--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 17:21:40 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML1025/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -874.97 -877.90
2 -874.99 -879.05
--------------------------------------
TOTAL -874.98 -878.63
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902251 0.091180 0.376751 1.481713 0.861733 1346.84 1410.72 1.000
r(A<->C){all} 0.174863 0.021537 0.000050 0.479800 0.138258 182.79 213.59 1.000
r(A<->G){all} 0.158048 0.018790 0.000027 0.433233 0.120056 209.99 235.19 1.000
r(A<->T){all} 0.159581 0.019231 0.000138 0.450537 0.122823 127.02 178.38 1.000
r(C<->G){all} 0.165703 0.018573 0.000182 0.446652 0.132625 268.30 337.22 1.007
r(C<->T){all} 0.170210 0.022190 0.000036 0.482860 0.128421 217.85 245.00 1.001
r(G<->T){all} 0.171595 0.021171 0.000205 0.462596 0.128302 325.49 336.28 1.004
pi(A){all} 0.207163 0.000250 0.176535 0.238078 0.206887 1297.78 1313.79 1.001
pi(C){all} 0.345323 0.000334 0.310034 0.380737 0.345576 1135.70 1188.94 1.000
pi(G){all} 0.282442 0.000306 0.248927 0.316367 0.282315 1307.72 1338.24 1.000
pi(T){all} 0.165072 0.000212 0.138887 0.195177 0.164793 1089.49 1131.24 1.000
alpha{1,2} 0.411553 0.225264 0.000193 1.367900 0.238199 1281.86 1332.01 1.000
alpha{3} 0.465092 0.245424 0.000719 1.441203 0.304913 1012.55 1179.06 1.000
pinvar{all} 0.997655 0.000008 0.992342 0.999999 0.998596 1414.45 1416.35 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -845.352836
Model 2: PositiveSelection -845.352831
Model 0: one-ratio -845.352838
Model 7: beta -845.352832
Model 8: beta&w>1 -845.352834
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 9.999999974752427E-6
Model 8 vs 7 3.999999989900971E-6
>C1
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C2
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C3
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C4
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C5
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C6
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=216
C1 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C2 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C3 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C4 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C5 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C6 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
**************************************************
C1 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C2 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C3 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C4 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C5 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C6 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
**************************************************
C1 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C2 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C3 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C4 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C5 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C6 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
**************************************************
C1 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C2 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C3 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C4 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C5 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C6 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
**************************************************
C1 EPSDPALLQKIHANSC
C2 EPSDPALLQKIHANSC
C3 EPSDPALLQKIHANSC
C4 EPSDPALLQKIHANSC
C5 EPSDPALLQKIHANSC
C6 EPSDPALLQKIHANSC
****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 216 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 216 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6480]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6480]--->[6480]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.479 Mb, Max= 30.757 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C2 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C3 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C4 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C5 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C6 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
**************************************************
C1 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C2 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C3 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C4 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C5 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C6 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
**************************************************
C1 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C2 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C3 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C4 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C5 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C6 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
**************************************************
C1 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C2 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C3 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C4 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C5 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C6 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
**************************************************
C1 EPSDPALLQKIHANSC
C2 EPSDPALLQKIHANSC
C3 EPSDPALLQKIHANSC
C4 EPSDPALLQKIHANSC
C5 EPSDPALLQKIHANSC
C6 EPSDPALLQKIHANSC
****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C2 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C3 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C4 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C5 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C6 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
**************************************************
C1 CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C2 CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C3 CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C4 CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C5 CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C6 CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
**************************************************
C1 TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C2 TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C3 TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C4 TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C5 TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C6 TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
**************************************************
C1 GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C2 GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C3 GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C4 GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C5 GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C6 GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
**************************************************
C1 GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C2 GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C3 GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C4 GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C5 GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C6 GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
**************************************************
C1 CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C2 CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C3 CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C4 CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C5 CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C6 CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
**************************************************
C1 CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C2 CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C3 CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C4 CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C5 CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C6 CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
**************************************************
C1 CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C2 CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C3 CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C4 CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C5 CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C6 CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
