: 0.000004, NZ_LYPH01000015_1_WP_010908087_1_473_A8144_RS02225: 0.000004, NZ_CP029543_1_WP_010908087_1_1086_DIJ64_RS05505: 0.000004, NZ_AP014567_1_WP_010908087_1_1107_JK2ML_RS05610: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99792 p = 0.00500 q = 1.76846
(p1 = 0.00208) w = 666.35543
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09979 0.09979 0.09979 0.09979 0.09979 0.09979 0.09979 0.09979 0.09979 0.09979 0.00208
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 666.35543
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 474.0 222.0 1.3878 0.0000 0.0000 0.0 0.0
7..2 0.000 474.0 222.0 1.3878 0.0000 0.0000 0.0 0.0
7..3 0.000 474.0 222.0 1.3878 0.0000 0.0000 0.0 0.0
7..4 0.000 474.0 222.0 1.3878 0.0000 0.0000 0.0 0.0
7..5 0.000 474.0 222.0 1.3878 0.0000 0.0000 0.0 0.0
7..6 0.000 474.0 222.0 1.3878 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908087_1_1065_MLBR_RS05015)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908087_1_1065_MLBR_RS05015)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:11
Model 1: NearlyNeutral -889.1198 Model 2: PositiveSelection -889.119771 Model 0: one-ratio -889.119771 Model 7: beta -889.119835 Model 8: beta&w>1 -889.119773 Model 0 vs 1 5.800000008093775E-5 Model 2 vs 1 5.800000008093775E-5 Model 8 vs 7 1.2399999991430377E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