**************************************************
C1 ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C2 ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C3 ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C4 ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C5 ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C6 ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
**************************************************
C1 GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C2 GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C3 GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C4 GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C5 GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C6 GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
**************************************************
C1 CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C2 CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C3 CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C4 CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C5 CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C6 CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
**************************************************
C1 ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C2 ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C3 ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C4 ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C5 ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C6 ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
**************************************************
C1 GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C2 GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C3 GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C4 GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C5 GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C6 GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
************************************************
>C1
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C2
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C3
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C4
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C5
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C6
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C1
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C2
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C3
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C4
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C5
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C6
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 648 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579800026
Setting output file names to "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1207664176
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0163529363
Seed = 1411897286
Swapseed = 1579800026
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1450.255071 -- -24.965149
Chain 2 -- -1450.255071 -- -24.965149
Chain 3 -- -1450.254849 -- -24.965149
Chain 4 -- -1450.255071 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1450.255071 -- -24.965149
Chain 2 -- -1450.254988 -- -24.965149
Chain 3 -- -1450.255071 -- -24.965149
Chain 4 -- -1450.255071 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1450.255] (-1450.255) (-1450.255) (-1450.255) * [-1450.255] (-1450.255) (-1450.255) (-1450.255)
500 -- (-899.492) [-891.221] (-901.764) (-889.732) * (-883.835) [-895.949] (-898.006) (-891.281) -- 0:00:00
1000 -- (-890.891) (-892.841) (-899.626) [-880.530] * (-885.085) (-887.246) [-881.894] (-891.739) -- 0:00:00
1500 -- (-889.947) (-885.125) (-885.339) [-880.565] * (-886.725) (-884.407) [-886.289] (-882.057) -- 0:00:00
2000 -- (-878.114) (-883.263) (-879.856) [-886.721] * (-884.572) (-881.719) (-890.240) [-881.379] -- 0:00:00
2500 -- (-891.084) (-882.040) [-882.985] (-881.187) * (-890.602) (-880.159) (-883.066) [-880.035] -- 0:00:00
3000 -- [-881.890] (-885.852) (-883.920) (-881.506) * (-882.875) (-886.970) (-885.821) [-886.832] -- 0:00:00
3500 -- (-876.046) (-881.043) [-887.681] (-892.912) * (-894.175) [-882.898] (-887.714) (-889.377) -- 0:00:00
4000 -- [-882.305] (-880.845) (-886.529) (-887.623) * (-892.465) (-884.263) [-877.792] (-884.360) -- 0:00:00
4500 -- (-882.945) (-893.396) (-888.957) [-887.574] * (-881.273) (-882.127) (-892.352) [-879.217] -- 0:00:00
5000 -- (-886.504) (-888.801) (-883.195) [-881.662] * (-884.768) (-880.492) [-880.263] (-890.505) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- [-883.125] (-884.002) (-883.322) (-891.997) * [-885.188] (-887.959) (-893.589) (-890.037) -- 0:00:00
6000 -- (-889.863) (-884.201) (-884.755) [-881.931] * (-886.299) (-889.776) [-882.417] (-881.227) -- 0:00:00
6500 -- [-883.635] (-885.560) (-884.185) (-884.810) * [-880.106] (-884.768) (-892.982) (-884.735) -- 0:00:00
7000 -- (-887.930) (-888.388) (-878.825) [-880.680] * [-880.462] (-887.881) (-882.221) (-883.847) -- 0:00:00
7500 -- (-889.001) (-891.419) (-884.976) [-880.473] * [-882.263] (-892.461) (-886.052) (-888.794) -- 0:02:12
8000 -- (-885.270) (-894.621) [-884.739] (-889.180) * [-879.231] (-884.608) (-885.126) (-879.233) -- 0:02:04
8500 -- [-889.440] (-891.187) (-882.065) (-882.006) * (-890.338) [-880.828] (-887.976) (-878.151) -- 0:01:56
9000 -- (-889.411) (-893.075) [-884.687] (-890.345) * (-887.892) (-880.844) (-884.547) [-873.963] -- 0:01:50
9500 -- (-886.467) [-884.828] (-883.054) (-881.034) * (-893.568) (-882.317) (-884.247) [-876.057] -- 0:01:44
10000 -- (-885.356) (-876.231) [-888.540] (-886.917) * (-882.929) (-884.661) [-881.978] (-875.623) -- 0:01:39
Average standard deviation of split frequencies: 0.070711
10500 -- [-882.865] (-879.734) (-886.897) (-890.503) * [-883.698] (-888.924) (-888.486) (-875.479) -- 0:01:34
11000 -- (-887.570) (-882.104) (-883.970) [-889.200] * [-882.615] (-886.327) (-888.892) (-879.076) -- 0:01:29
11500 -- [-881.814] (-874.577) (-902.077) (-884.914) * (-885.295) (-881.895) [-881.223] (-877.122) -- 0:01:25
12000 -- (-885.638) (-880.217) [-882.114] (-893.383) * (-890.681) (-885.636) [-877.688] (-877.179) -- 0:01:22
12500 -- (-882.567) [-876.759] (-882.834) (-887.067) * (-886.959) (-885.434) (-891.059) [-877.425] -- 0:01:19
13000 -- (-884.795) (-875.313) [-879.942] (-880.637) * [-882.390] (-884.618) (-887.319) (-878.496) -- 0:01:15
13500 -- (-880.540) (-874.798) [-876.276] (-885.426) * [-882.980] (-879.863) (-886.423) (-878.731) -- 0:01:13
14000 -- (-891.966) [-875.107] (-881.547) (-883.352) * [-881.966] (-891.550) (-881.578) (-878.182) -- 0:01:10
14500 -- (-882.219) (-880.608) [-874.809] (-889.635) * [-888.098] (-886.257) (-888.082) (-877.925) -- 0:01:07
15000 -- [-879.104] (-879.220) (-877.259) (-887.688) * (-893.791) [-884.530] (-890.528) (-876.034) -- 0:01:05
Average standard deviation of split frequencies: 0.047140
15500 -- [-876.815] (-877.141) (-878.847) (-885.927) * (-885.025) [-884.557] (-887.713) (-875.122) -- 0:01:03
16000 -- (-891.585) [-877.880] (-878.327) (-884.288) * [-888.229] (-881.002) (-879.511) (-876.351) -- 0:01:01
16500 -- [-884.840] (-875.091) (-876.949) (-883.233) * (-885.687) (-885.126) (-877.134) [-874.840] -- 0:00:59
17000 -- (-882.679) [-875.543] (-875.145) (-889.760) * [-892.508] (-886.077) (-875.658) (-875.783) -- 0:00:57
17500 -- (-890.800) (-877.353) [-875.649] (-888.091) * [-888.223] (-886.190) (-876.159) (-875.476) -- 0:00:56
18000 -- (-882.900) (-875.650) (-878.472) [-884.727] * [-881.562] (-881.487) (-874.933) (-876.939) -- 0:00:54
18500 -- (-892.382) (-875.532) (-874.783) [-884.195] * (-882.314) (-882.697) [-874.005] (-877.994) -- 0:00:53
19000 -- (-877.999) (-877.523) [-876.410] (-886.642) * (-893.340) [-882.608] (-877.215) (-873.977) -- 0:00:51
19500 -- (-875.669) [-876.949] (-874.785) (-880.930) * (-883.942) [-881.408] (-876.025) (-874.049) -- 0:00:50
20000 -- [-874.042] (-875.720) (-879.915) (-884.579) * (-887.815) [-883.001] (-874.897) (-878.370) -- 0:00:49
Average standard deviation of split frequencies: 0.049645
20500 -- [-874.020] (-875.726) (-877.809) (-883.724) * (-881.417) [-876.961] (-875.266) (-877.367) -- 0:00:47
21000 -- [-874.826] (-874.709) (-874.294) (-884.766) * (-888.039) (-881.208) [-876.049] (-874.937) -- 0:00:46
21500 -- [-874.477] (-874.866) (-878.422) (-886.844) * (-888.230) (-880.395) [-875.941] (-876.953) -- 0:00:45
22000 -- (-874.349) (-876.397) [-877.512] (-884.733) * [-882.105] (-881.872) (-873.737) (-874.584) -- 0:00:44
22500 -- (-874.097) (-875.260) [-876.033] (-889.403) * (-882.709) [-885.993] (-873.368) (-875.404) -- 0:00:43
23000 -- (-873.976) (-874.948) (-875.691) [-888.806] * (-883.369) [-880.071] (-874.205) (-874.402) -- 0:00:42
23500 -- [-874.367] (-874.877) (-876.635) (-887.162) * (-895.600) (-887.140) [-875.003] (-874.987) -- 0:00:41
24000 -- (-877.599) (-879.211) [-874.152] (-890.195) * [-888.832] (-891.533) (-878.099) (-874.812) -- 0:01:21
24500 -- (-874.301) [-874.709] (-874.403) (-885.663) * (-887.994) (-884.895) (-878.254) [-874.126] -- 0:01:19
25000 -- (-875.765) (-874.808) [-875.268] (-886.046) * (-884.940) (-894.035) (-875.715) [-880.461] -- 0:01:18
Average standard deviation of split frequencies: 0.046759
25500 -- (-877.519) [-873.972] (-875.837) (-896.842) * (-887.496) (-885.404) (-874.740) [-877.373] -- 0:01:16
26000 -- (-877.384) [-874.040] (-876.759) (-899.014) * (-886.150) (-891.131) (-875.338) [-880.223] -- 0:01:14
26500 -- (-876.117) (-875.765) (-879.008) [-875.250] * (-881.806) (-890.737) (-875.934) [-876.781] -- 0:01:13
27000 -- (-875.600) [-875.085] (-878.746) (-879.079) * [-883.755] (-888.658) (-877.832) (-876.337) -- 0:01:12
27500 -- (-876.820) (-875.077) (-876.367) [-874.025] * (-880.944) (-888.949) (-876.448) [-879.082] -- 0:01:10
28000 -- (-876.407) (-877.243) (-875.829) [-874.120] * [-881.727] (-888.953) (-876.002) (-875.377) -- 0:01:09
28500 -- (-875.450) [-877.222] (-878.263) (-876.240) * (-894.855) (-902.912) [-877.187] (-874.541) -- 0:01:08
29000 -- (-874.611) (-878.132) [-875.083] (-877.075) * (-886.243) (-883.383) [-876.444] (-875.970) -- 0:01:06
29500 -- [-875.003] (-876.430) (-877.766) (-877.746) * [-889.935] (-885.037) (-875.423) (-883.539) -- 0:01:05
30000 -- (-875.994) [-875.276] (-875.453) (-879.109) * [-888.754] (-886.845) (-873.929) (-873.995) -- 0:01:04
Average standard deviation of split frequencies: 0.041261
30500 -- (-874.395) [-875.664] (-876.636) (-877.806) * [-890.073] (-885.029) (-875.741) (-877.024) -- 0:01:03
31000 -- (-874.993) [-875.264] (-876.685) (-875.329) * [-887.252] (-886.631) (-873.990) (-876.937) -- 0:01:02
31500 -- (-877.157) [-874.942] (-876.654) (-879.499) * (-883.960) [-879.522] (-877.194) (-874.533) -- 0:01:01
32000 -- (-874.050) (-874.725) (-875.923) [-875.680] * (-887.741) [-877.556] (-876.095) (-876.201) -- 0:01:00
32500 -- (-874.686) (-874.056) [-877.597] (-875.430) * [-883.503] (-876.249) (-882.061) (-873.390) -- 0:00:59
33000 -- (-879.883) (-873.810) (-875.445) [-875.598] * (-883.092) (-876.658) [-881.399] (-873.851) -- 0:00:58
33500 -- [-876.803] (-873.862) (-874.298) (-873.759) * [-886.676] (-877.984) (-876.335) (-875.784) -- 0:00:57
34000 -- (-877.102) [-876.161] (-875.328) (-875.733) * (-887.618) (-874.635) [-875.966] (-874.331) -- 0:00:56
34500 -- (-876.178) (-879.085) (-880.735) [-876.035] * (-888.381) (-874.173) (-884.738) [-874.122] -- 0:00:55
35000 -- (-876.155) (-879.121) (-879.309) [-873.354] * (-891.357) (-875.178) [-875.820] (-877.090) -- 0:00:55
Average standard deviation of split frequencies: 0.034459
35500 -- (-873.877) [-877.348] (-876.152) (-875.006) * [-881.735] (-876.339) (-876.421) (-875.274) -- 0:00:54
36000 -- [-874.546] (-876.168) (-877.157) (-877.559) * (-890.277) [-875.150] (-873.622) (-875.209) -- 0:00:53
36500 -- [-874.387] (-877.521) (-873.716) (-875.914) * (-881.395) [-876.335] (-878.684) (-874.523) -- 0:00:52
37000 -- (-874.354) (-880.023) (-875.018) [-875.221] * (-883.610) (-875.041) (-875.115) [-875.250] -- 0:00:52
37500 -- (-875.964) (-876.324) (-876.298) [-873.585] * [-886.274] (-873.896) (-876.350) (-875.567) -- 0:00:51
38000 -- (-875.191) [-874.887] (-877.205) (-873.938) * (-878.705) [-875.641] (-882.902) (-874.765) -- 0:00:50
38500 -- (-876.788) [-875.048] (-873.426) (-874.498) * (-887.754) (-876.518) (-881.234) [-874.688] -- 0:00:49
39000 -- [-874.881] (-875.374) (-873.638) (-875.011) * (-878.333) [-876.340] (-881.461) (-877.049) -- 0:00:49
39500 -- (-876.605) [-883.983] (-874.265) (-875.036) * [-886.694] (-874.919) (-873.998) (-874.348) -- 0:01:12
40000 -- (-875.000) [-874.837] (-874.446) (-875.302) * (-893.579) (-877.095) [-877.320] (-874.681) -- 0:01:12
Average standard deviation of split frequencies: 0.031115
40500 -- (-875.039) (-874.581) [-875.595] (-873.465) * (-887.081) [-877.311] (-876.638) (-875.343) -- 0:01:11
41000 -- (-874.633) [-874.094] (-880.656) (-876.738) * [-879.852] (-875.654) (-877.408) (-875.666) -- 0:01:10
41500 -- [-877.679] (-875.164) (-881.008) (-876.030) * [-880.387] (-874.596) (-873.657) (-874.653) -- 0:01:09
42000 -- (-878.033) [-873.901] (-875.546) (-873.698) * (-882.255) [-875.408] (-875.822) (-875.513) -- 0:01:08
42500 -- (-875.095) [-875.032] (-875.207) (-874.359) * (-889.635) (-874.467) [-876.260] (-875.539) -- 0:01:07
43000 -- (-874.969) [-873.487] (-878.979) (-874.763) * (-888.150) (-875.942) [-873.846] (-874.880) -- 0:01:06
43500 -- (-874.102) (-874.001) (-879.543) [-876.414] * (-897.200) [-876.094] (-877.152) (-875.367) -- 0:01:05
44000 -- (-874.526) [-873.996] (-878.472) (-875.528) * (-879.233) (-878.489) (-876.840) [-875.937] -- 0:01:05
44500 -- (-874.559) (-873.414) (-879.998) [-875.237] * [-883.348] (-874.009) (-877.717) (-876.508) -- 0:01:04
45000 -- (-877.931) (-875.113) [-875.659] (-874.669) * [-884.997] (-875.441) (-877.743) (-876.511) -- 0:01:03
Average standard deviation of split frequencies: 0.030744
45500 -- (-876.390) (-875.114) [-874.783] (-877.125) * (-893.677) [-878.995] (-876.276) (-879.996) -- 0:01:02
46000 -- (-874.555) (-879.338) (-874.525) [-874.256] * [-884.104] (-873.793) (-876.731) (-875.225) -- 0:01:02
46500 -- (-873.952) (-876.591) [-873.840] (-873.714) * (-887.358) (-878.035) [-874.929] (-879.212) -- 0:01:01
47000 -- (-874.047) (-873.646) (-875.278) [-874.220] * [-887.962] (-876.054) (-875.913) (-876.571) -- 0:01:00
47500 -- (-876.852) (-873.612) [-876.648] (-874.062) * (-886.448) (-874.779) [-874.791] (-875.509) -- 0:01:00
48000 -- (-875.420) (-876.070) [-874.530] (-874.955) * (-892.065) (-878.293) [-876.008] (-873.724) -- 0:00:59
48500 -- (-873.718) (-875.182) [-873.822] (-877.306) * (-884.867) (-874.248) (-877.503) [-874.878] -- 0:00:58
49000 -- (-873.782) [-874.478] (-875.675) (-878.151) * (-882.899) (-876.148) [-876.853] (-875.144) -- 0:00:58
49500 -- (-875.421) (-876.702) (-874.945) [-874.469] * (-886.225) (-883.123) [-879.384] (-876.628) -- 0:00:57
50000 -- (-875.326) [-873.782] (-875.830) (-876.714) * (-885.066) [-875.010] (-878.131) (-879.459) -- 0:00:57
Average standard deviation of split frequencies: 0.026517
50500 -- (-877.566) (-874.090) (-875.651) [-874.104] * (-890.875) (-878.685) [-876.601] (-873.945) -- 0:00:56
51000 -- (-877.389) (-874.056) (-876.196) [-875.716] * (-881.324) (-879.464) (-877.216) [-873.769] -- 0:00:55
51500 -- (-877.246) (-877.511) [-875.288] (-878.687) * (-884.669) (-879.725) (-876.095) [-874.252] -- 0:00:55
52000 -- (-873.907) (-877.510) (-874.357) [-874.139] * (-886.338) (-882.178) (-875.937) [-875.045] -- 0:00:54
52500 -- (-874.271) [-875.389] (-877.352) (-879.443) * [-880.160] (-874.315) (-876.465) (-877.390) -- 0:00:54
53000 -- (-875.839) (-874.068) (-877.852) [-876.253] * [-882.783] (-874.293) (-876.178) (-878.604) -- 0:00:53
53500 -- (-876.271) (-875.896) [-874.996] (-877.231) * (-884.478) (-877.388) (-877.068) [-878.634] -- 0:00:53
54000 -- (-875.043) (-878.822) (-875.293) [-874.794] * (-893.649) (-875.340) [-879.829] (-882.127) -- 0:00:52
54500 -- (-874.978) (-878.648) (-877.152) [-874.573] * [-884.107] (-877.293) (-876.414) (-878.552) -- 0:00:52
55000 -- (-874.269) (-878.717) (-880.389) [-876.005] * (-885.453) (-877.989) (-874.630) [-874.987] -- 0:00:51
Average standard deviation of split frequencies: 0.027026
55500 -- [-874.451] (-880.942) (-874.038) (-874.239) * (-883.190) [-877.067] (-874.845) (-875.438) -- 0:00:51
56000 -- (-876.945) (-874.951) [-876.243] (-876.665) * (-887.852) (-879.356) [-876.938] (-873.660) -- 0:01:07
56500 -- [-875.395] (-881.286) (-875.417) (-875.414) * (-904.716) (-877.903) (-877.532) [-875.475] -- 0:01:06
57000 -- (-879.786) (-882.268) (-874.761) [-877.768] * (-882.673) (-875.287) (-873.914) [-874.707] -- 0:01:06
57500 -- (-877.327) [-874.574] (-874.689) (-874.732) * (-878.551) (-875.087) [-874.477] (-874.470) -- 0:01:05
58000 -- (-879.659) (-879.696) (-875.294) [-874.664] * (-877.344) (-875.578) (-877.104) [-875.728] -- 0:01:04
58500 -- (-876.700) [-879.795] (-874.596) (-874.086) * (-876.897) (-879.987) [-875.006] (-874.972) -- 0:01:04
59000 -- (-875.215) (-875.696) (-876.530) [-873.953] * (-875.433) [-876.948] (-880.768) (-875.447) -- 0:01:03
59500 -- (-873.835) (-877.623) (-877.743) [-874.302] * [-876.488] (-874.509) (-877.537) (-875.099) -- 0:01:03
60000 -- (-875.766) (-876.699) [-876.561] (-876.900) * (-877.377) [-873.738] (-874.921) (-878.471) -- 0:01:02
Average standard deviation of split frequencies: 0.026808
60500 -- [-875.046] (-879.189) (-876.062) (-874.952) * (-875.830) (-874.672) (-875.318) [-876.714] -- 0:01:02
61000 -- (-876.882) (-876.501) [-876.240] (-877.038) * [-874.608] (-876.396) (-876.027) (-879.136) -- 0:01:01
61500 -- (-876.026) (-875.995) [-875.762] (-877.484) * (-873.993) (-875.540) (-876.939) [-876.484] -- 0:01:01
62000 -- (-874.866) (-874.321) (-874.636) [-876.805] * (-875.711) [-877.681] (-875.218) (-878.892) -- 0:01:00
62500 -- (-874.365) [-874.682] (-878.100) (-877.140) * [-877.329] (-875.775) (-875.514) (-878.535) -- 0:01:00
63000 -- (-874.623) [-875.574] (-879.946) (-874.517) * (-882.863) [-874.584] (-875.016) (-877.000) -- 0:00:59
63500 -- (-874.105) (-875.930) [-880.391] (-874.457) * [-875.933] (-874.645) (-875.148) (-877.102) -- 0:00:58
64000 -- (-877.550) [-877.449] (-877.711) (-878.012) * [-877.269] (-874.455) (-875.311) (-877.336) -- 0:00:58
64500 -- (-877.495) (-877.340) (-876.681) [-878.735] * [-876.619] (-874.100) (-876.624) (-877.762) -- 0:00:58
65000 -- (-877.648) (-881.662) [-879.357] (-875.891) * (-875.307) (-876.367) [-875.907] (-876.164) -- 0:00:57
Average standard deviation of split frequencies: 0.022448
65500 -- (-874.497) (-876.423) (-882.700) [-877.314] * (-874.858) (-880.254) [-876.700] (-875.328) -- 0:00:57
66000 -- (-874.479) (-876.668) (-882.512) [-874.928] * [-874.199] (-873.906) (-874.386) (-875.734) -- 0:00:56
66500 -- (-874.197) (-875.931) (-874.827) [-878.184] * (-876.102) [-875.030] (-878.488) (-875.772) -- 0:00:56
67000 -- [-873.975] (-875.930) (-878.962) (-876.040) * (-878.519) (-876.018) [-877.335] (-875.134) -- 0:00:55
67500 -- (-875.478) (-874.535) [-875.451] (-874.986) * [-874.549] (-875.838) (-877.783) (-874.819) -- 0:00:55
68000 -- (-876.671) (-875.622) [-876.053] (-875.091) * (-878.544) (-875.072) [-874.008] (-875.136) -- 0:00:54
68500 -- (-876.576) (-876.749) [-874.477] (-875.345) * (-877.018) [-877.529] (-875.492) (-875.037) -- 0:00:54
69000 -- (-877.513) [-877.896] (-875.293) (-875.953) * (-874.795) (-877.521) [-875.429] (-875.999) -- 0:00:53
69500 -- (-875.791) (-877.809) (-876.098) [-873.885] * (-878.409) (-878.761) [-876.458] (-876.254) -- 0:00:53
70000 -- [-877.377] (-876.309) (-885.371) (-879.344) * (-877.643) [-875.761] (-875.826) (-879.929) -- 0:00:53
Average standard deviation of split frequencies: 0.021013
70500 -- (-874.223) (-879.641) (-880.263) [-875.466] * (-875.689) (-878.940) [-875.139] (-875.963) -- 0:00:52
71000 -- (-878.098) [-874.774] (-876.286) (-875.320) * (-875.172) [-875.046] (-874.065) (-876.188) -- 0:01:05
71500 -- (-878.411) (-874.216) (-874.994) [-874.577] * (-877.333) (-874.800) (-878.899) [-878.536] -- 0:01:04
72000 -- (-874.035) (-874.224) [-877.846] (-875.953) * (-875.123) [-874.267] (-876.951) (-879.051) -- 0:01:04
72500 -- (-875.371) [-874.346] (-876.943) (-875.292) * [-875.360] (-874.892) (-878.019) (-874.422) -- 0:01:03
73000 -- (-875.279) (-876.605) [-875.604] (-874.106) * (-876.419) (-877.323) (-878.209) [-874.020] -- 0:01:03
73500 -- (-875.847) (-875.339) [-878.173] (-875.393) * (-878.145) (-876.986) (-877.392) [-873.342] -- 0:01:03
74000 -- [-877.574] (-876.203) (-877.566) (-877.321) * [-875.962] (-874.039) (-880.294) (-877.221) -- 0:01:02
74500 -- (-873.751) (-874.644) (-877.539) [-877.951] * (-876.118) (-874.496) [-878.820] (-878.487) -- 0:01:02
75000 -- [-874.165] (-874.923) (-877.574) (-876.991) * (-873.982) (-877.126) (-876.328) [-878.509] -- 0:01:01
Average standard deviation of split frequencies: 0.019261
75500 -- (-874.356) (-876.148) (-875.113) [-875.649] * (-875.360) [-875.331] (-873.755) (-874.540) -- 0:01:01
76000 -- (-874.387) (-879.471) (-874.493) [-874.478] * (-876.444) (-877.167) [-874.499] (-874.000) -- 0:01:00
76500 -- [-875.292] (-877.765) (-874.044) (-873.836) * (-874.595) [-875.080] (-874.672) (-873.721) -- 0:01:00
77000 -- [-875.945] (-876.326) (-876.564) (-875.102) * [-876.932] (-874.516) (-877.054) (-877.263) -- 0:00:59
77500 -- (-878.039) (-874.482) (-877.676) [-875.803] * [-879.880] (-874.272) (-877.715) (-879.794) -- 0:00:59
78000 -- (-876.761) (-877.189) [-874.722] (-877.274) * (-874.680) [-873.750] (-875.549) (-878.057) -- 0:00:59
78500 -- (-875.004) (-878.649) (-876.296) [-873.414] * (-875.441) (-874.230) (-875.453) [-875.921] -- 0:00:58
79000 -- (-874.491) [-876.149] (-880.184) (-874.488) * (-880.124) (-874.474) [-876.784] (-879.418) -- 0:00:58
79500 -- (-874.878) [-874.736] (-877.299) (-874.020) * (-875.870) [-873.894] (-876.993) (-878.663) -- 0:00:57
80000 -- (-874.766) [-875.721] (-879.185) (-875.169) * (-879.194) (-875.254) (-877.462) [-879.072] -- 0:00:57
Average standard deviation of split frequencies: 0.020746
80500 -- (-874.907) (-875.042) [-875.147] (-875.158) * (-873.807) (-874.288) [-875.152] (-877.639) -- 0:00:57
81000 -- (-874.234) (-875.054) [-879.137] (-873.960) * (-880.906) [-873.916] (-876.452) (-879.220) -- 0:00:56
81500 -- [-875.571] (-875.340) (-875.446) (-876.358) * (-877.142) (-874.247) (-877.806) [-877.886] -- 0:00:56
82000 -- (-876.440) (-875.229) (-874.065) [-876.425] * (-876.001) [-875.868] (-878.704) (-876.915) -- 0:00:55
82500 -- (-875.150) (-878.969) [-874.176] (-873.924) * [-873.849] (-876.469) (-874.146) (-876.628) -- 0:00:55
83000 -- [-874.517] (-876.632) (-876.936) (-876.229) * (-875.564) [-875.033] (-875.053) (-880.791) -- 0:00:55
83500 -- [-874.766] (-877.188) (-874.032) (-874.489) * (-876.737) (-875.931) [-875.099] (-875.765) -- 0:00:54
84000 -- [-873.875] (-875.676) (-875.787) (-878.517) * (-878.639) [-874.279] (-876.367) (-874.065) -- 0:00:54
84500 -- [-874.584] (-876.715) (-874.448) (-874.675) * (-878.056) (-875.153) [-875.592] (-874.545) -- 0:00:54
85000 -- (-875.310) (-876.635) (-874.581) [-873.892] * (-878.465) (-874.690) (-876.561) [-873.893] -- 0:00:53
Average standard deviation of split frequencies: 0.021926
85500 -- (-875.206) (-875.536) (-876.309) [-876.451] * (-875.600) (-874.001) [-876.621] (-875.317) -- 0:00:53
86000 -- (-876.632) (-876.329) (-876.958) [-877.124] * (-875.280) (-875.916) [-875.522] (-874.774) -- 0:00:53
86500 -- (-877.247) [-876.502] (-875.396) (-874.428) * (-878.242) (-876.792) [-876.236] (-875.365) -- 0:00:52
87000 -- (-880.902) (-877.732) [-876.398] (-876.605) * (-878.498) [-877.490] (-874.982) (-876.142) -- 0:01:02
87500 -- [-874.897] (-875.237) (-874.650) (-874.961) * (-875.797) (-875.027) (-874.532) [-878.360] -- 0:01:02
88000 -- (-875.933) (-875.874) (-874.649) [-875.805] * [-877.152] (-875.513) (-876.564) (-876.814) -- 0:01:02
88500 -- [-876.551] (-875.595) (-877.102) (-875.114) * (-876.164) [-874.771] (-876.224) (-875.171) -- 0:01:01
89000 -- (-875.303) (-876.064) [-875.480] (-875.821) * (-876.026) [-876.327] (-878.128) (-876.037) -- 0:01:01
89500 -- (-875.943) (-875.771) (-875.125) [-876.960] * (-874.877) (-877.150) [-874.817] (-875.558) -- 0:01:01
90000 -- (-874.119) (-874.603) (-875.769) [-876.355] * (-879.207) [-877.624] (-875.284) (-873.947) -- 0:01:00
Average standard deviation of split frequencies: 0.021292
90500 -- (-874.647) (-875.322) (-875.365) [-875.095] * (-874.427) (-874.247) [-876.058] (-874.217) -- 0:01:00
91000 -- (-875.754) (-875.301) [-875.398] (-876.427) * (-876.765) (-875.499) (-877.231) [-875.172] -- 0:00:59
91500 -- (-875.155) (-873.950) [-878.955] (-876.394) * (-876.245) (-874.380) [-878.488] (-876.068) -- 0:00:59
92000 -- (-878.598) (-874.044) (-876.608) [-875.843] * (-875.745) (-875.265) (-877.419) [-874.342] -- 0:00:59
92500 -- (-876.643) (-874.393) (-875.364) [-876.915] * (-877.058) (-876.027) (-876.906) [-875.325] -- 0:00:58
93000 -- (-874.724) [-875.358] (-874.578) (-881.805) * (-874.226) [-876.607] (-876.549) (-876.452) -- 0:00:58
93500 -- (-876.853) [-875.025] (-875.357) (-878.045) * [-874.957] (-874.956) (-876.240) (-877.524) -- 0:00:58
94000 -- (-874.863) (-876.625) (-876.174) [-876.506] * (-877.635) (-877.089) [-874.203] (-875.098) -- 0:00:57
94500 -- (-876.845) [-874.638] (-877.168) (-882.014) * [-874.175] (-876.717) (-873.924) (-874.579) -- 0:00:57
95000 -- (-879.266) [-874.959] (-875.601) (-878.254) * (-874.797) [-875.445] (-874.287) (-879.821) -- 0:00:57
Average standard deviation of split frequencies: 0.019887
95500 -- (-877.225) [-874.419] (-876.829) (-879.480) * (-876.334) (-875.098) [-874.879] (-879.460) -- 0:00:56
96000 -- (-874.598) (-874.451) (-875.986) [-878.198] * [-875.521] (-875.526) (-874.702) (-875.986) -- 0:00:56
96500 -- (-882.128) (-874.389) [-875.897] (-874.291) * (-874.186) (-875.760) [-875.092] (-875.916) -- 0:00:56
97000 -- (-876.179) (-877.361) [-878.658] (-873.688) * (-877.458) [-878.208] (-879.234) (-878.314) -- 0:00:55
97500 -- (-875.638) (-875.311) [-876.400] (-874.194) * (-873.593) (-875.665) (-878.912) [-874.153] -- 0:00:55
98000 -- (-875.866) (-875.633) (-874.545) [-874.665] * (-875.103) (-877.200) [-875.414] (-874.698) -- 0:00:55
98500 -- (-878.323) [-874.367] (-873.877) (-875.870) * [-878.768] (-881.170) (-874.553) (-877.360) -- 0:00:54
99000 -- (-875.638) (-875.104) (-873.623) [-875.587] * (-875.907) [-879.757] (-877.919) (-874.105) -- 0:00:54
99500 -- [-875.276] (-881.051) (-874.501) (-877.511) * (-877.640) [-873.337] (-874.956) (-875.508) -- 0:00:54
100000 -- (-875.153) (-876.642) [-875.334] (-877.530) * (-875.505) (-874.855) (-875.185) [-874.785] -- 0:00:54
Average standard deviation of split frequencies: 0.019902
100500 -- (-875.779) [-878.573] (-874.245) (-873.593) * (-876.273) (-879.066) (-876.283) [-873.787] -- 0:00:53
101000 -- [-875.560] (-876.310) (-875.224) (-874.977) * (-875.355) [-882.315] (-876.646) (-875.557) -- 0:00:53
101500 -- (-875.049) (-883.950) [-876.087] (-881.952) * [-876.936] (-873.877) (-875.014) (-875.369) -- 0:00:53
102000 -- [-878.103] (-882.028) (-878.277) (-877.147) * (-880.099) (-878.240) [-876.488] (-879.171) -- 0:00:52
102500 -- (-875.181) (-879.098) (-879.080) [-876.834] * (-875.341) [-878.881] (-874.688) (-874.745) -- 0:00:52
103000 -- (-877.019) [-874.950] (-873.753) (-877.402) * [-876.335] (-874.914) (-874.912) (-875.390) -- 0:00:52
103500 -- [-875.451] (-876.724) (-876.909) (-876.844) * (-876.770) (-874.638) [-875.021] (-879.550) -- 0:01:00
104000 -- (-874.669) (-877.580) [-877.142] (-874.810) * (-877.553) (-877.019) [-875.515] (-875.415) -- 0:01:00
104500 -- [-875.366] (-874.889) (-877.453) (-874.767) * (-875.438) (-877.750) [-874.517] (-876.547) -- 0:00:59
105000 -- (-877.152) [-878.142] (-874.614) (-876.885) * (-877.017) (-876.204) [-875.820] (-877.291) -- 0:00:59
Average standard deviation of split frequencies: 0.018424
105500 -- (-875.796) (-878.960) (-876.797) [-876.596] * (-877.440) (-879.223) [-875.435] (-874.896) -- 0:00:59
106000 -- (-876.281) (-876.004) (-876.516) [-876.870] * [-876.564] (-879.123) (-874.523) (-874.698) -- 0:00:59
106500 -- (-876.744) (-875.465) [-878.802] (-875.463) * [-879.130] (-875.637) (-875.016) (-880.896) -- 0:00:58
107000 -- [-873.888] (-875.120) (-877.688) (-876.444) * (-885.784) (-878.165) (-876.216) [-875.197] -- 0:00:58
107500 -- [-874.008] (-874.575) (-878.338) (-876.557) * (-876.728) [-877.683] (-878.425) (-876.052) -- 0:00:58
108000 -- (-875.229) [-875.391] (-877.241) (-879.830) * (-875.256) (-874.502) [-876.213] (-876.377) -- 0:00:57
108500 -- (-880.479) [-877.383] (-877.762) (-877.942) * (-876.218) (-876.482) (-875.361) [-879.833] -- 0:00:57
109000 -- [-876.786] (-877.142) (-877.280) (-879.169) * [-874.013] (-876.862) (-875.409) (-874.338) -- 0:00:57
109500 -- (-878.071) [-876.860] (-879.066) (-876.530) * (-878.799) [-877.175] (-875.231) (-875.716) -- 0:00:56
110000 -- (-878.561) (-875.101) [-876.733] (-874.832) * (-877.178) (-877.434) (-874.881) [-874.697] -- 0:00:56
Average standard deviation of split frequencies: 0.020177
110500 -- (-875.210) (-875.559) [-875.929] (-875.081) * [-874.437] (-874.704) (-874.895) (-875.749) -- 0:00:56
111000 -- (-878.421) (-874.813) [-874.872] (-875.454) * (-875.596) (-875.850) [-876.733] (-874.235) -- 0:00:56
111500 -- (-877.420) (-876.298) (-873.748) [-875.265] * (-878.086) (-875.347) [-876.255] (-874.109) -- 0:00:55
112000 -- (-877.099) [-876.177] (-874.338) (-875.568) * (-880.086) (-878.394) (-874.787) [-875.394] -- 0:00:55
112500 -- (-876.194) (-878.128) (-874.333) [-878.867] * (-876.702) [-876.633] (-876.050) (-875.825) -- 0:00:55
113000 -- (-875.631) (-878.975) (-877.486) [-877.327] * (-876.253) (-877.017) (-875.877) [-875.438] -- 0:00:54
113500 -- (-876.301) (-876.920) [-874.456] (-877.024) * (-876.483) [-874.778] (-877.228) (-877.018) -- 0:00:54
114000 -- (-877.550) (-874.307) [-874.042] (-873.713) * (-874.557) (-875.791) (-874.102) [-877.290] -- 0:00:54
114500 -- [-874.939] (-874.379) (-874.899) (-875.445) * (-874.847) [-877.133] (-874.236) (-876.368) -- 0:00:54
115000 -- (-874.668) (-874.429) (-873.742) [-874.771] * (-875.811) (-878.020) (-874.896) [-877.714] -- 0:00:53
Average standard deviation of split frequencies: 0.021175
115500 -- (-878.125) (-875.406) [-874.701] (-874.038) * [-874.909] (-875.142) (-877.031) (-877.332) -- 0:00:53
116000 -- (-876.936) (-878.599) (-874.043) [-873.821] * [-876.544] (-875.421) (-876.146) (-876.762) -- 0:00:53
116500 -- (-875.449) [-876.393] (-873.776) (-876.014) * (-876.535) (-876.098) (-876.071) [-880.207] -- 0:00:53
117000 -- [-874.559] (-875.638) (-874.536) (-874.120) * (-875.482) [-875.472] (-876.403) (-878.573) -- 0:00:52
117500 -- (-875.079) (-876.705) [-874.744] (-873.726) * (-878.506) (-875.415) [-879.750] (-877.844) -- 0:00:52
118000 -- (-875.009) [-876.680] (-874.148) (-876.001) * (-878.998) [-874.087] (-874.922) (-875.167) -- 0:00:52
118500 -- [-878.486] (-876.500) (-878.913) (-876.767) * (-876.498) [-874.508] (-875.641) (-875.208) -- 0:00:52
119000 -- (-877.430) [-874.300] (-876.854) (-875.461) * (-874.385) [-875.710] (-874.832) (-877.390) -- 0:00:51
119500 -- (-876.691) (-876.287) (-876.042) [-874.027] * (-878.579) (-873.766) (-874.465) [-874.533] -- 0:00:51
120000 -- (-875.032) [-874.940] (-878.790) (-874.942) * (-879.047) (-873.740) [-875.095] (-875.102) -- 0:00:51
Average standard deviation of split frequencies: 0.017775
120500 -- (-878.115) (-876.601) (-879.553) [-874.156] * (-878.218) (-880.785) (-875.676) [-875.443] -- 0:00:58
121000 -- [-873.436] (-876.952) (-876.351) (-875.522) * (-874.195) (-874.325) (-874.886) [-873.673] -- 0:00:58
121500 -- (-874.312) [-879.710] (-876.690) (-875.759) * (-875.497) (-877.201) [-874.096] (-873.532) -- 0:00:57
122000 -- (-874.639) [-877.094] (-875.835) (-875.897) * [-876.417] (-875.715) (-874.325) (-878.915) -- 0:00:57
122500 -- [-877.898] (-874.764) (-877.017) (-875.211) * [-875.057] (-875.809) (-874.207) (-875.603) -- 0:00:57
123000 -- (-875.925) [-875.037] (-876.038) (-879.251) * (-875.685) [-878.784] (-875.658) (-874.227) -- 0:00:57
123500 -- (-874.272) [-875.296] (-874.487) (-878.994) * (-874.682) [-876.721] (-875.210) (-873.843) -- 0:00:56
124000 -- (-874.544) (-874.913) (-874.446) [-875.247] * (-875.070) [-873.923] (-875.139) (-873.758) -- 0:00:56
124500 -- (-874.519) [-874.368] (-875.039) (-876.049) * (-874.969) (-876.689) (-874.691) [-875.739] -- 0:00:56
125000 -- (-874.573) (-875.682) [-879.773] (-875.614) * (-876.134) (-875.960) (-874.642) [-876.127] -- 0:00:56
Average standard deviation of split frequencies: 0.017281
125500 -- (-874.561) (-879.366) (-874.650) [-874.809] * (-876.341) (-877.394) (-875.794) [-876.207] -- 0:00:55
126000 -- [-875.417] (-877.532) (-880.823) (-875.455) * (-875.031) (-876.224) (-875.593) [-874.598] -- 0:00:55
126500 -- [-873.934] (-875.842) (-874.864) (-876.632) * (-876.351) (-874.798) (-875.622) [-874.328] -- 0:00:55
127000 -- (-873.547) (-876.090) [-873.910] (-877.003) * (-876.760) (-875.981) (-875.913) [-879.938] -- 0:00:54
127500 -- [-873.654] (-878.784) (-874.273) (-878.199) * (-874.262) (-883.261) (-874.982) [-875.949] -- 0:00:54
128000 -- [-876.737] (-880.473) (-873.613) (-878.788) * (-876.877) (-878.615) (-876.044) [-877.048] -- 0:00:54
128500 -- (-875.087) (-880.813) [-875.888] (-877.688) * [-875.342] (-875.241) (-877.376) (-878.389) -- 0:00:54
129000 -- (-879.842) (-876.661) [-879.073] (-879.030) * (-877.183) (-876.076) (-879.263) [-878.785] -- 0:00:54
129500 -- (-878.506) [-878.656] (-874.981) (-877.766) * (-879.479) (-874.547) (-875.432) [-878.420] -- 0:00:53
130000 -- (-881.463) [-876.425] (-882.134) (-881.423) * [-876.279] (-880.816) (-874.324) (-878.268) -- 0:00:53
Average standard deviation of split frequencies: 0.016727
130500 -- [-876.741] (-875.730) (-877.173) (-874.399) * (-875.446) (-879.051) (-875.559) [-877.554] -- 0:00:53
131000 -- (-879.386) (-879.257) [-876.285] (-877.935) * (-878.288) (-880.041) [-877.313] (-874.091) -- 0:00:53
131500 -- (-874.825) (-874.152) (-877.056) [-874.520] * [-875.069] (-874.812) (-877.802) (-876.742) -- 0:00:52
132000 -- (-875.995) (-877.470) (-874.865) [-876.067] * (-874.392) [-876.619] (-877.061) (-876.145) -- 0:00:52
132500 -- [-878.002] (-877.746) (-879.582) (-875.388) * (-874.969) [-878.231] (-875.908) (-877.636) -- 0:00:52
133000 -- (-881.534) (-875.662) (-881.999) [-877.021] * (-880.001) (-880.529) (-875.478) [-876.042] -- 0:00:52
133500 -- (-875.124) (-874.231) [-874.569] (-877.181) * (-879.540) [-876.022] (-876.072) (-874.421) -- 0:00:51
134000 -- (-873.872) [-876.217] (-874.715) (-877.406) * [-875.919] (-874.799) (-878.071) (-876.254) -- 0:00:51
134500 -- (-873.980) (-876.258) (-876.529) [-875.764] * [-876.430] (-874.798) (-875.353) (-876.719) -- 0:00:51
135000 -- (-873.764) [-875.601] (-877.853) (-874.754) * (-878.965) (-875.522) (-878.236) [-873.865] -- 0:00:51
Average standard deviation of split frequencies: 0.014777
135500 -- (-876.933) (-875.543) [-874.539] (-874.581) * (-879.927) (-874.340) [-874.749] (-874.009) -- 0:00:51
136000 -- (-881.097) (-877.819) [-877.917] (-877.245) * (-876.451) [-875.447] (-875.678) (-874.338) -- 0:00:50
136500 -- (-877.782) (-876.508) [-874.773] (-875.561) * [-875.004] (-877.053) (-875.628) (-876.942) -- 0:00:50
137000 -- (-875.567) [-874.341] (-874.215) (-874.126) * (-877.035) (-875.058) [-875.721] (-873.600) -- 0:00:50
137500 -- (-873.829) (-878.366) (-876.534) [-875.293] * (-875.436) [-873.678] (-877.558) (-874.009) -- 0:00:56
138000 -- (-874.944) (-875.621) (-878.338) [-874.234] * [-875.196] (-873.678) (-874.309) (-873.829) -- 0:00:56
138500 -- (-874.770) (-877.972) (-877.310) [-875.593] * (-874.650) (-879.880) [-875.149] (-875.009) -- 0:00:55
139000 -- (-874.331) (-876.965) [-876.117] (-874.106) * [-874.782] (-875.934) (-874.896) (-877.013) -- 0:00:55
139500 -- (-874.278) (-877.610) [-876.411] (-873.559) * (-874.302) [-874.157] (-875.585) (-874.934) -- 0:00:55
140000 -- (-873.581) [-876.328] (-874.269) (-880.581) * (-874.183) (-875.781) [-873.957] (-875.081) -- 0:00:55
Average standard deviation of split frequencies: 0.015874
140500 -- [-873.661] (-877.200) (-877.379) (-876.433) * (-874.255) [-875.691] (-876.015) (-876.752) -- 0:00:55
141000 -- (-881.070) [-874.582] (-874.473) (-875.309) * [-874.358] (-877.260) (-876.058) (-877.130) -- 0:00:54
141500 -- (-876.008) (-875.275) (-876.040) [-874.237] * (-876.422) (-877.407) (-876.218) [-876.346] -- 0:00:54
142000 -- (-877.567) (-877.612) (-877.214) [-874.970] * (-878.449) [-875.517] (-875.304) (-877.705) -- 0:00:54
142500 -- (-875.489) (-878.677) (-877.338) [-876.342] * (-876.379) [-875.083] (-874.698) (-877.132) -- 0:00:54
143000 -- (-875.196) (-874.105) (-879.206) [-874.588] * [-874.782] (-874.895) (-875.255) (-876.213) -- 0:00:53
143500 -- [-875.872] (-874.394) (-874.065) (-879.180) * (-875.208) [-875.767] (-876.315) (-876.440) -- 0:00:53
144000 -- (-877.463) (-873.580) (-875.444) [-875.821] * (-875.865) [-878.119] (-876.116) (-882.457) -- 0:00:53
144500 -- [-877.284] (-878.823) (-875.657) (-873.499) * [-874.149] (-877.779) (-878.092) (-874.430) -- 0:00:53
145000 -- (-876.789) (-875.348) [-876.048] (-876.861) * (-874.979) (-876.512) (-874.418) [-873.968] -- 0:00:53
Average standard deviation of split frequencies: 0.014954
145500 -- (-878.673) (-874.598) (-875.779) [-877.440] * (-875.713) [-873.944] (-875.992) (-874.066) -- 0:00:52
146000 -- (-876.482) [-874.531] (-876.283) (-876.050) * (-874.892) (-874.498) (-875.949) [-874.384] -- 0:00:52
146500 -- [-878.096] (-874.324) (-876.372) (-876.718) * [-875.414] (-874.825) (-876.411) (-877.047) -- 0:00:52
147000 -- (-881.797) (-874.935) [-878.881] (-876.086) * [-875.759] (-878.139) (-874.518) (-876.124) -- 0:00:52
147500 -- (-873.795) (-875.277) [-876.394] (-875.176) * (-877.936) (-875.873) [-875.671] (-879.602) -- 0:00:52
148000 -- (-876.510) [-874.803] (-876.451) (-876.159) * (-876.514) (-874.563) [-875.931] (-880.445) -- 0:00:51
148500 -- [-874.902] (-874.456) (-876.558) (-875.937) * (-873.918) (-875.022) (-874.870) [-881.719] -- 0:00:51
149000 -- (-878.444) (-877.168) [-879.185] (-875.887) * (-875.456) (-877.075) [-875.081] (-875.340) -- 0:00:51
149500 -- (-877.307) [-879.753] (-874.913) (-875.061) * (-874.017) (-884.102) (-875.081) [-875.459] -- 0:00:51
150000 -- (-876.165) (-877.083) [-876.796] (-874.428) * (-876.344) (-876.924) (-876.020) [-875.386] -- 0:00:51
Average standard deviation of split frequencies: 0.014862
150500 -- (-877.181) (-877.150) [-875.705] (-876.435) * (-873.777) (-878.543) [-880.130] (-875.487) -- 0:00:50
151000 -- (-876.290) (-874.485) [-876.656] (-874.373) * [-874.162] (-878.040) (-875.766) (-875.167) -- 0:00:50
151500 -- (-877.543) [-876.581] (-876.665) (-876.003) * (-876.657) (-876.000) [-875.898] (-876.168) -- 0:00:50
152000 -- (-876.108) (-876.391) [-879.641] (-874.519) * (-874.696) (-874.200) [-876.806] (-877.629) -- 0:00:50
152500 -- (-875.856) (-877.324) (-884.563) [-874.350] * [-875.787] (-874.924) (-873.714) (-874.472) -- 0:00:50
153000 -- (-876.640) (-873.798) [-875.219] (-876.520) * (-875.876) (-878.442) [-874.111] (-874.179) -- 0:00:49
153500 -- (-875.730) [-875.433] (-875.557) (-873.988) * [-876.048] (-878.003) (-875.853) (-875.158) -- 0:00:49
154000 -- (-876.982) [-874.714] (-882.899) (-875.860) * (-874.662) (-877.181) [-875.858] (-876.309) -- 0:00:54
154500 -- [-874.480] (-874.799) (-878.948) (-874.393) * [-874.057] (-875.875) (-875.714) (-877.037) -- 0:00:54
155000 -- (-875.475) (-873.787) [-876.810] (-873.653) * (-874.103) (-877.982) (-875.617) [-877.276] -- 0:00:54
Average standard deviation of split frequencies: 0.014773
155500 -- (-877.632) [-874.806] (-878.223) (-878.238) * [-879.171] (-875.099) (-879.562) (-874.245) -- 0:00:54
156000 -- (-875.425) (-874.612) (-874.741) [-877.737] * (-877.698) (-877.851) [-875.293] (-874.510) -- 0:00:54
156500 -- [-880.472] (-874.950) (-876.358) (-874.241) * (-878.502) (-879.900) (-877.026) [-875.147] -- 0:00:53
157000 -- (-877.749) [-877.134] (-875.920) (-882.885) * [-880.113] (-878.633) (-876.215) (-878.466) -- 0:00:53
157500 -- (-876.388) (-876.081) [-878.565] (-876.459) * (-879.058) (-876.979) [-874.771] (-878.842) -- 0:00:53
158000 -- (-875.704) (-874.690) (-874.474) [-874.630] * (-875.828) (-877.587) [-877.668] (-875.206) -- 0:00:53
158500 -- (-877.088) (-875.372) [-875.225] (-876.489) * (-878.761) (-878.452) (-877.831) [-879.930] -- 0:00:53
159000 -- (-875.580) (-876.901) [-875.586] (-874.382) * (-876.413) (-883.849) [-880.717] (-874.072) -- 0:00:52
159500 -- (-875.102) [-881.073] (-877.696) (-873.977) * [-876.257] (-879.548) (-875.539) (-875.317) -- 0:00:52
160000 -- (-877.544) (-875.925) [-877.100] (-874.557) * (-879.182) (-877.025) [-874.371] (-875.361) -- 0:00:52
Average standard deviation of split frequencies: 0.013744
160500 -- (-875.082) (-876.564) [-877.494] (-875.363) * [-877.238] (-875.273) (-874.020) (-875.110) -- 0:00:52
161000 -- (-876.233) [-877.403] (-873.815) (-876.860) * (-874.541) (-874.904) [-873.818] (-873.653) -- 0:00:52
161500 -- (-874.364) (-873.811) [-876.322] (-875.829) * (-874.612) (-878.242) (-873.998) [-876.469] -- 0:00:51
162000 -- (-874.848) (-875.887) (-876.746) [-874.179] * (-874.211) [-877.714] (-874.074) (-874.839) -- 0:00:51
162500 -- (-874.457) (-877.026) (-876.312) [-874.667] * (-875.901) (-876.289) [-874.859] (-876.124) -- 0:00:51
163000 -- (-873.843) (-876.177) (-876.764) [-873.520] * [-874.747] (-876.456) (-876.158) (-873.867) -- 0:00:51
163500 -- (-873.843) [-873.904] (-876.333) (-873.959) * [-874.436] (-876.580) (-875.884) (-874.862) -- 0:00:51
164000 -- (-875.715) (-873.760) [-879.227] (-873.766) * [-875.969] (-876.143) (-874.269) (-874.108) -- 0:00:50
164500 -- (-875.694) (-875.488) [-879.081] (-877.342) * (-878.770) (-881.263) [-873.632] (-873.539) -- 0:00:50
165000 -- (-877.083) [-874.192] (-877.884) (-875.930) * (-875.896) (-882.564) [-873.710] (-875.400) -- 0:00:50
Average standard deviation of split frequencies: 0.013410
165500 -- [-875.937] (-874.622) (-874.385) (-877.900) * (-876.111) [-877.409] (-876.349) (-883.697) -- 0:00:50
166000 -- (-874.626) (-879.504) (-874.636) [-876.809] * (-878.101) [-874.824] (-874.508) (-877.682) -- 0:00:50
166500 -- (-873.873) (-882.876) [-874.363] (-875.883) * (-875.773) (-882.202) (-875.835) [-875.940] -- 0:00:50
167000 -- (-876.663) (-875.199) (-874.324) [-876.120] * (-875.824) [-876.620] (-875.791) (-874.851) -- 0:00:49
167500 -- (-874.597) (-878.638) (-875.116) [-875.357] * (-874.014) [-875.464] (-874.426) (-876.312) -- 0:00:49
168000 -- (-877.778) (-875.357) [-876.480] (-875.263) * (-881.056) [-879.419] (-874.809) (-874.887) -- 0:00:49
168500 -- [-876.867] (-874.638) (-876.735) (-873.887) * (-878.635) (-874.325) [-875.058] (-876.601) -- 0:00:49
169000 -- (-878.939) [-875.448] (-876.093) (-873.893) * (-874.628) (-880.552) [-875.315] (-875.740) -- 0:00:49
169500 -- (-876.534) (-877.889) (-876.407) [-874.428] * (-879.187) (-879.902) [-875.074] (-877.070) -- 0:00:48
170000 -- (-877.247) (-875.501) (-878.373) [-877.125] * (-877.006) (-877.828) [-875.187] (-874.899) -- 0:00:48
Average standard deviation of split frequencies: 0.012502
170500 -- [-874.551] (-881.825) (-874.651) (-877.498) * (-876.930) [-877.742] (-873.477) (-876.608) -- 0:00:53
171000 -- (-876.293) (-875.129) (-874.864) [-875.396] * (-876.310) (-875.688) (-874.412) [-874.741] -- 0:00:53
171500 -- (-874.929) (-875.251) (-874.238) [-876.127] * (-874.572) (-874.612) (-875.920) [-875.090] -- 0:00:53
172000 -- (-875.730) [-877.133] (-876.689) (-875.815) * (-877.461) (-875.413) (-877.971) [-875.939] -- 0:00:52
172500 -- [-876.258] (-875.616) (-876.594) (-877.570) * [-881.413] (-875.049) (-879.783) (-875.706) -- 0:00:52
173000 -- (-878.458) [-875.290] (-877.686) (-875.840) * (-880.309) (-876.018) [-876.211] (-876.462) -- 0:00:52
173500 -- (-875.812) (-876.097) (-876.809) [-874.769] * (-882.650) [-874.155] (-875.253) (-879.129) -- 0:00:52
174000 -- (-875.735) (-874.989) [-877.065] (-880.064) * (-876.771) (-874.313) (-878.175) [-876.914] -- 0:00:52
174500 -- (-873.948) (-875.019) [-874.498] (-875.063) * (-876.356) [-875.834] (-877.220) (-876.783) -- 0:00:52
175000 -- [-874.166] (-874.930) (-875.571) (-875.727) * (-878.171) [-875.863] (-878.292) (-874.590) -- 0:00:51
Average standard deviation of split frequencies: 0.011278
175500 -- (-873.990) (-874.885) (-874.376) [-875.125] * (-878.499) (-874.329) [-876.566] (-882.207) -- 0:00:51
176000 -- (-874.225) (-874.366) [-874.161] (-875.572) * [-875.463] (-874.390) (-874.895) (-879.826) -- 0:00:51
176500 -- (-874.566) (-878.271) [-875.232] (-876.123) * (-876.429) (-875.359) [-876.068] (-876.715) -- 0:00:51
177000 -- (-874.217) (-877.901) (-878.994) [-876.004] * [-874.931] (-875.432) (-877.322) (-876.554) -- 0:00:51
177500 -- (-876.291) (-876.467) [-874.880] (-877.319) * (-876.736) [-874.280] (-873.385) (-874.353) -- 0:00:50
178000 -- (-873.963) [-874.787] (-874.563) (-876.593) * (-874.356) (-874.400) [-874.073] (-875.752) -- 0:00:50
178500 -- (-877.704) [-874.375] (-877.383) (-877.001) * (-874.388) (-875.671) [-876.550] (-876.613) -- 0:00:50
179000 -- [-874.868] (-876.476) (-874.690) (-877.321) * (-876.236) (-875.214) [-875.296] (-877.303) -- 0:00:50
179500 -- [-874.690] (-877.598) (-873.794) (-875.037) * (-875.343) (-876.125) [-874.067] (-879.165) -- 0:00:50
180000 -- [-876.129] (-876.811) (-876.141) (-875.683) * (-875.563) (-877.816) (-874.575) [-877.917] -- 0:00:50
Average standard deviation of split frequencies: 0.011887
180500 -- (-873.800) [-875.091] (-878.511) (-875.237) * (-876.374) [-876.563] (-875.580) (-873.842) -- 0:00:49
181000 -- (-874.966) (-877.036) (-875.070) [-876.987] * [-877.786] (-874.690) (-875.245) (-875.379) -- 0:00:49
181500 -- [-876.239] (-874.754) (-874.247) (-878.223) * [-875.459] (-874.954) (-873.688) (-874.043) -- 0:00:49
182000 -- [-876.294] (-875.417) (-874.776) (-874.254) * (-874.581) (-877.907) [-874.630] (-874.101) -- 0:00:49
182500 -- [-875.089] (-878.508) (-875.131) (-874.552) * [-875.358] (-874.517) (-875.413) (-874.857) -- 0:00:49
183000 -- (-876.729) (-875.025) [-874.712] (-873.810) * (-873.572) (-876.448) [-873.933] (-874.416) -- 0:00:49
183500 -- [-875.932] (-875.736) (-875.280) (-874.784) * (-874.735) (-875.239) (-875.926) [-876.058] -- 0:00:48
184000 -- [-874.448] (-873.702) (-879.913) (-876.498) * (-875.996) (-875.678) [-875.181] (-875.356) -- 0:00:48
184500 -- [-874.576] (-876.585) (-876.457) (-874.147) * (-875.083) [-875.218] (-875.808) (-875.616) -- 0:00:48
185000 -- (-875.071) (-874.263) (-878.637) [-876.353] * (-877.139) (-873.476) (-876.089) [-874.873] -- 0:00:48
Average standard deviation of split frequencies: 0.011968
185500 -- (-874.805) (-874.578) [-874.817] (-880.017) * (-878.399) (-874.238) (-875.487) [-874.921] -- 0:00:48
186000 -- (-876.234) [-875.482] (-877.218) (-875.607) * [-880.222] (-874.238) (-878.668) (-875.876) -- 0:00:48
186500 -- (-879.755) [-876.956] (-880.915) (-874.515) * (-881.868) [-873.949] (-876.814) (-874.476) -- 0:00:47
187000 -- [-876.730] (-876.167) (-879.668) (-874.562) * (-876.641) [-873.620] (-876.193) (-874.617) -- 0:00:52
187500 -- (-878.453) [-874.592] (-878.151) (-878.454) * (-877.912) (-874.806) [-876.741] (-873.941) -- 0:00:52
188000 -- [-876.706] (-875.012) (-878.939) (-878.054) * (-874.700) (-877.033) (-876.362) [-873.638] -- 0:00:51
188500 -- [-876.147] (-873.966) (-875.845) (-877.859) * (-874.712) (-876.434) (-875.534) [-873.824] -- 0:00:51
189000 -- [-875.043] (-873.543) (-880.161) (-877.207) * (-877.504) (-877.521) (-875.614) [-876.545] -- 0:00:51
189500 -- (-875.264) (-873.817) [-875.411] (-879.301) * [-877.258] (-877.563) (-874.373) (-876.336) -- 0:00:51
190000 -- (-874.663) (-876.027) [-875.499] (-880.911) * (-876.228) [-876.668] (-874.254) (-875.195) -- 0:00:51
Average standard deviation of split frequencies: 0.010800
190500 -- (-875.482) (-874.946) [-877.068] (-879.166) * (-879.229) (-878.905) [-873.857] (-875.908) -- 0:00:50
191000 -- (-876.388) (-875.192) [-874.518] (-874.084) * (-877.410) (-882.265) [-873.429] (-875.439) -- 0:00:50
191500 -- (-876.693) (-875.773) [-874.399] (-874.084) * [-879.818] (-877.964) (-876.845) (-876.041) -- 0:00:50
192000 -- (-874.902) [-873.732] (-875.223) (-874.689) * (-875.636) (-875.741) [-875.202] (-875.383) -- 0:00:50
192500 -- (-874.334) (-874.337) (-876.928) [-875.253] * (-875.394) (-874.056) (-874.526) [-875.319] -- 0:00:50
193000 -- (-875.946) (-875.146) (-877.350) [-875.937] * [-875.725] (-874.699) (-876.233) (-875.137) -- 0:00:50
193500 -- (-878.096) [-874.583] (-877.059) (-878.567) * (-878.308) [-876.854] (-877.004) (-876.363) -- 0:00:50
194000 -- (-875.442) (-873.426) (-877.090) [-877.054] * (-874.689) (-877.199) [-874.479] (-876.966) -- 0:00:49
194500 -- [-875.563] (-874.499) (-877.182) (-878.750) * (-874.939) (-873.808) [-877.178] (-874.586) -- 0:00:49
195000 -- [-875.390] (-880.497) (-876.908) (-877.216) * (-874.882) (-873.606) (-876.551) [-877.553] -- 0:00:49
Average standard deviation of split frequencies: 0.010253
195500 -- (-874.444) (-877.123) (-877.796) [-874.327] * (-874.176) (-873.843) [-874.466] (-874.096) -- 0:00:49
196000 -- (-876.954) (-879.656) [-874.052] (-875.287) * (-877.803) (-873.570) [-876.370] (-876.178) -- 0:00:49
196500 -- [-876.148] (-875.332) (-876.462) (-876.065) * [-875.114] (-874.030) (-873.951) (-875.245) -- 0:00:49
197000 -- (-873.821) (-876.277) (-882.528) [-876.794] * (-875.559) [-874.835] (-874.969) (-879.586) -- 0:00:48
197500 -- (-874.839) (-874.951) (-881.592) [-875.235] * [-877.164] (-879.060) (-878.227) (-879.360) -- 0:00:48
198000 -- (-877.956) [-875.505] (-881.239) (-876.612) * [-877.628] (-874.573) (-875.489) (-873.788) -- 0:00:48
198500 -- [-873.845] (-877.162) (-877.199) (-879.622) * (-881.101) (-873.997) [-879.141] (-874.511) -- 0:00:48
199000 -- (-875.423) (-874.975) (-877.355) [-882.664] * (-877.961) [-874.527] (-876.952) (-877.703) -- 0:00:48
199500 -- [-876.272] (-874.488) (-875.369) (-874.380) * [-876.789] (-875.206) (-874.155) (-877.181) -- 0:00:48
200000 -- (-878.185) (-879.628) (-877.710) [-876.658] * (-876.332) (-874.494) [-874.915] (-876.179) -- 0:00:48
Average standard deviation of split frequencies: 0.011128
200500 -- (-878.734) (-877.349) (-879.258) [-877.315] * (-874.136) [-875.470] (-879.438) (-873.999) -- 0:00:47
201000 -- [-877.519] (-875.723) (-885.783) (-874.307) * (-875.434) (-875.594) (-876.477) [-875.522] -- 0:00:47
201500 -- [-878.310] (-877.357) (-876.472) (-876.326) * [-874.072] (-877.463) (-877.329) (-873.690) -- 0:00:47
202000 -- (-875.033) (-873.889) [-876.145] (-875.556) * (-875.277) [-875.789] (-874.999) (-873.916) -- 0:00:47
202500 -- [-876.823] (-873.755) (-878.384) (-877.483) * (-877.161) (-878.260) [-874.365] (-874.176) -- 0:00:47
203000 -- (-876.361) (-879.734) [-876.767] (-875.750) * [-876.609] (-880.704) (-875.586) (-879.012) -- 0:00:47
203500 -- (-875.710) [-874.595] (-875.737) (-878.082) * [-877.448] (-880.533) (-880.050) (-883.455) -- 0:00:50
204000 -- [-873.930] (-876.389) (-873.923) (-875.558) * (-875.736) (-878.662) (-879.168) [-879.477] -- 0:00:50
204500 -- (-877.226) (-875.171) (-875.816) [-876.415] * [-874.299] (-875.838) (-875.091) (-875.927) -- 0:00:50
205000 -- (-876.961) (-876.496) [-877.294] (-875.164) * [-879.008] (-875.070) (-875.728) (-876.518) -- 0:00:50
Average standard deviation of split frequencies: 0.011803
205500 -- [-875.187] (-874.431) (-879.159) (-876.555) * (-879.387) (-877.395) [-878.780] (-880.185) -- 0:00:50
206000 -- (-875.104) (-876.119) (-876.582) [-875.526] * (-877.445) (-876.200) [-875.385] (-875.018) -- 0:00:50
206500 -- (-881.143) (-878.338) [-877.120] (-875.147) * (-876.976) (-877.106) [-873.655] (-877.056) -- 0:00:49
207000 -- [-875.661] (-879.969) (-877.669) (-876.172) * (-875.637) (-878.138) (-876.287) [-874.447] -- 0:00:49
207500 -- (-874.162) (-876.528) (-876.936) [-874.512] * (-874.756) (-875.502) (-876.293) [-873.990] -- 0:00:49
208000 -- (-876.792) (-876.660) [-875.152] (-875.703) * (-874.407) [-873.730] (-874.229) (-874.862) -- 0:00:49
208500 -- (-876.326) [-877.917] (-875.406) (-879.484) * (-877.876) [-874.877] (-874.482) (-877.316) -- 0:00:49
209000 -- [-875.309] (-875.631) (-878.958) (-877.076) * (-875.324) (-875.265) [-875.367] (-874.576) -- 0:00:49
209500 -- [-875.741] (-874.991) (-879.600) (-875.794) * (-874.550) [-873.765] (-877.382) (-875.917) -- 0:00:49
210000 -- [-875.997] (-874.308) (-874.801) (-880.414) * [-875.117] (-877.564) (-874.387) (-874.405) -- 0:00:48
Average standard deviation of split frequencies: 0.012131
210500 -- (-875.928) (-874.217) [-875.037] (-874.064) * (-875.770) (-875.247) (-875.451) [-874.168] -- 0:00:48
211000 -- (-874.463) (-874.287) (-877.014) [-874.026] * (-875.637) (-875.113) (-877.131) [-874.099] -- 0:00:48
211500 -- [-880.555] (-875.074) (-875.191) (-874.101) * [-875.087] (-880.575) (-876.778) (-874.120) -- 0:00:48
212000 -- (-877.287) (-873.745) [-876.201] (-874.461) * (-876.582) [-875.387] (-875.868) (-874.709) -- 0:00:48
212500 -- (-874.739) [-874.551] (-875.898) (-874.103) * (-874.845) [-875.539] (-874.432) (-875.192) -- 0:00:48
213000 -- (-875.170) [-875.593] (-876.665) (-873.676) * (-875.973) (-875.435) (-876.105) [-879.137] -- 0:00:48
213500 -- (-873.626) (-877.779) [-875.983] (-874.871) * (-876.917) (-879.240) (-875.838) [-877.317] -- 0:00:47
214000 -- (-877.778) (-877.145) [-874.313] (-874.899) * (-875.774) [-875.297] (-875.989) (-875.018) -- 0:00:47
214500 -- [-877.141] (-877.786) (-878.237) (-873.934) * [-876.059] (-876.562) (-876.852) (-876.695) -- 0:00:47
215000 -- (-875.453) (-874.402) [-879.652] (-873.902) * (-876.671) (-875.489) [-875.566] (-875.202) -- 0:00:47
Average standard deviation of split frequencies: 0.011761
215500 -- (-873.966) (-874.825) (-880.740) [-873.935] * (-874.885) [-875.315] (-875.810) (-879.876) -- 0:00:47
216000 -- (-874.297) (-876.021) (-880.578) [-873.859] * (-874.903) [-878.105] (-876.269) (-874.370) -- 0:00:47
216500 -- (-875.827) [-874.670] (-873.586) (-875.197) * [-874.420] (-877.392) (-876.977) (-876.088) -- 0:00:47
217000 -- (-875.752) [-873.701] (-874.242) (-875.084) * (-881.082) [-876.760] (-873.956) (-874.360) -- 0:00:46
217500 -- (-874.085) (-873.403) [-877.239] (-874.172) * (-881.389) (-880.583) [-878.777] (-878.488) -- 0:00:46
218000 -- [-876.217] (-875.421) (-877.892) (-873.996) * [-874.891] (-876.643) (-877.696) (-880.518) -- 0:00:46
218500 -- (-875.595) (-875.931) (-875.015) [-875.443] * [-874.218] (-877.807) (-876.174) (-874.908) -- 0:00:46
219000 -- [-874.379] (-875.040) (-876.288) (-875.843) * (-874.561) (-875.190) [-877.255] (-875.021) -- 0:00:46
219500 -- [-874.070] (-876.354) (-875.212) (-876.019) * (-879.315) (-876.349) [-875.203] (-874.075) -- 0:00:46
220000 -- (-874.392) [-877.454] (-874.335) (-878.548) * [-876.721] (-875.631) (-879.786) (-874.693) -- 0:00:46
Average standard deviation of split frequencies: 0.011868
220500 -- (-873.716) (-879.454) [-875.137] (-878.115) * (-876.713) (-878.819) [-881.633] (-874.085) -- 0:00:49
221000 -- (-873.732) (-878.039) (-875.792) [-875.496] * (-875.599) (-875.960) (-882.061) [-874.252] -- 0:00:49
221500 -- (-874.770) (-876.353) [-875.021] (-876.795) * (-875.939) (-875.372) (-879.001) [-874.544] -- 0:00:49
222000 -- (-877.004) (-877.309) (-875.999) [-877.167] * (-875.755) [-875.595] (-880.894) (-875.112) -- 0:00:49
222500 -- [-875.428] (-876.522) (-877.524) (-875.359) * (-877.334) (-874.497) [-879.830] (-874.810) -- 0:00:48
223000 -- (-875.119) (-878.966) (-875.362) [-875.329] * (-875.876) [-878.775] (-878.102) (-874.600) -- 0:00:48
223500 -- (-874.957) [-877.124] (-874.889) (-877.276) * [-874.516] (-880.331) (-878.176) (-880.974) -- 0:00:48
224000 -- (-876.395) (-878.814) (-874.808) [-875.925] * [-874.157] (-876.741) (-876.273) (-875.508) -- 0:00:48
224500 -- (-879.989) (-874.914) (-875.105) [-875.906] * [-875.674] (-877.384) (-874.671) (-877.223) -- 0:00:48
225000 -- (-875.460) (-874.859) [-874.277] (-874.484) * (-875.779) (-875.405) (-876.032) [-877.518] -- 0:00:48
Average standard deviation of split frequencies: 0.013833
225500 -- [-874.646] (-878.902) (-874.324) (-876.805) * (-876.605) (-878.187) [-877.365] (-879.406) -- 0:00:48
226000 -- (-874.993) (-882.889) [-874.922] (-877.306) * [-875.482] (-879.086) (-875.944) (-875.210) -- 0:00:47
226500 -- (-875.680) [-877.213] (-877.559) (-873.961) * (-876.896) (-876.775) (-877.443) [-874.368] -- 0:00:47
227000 -- (-873.833) (-874.480) [-874.979] (-874.220) * [-874.947] (-877.546) (-879.806) (-876.963) -- 0:00:47
227500 -- (-875.903) [-874.307] (-874.519) (-874.418) * (-875.774) (-874.154) (-880.658) [-876.319] -- 0:00:47
228000 -- (-877.759) (-875.736) [-875.380] (-874.665) * [-877.686] (-875.149) (-874.553) (-878.143) -- 0:00:47
228500 -- (-877.325) (-875.799) (-876.292) [-874.830] * (-877.603) (-874.727) [-874.227] (-877.019) -- 0:00:47
229000 -- (-878.056) (-873.967) (-874.630) [-874.725] * (-873.972) [-873.354] (-875.067) (-874.929) -- 0:00:47
229500 -- (-876.012) [-874.936] (-874.749) (-875.678) * (-876.952) (-874.341) [-875.329] (-874.566) -- 0:00:47
230000 -- (-877.932) [-875.995] (-875.325) (-875.549) * (-877.924) (-880.034) [-873.470] (-874.309) -- 0:00:46
Average standard deviation of split frequencies: 0.015919
230500 -- (-877.275) (-876.062) [-875.150] (-878.196) * (-879.582) (-875.514) (-874.787) [-874.812] -- 0:00:46
231000 -- (-874.128) (-876.424) [-874.125] (-875.469) * [-873.942] (-874.575) (-873.824) (-876.209) -- 0:00:46
231500 -- (-875.165) [-874.700] (-880.336) (-876.685) * (-874.878) (-876.545) (-877.124) [-876.782] -- 0:00:46
232000 -- (-876.341) (-875.606) (-876.155) [-873.993] * (-874.992) (-879.663) [-875.550] (-873.922) -- 0:00:46
232500 -- [-877.492] (-874.376) (-878.432) (-873.492) * (-874.788) (-879.294) [-878.157] (-874.267) -- 0:00:46
233000 -- [-877.078] (-878.492) (-875.717) (-873.657) * [-874.840] (-876.953) (-883.935) (-878.495) -- 0:00:46
233500 -- (-879.273) (-877.292) [-875.384] (-875.405) * (-875.826) (-878.172) (-878.244) [-874.334] -- 0:00:45
234000 -- (-877.521) (-881.224) [-876.751] (-875.810) * (-875.200) (-879.623) (-878.476) [-875.745] -- 0:00:45
234500 -- (-876.892) [-880.371] (-876.079) (-879.395) * [-874.852] (-876.810) (-879.782) (-874.951) -- 0:00:45
235000 -- (-875.554) [-875.762] (-877.222) (-877.125) * (-876.377) (-882.325) (-874.349) [-876.815] -- 0:00:45
Average standard deviation of split frequencies: 0.014870
235500 -- (-877.224) (-875.607) [-874.679] (-876.187) * [-878.338] (-882.497) (-877.048) (-877.421) -- 0:00:45
236000 -- (-875.471) (-875.920) (-876.469) [-875.093] * (-878.663) (-878.802) (-875.589) [-876.558] -- 0:00:45
236500 -- (-876.258) [-877.001] (-876.255) (-878.769) * (-875.624) (-876.132) (-877.992) [-875.740] -- 0:00:45
237000 -- (-879.013) [-878.056] (-876.531) (-875.783) * (-875.876) [-874.784] (-878.275) (-874.843) -- 0:00:48
237500 -- [-877.369] (-876.428) (-875.062) (-877.658) * (-880.316) [-874.781] (-876.565) (-874.967) -- 0:00:48
238000 -- (-878.906) (-875.696) [-873.755] (-878.246) * (-881.276) (-874.875) [-875.889] (-874.196) -- 0:00:48
238500 -- (-875.899) [-875.839] (-875.623) (-876.073) * (-878.051) (-875.172) (-874.577) [-874.959] -- 0:00:47
239000 -- [-877.154] (-874.463) (-875.346) (-874.904) * (-876.661) [-877.548] (-878.252) (-878.610) -- 0:00:47
239500 -- (-876.507) (-873.762) [-876.915] (-878.752) * (-875.695) [-875.644] (-880.151) (-876.818) -- 0:00:47
240000 -- (-875.615) [-873.823] (-873.922) (-874.914) * (-881.895) (-875.495) [-875.998] (-876.087) -- 0:00:47
Average standard deviation of split frequencies: 0.015017
240500 -- (-875.824) [-875.016] (-877.067) (-876.172) * (-880.150) (-875.748) (-876.819) [-875.172] -- 0:00:47
241000 -- (-877.216) (-875.046) (-873.905) [-874.961] * (-881.134) [-877.525] (-876.294) (-875.996) -- 0:00:47
241500 -- [-875.802] (-875.696) (-876.765) (-874.544) * (-875.199) (-877.609) [-875.104] (-877.822) -- 0:00:47
242000 -- (-879.078) (-877.655) (-875.963) [-878.019] * [-876.080] (-876.114) (-876.925) (-875.872) -- 0:00:46
242500 -- [-877.274] (-875.905) (-877.100) (-876.423) * (-874.695) (-875.140) (-880.544) [-874.350] -- 0:00:46
243000 -- [-875.391] (-878.993) (-877.322) (-877.082) * (-874.892) (-875.447) [-880.064] (-874.431) -- 0:00:46
243500 -- (-878.612) (-877.148) [-876.119] (-874.926) * (-876.095) [-876.935] (-874.610) (-876.424) -- 0:00:46
244000 -- [-876.714] (-875.498) (-878.054) (-875.956) * (-875.122) [-878.215] (-876.371) (-875.374) -- 0:00:46
244500 -- (-875.538) [-873.915] (-882.056) (-874.399) * (-876.671) [-876.317] (-876.889) (-873.951) -- 0:00:46
245000 -- (-878.579) (-874.171) [-877.761] (-876.758) * (-878.362) [-874.833] (-874.100) (-875.758) -- 0:00:46
Average standard deviation of split frequencies: 0.015330
245500 -- (-878.355) [-879.773] (-875.657) (-873.922) * (-878.386) (-875.237) [-876.040] (-874.989) -- 0:00:46
246000 -- (-873.997) (-876.992) (-875.291) [-873.774] * (-880.196) (-879.416) (-879.114) [-875.950] -- 0:00:45
246500 -- [-874.711] (-875.064) (-879.036) (-874.980) * [-879.142] (-878.976) (-877.018) (-876.278) -- 0:00:45
247000 -- (-874.630) [-875.729] (-878.346) (-878.540) * (-882.583) (-874.991) (-877.973) [-874.662] -- 0:00:45
247500 -- (-874.751) (-875.261) [-877.291] (-874.707) * (-876.433) (-876.123) [-874.725] (-874.584) -- 0:00:45
248000 -- (-877.140) [-875.892] (-877.230) (-878.377) * (-879.581) (-875.997) (-874.665) [-874.710] -- 0:00:45
248500 -- (-878.135) (-874.918) (-881.329) [-873.890] * [-874.544] (-876.894) (-876.789) (-876.508) -- 0:00:45
249000 -- (-875.008) (-875.312) [-875.994] (-878.649) * (-876.952) [-877.587] (-876.385) (-881.160) -- 0:00:45
249500 -- (-876.899) [-874.385] (-875.355) (-878.126) * (-875.802) (-875.542) (-877.519) [-875.479] -- 0:00:45
250000 -- [-875.053] (-874.764) (-877.482) (-876.093) * (-874.022) [-875.574] (-874.833) (-875.419) -- 0:00:45
Average standard deviation of split frequencies: 0.015377
250500 -- (-874.903) (-875.086) [-875.739] (-873.723) * (-877.354) (-875.911) [-874.735] (-876.959) -- 0:00:44
251000 -- (-873.884) (-875.104) (-878.859) [-874.196] * [-873.913] (-873.917) (-874.535) (-875.650) -- 0:00:44
251500 -- (-874.481) (-874.690) (-876.965) [-875.794] * (-874.538) [-876.178] (-877.041) (-877.184) -- 0:00:44
252000 -- (-873.846) [-877.693] (-875.426) (-874.321) * (-873.736) (-874.574) [-875.405] (-875.181) -- 0:00:44
252500 -- [-873.750] (-876.693) (-875.823) (-877.043) * [-875.818] (-875.379) (-880.514) (-873.972) -- 0:00:44
253000 -- (-875.786) (-875.560) [-874.764] (-874.922) * (-875.492) [-876.225] (-880.521) (-873.936) -- 0:00:44
253500 -- (-875.390) (-880.856) (-876.302) [-873.862] * (-874.211) (-877.772) (-876.245) [-877.684] -- 0:00:44
254000 -- (-875.105) [-875.493] (-881.873) (-873.658) * (-875.277) (-877.140) [-875.185] (-873.571) -- 0:00:46
254500 -- (-873.646) [-875.364] (-880.797) (-874.805) * (-875.247) (-874.276) [-874.488] (-874.940) -- 0:00:46
255000 -- (-878.067) (-878.367) (-878.965) [-874.593] * (-879.872) (-876.063) (-879.761) [-874.283] -- 0:00:46
Average standard deviation of split frequencies: 0.015056
255500 -- (-876.592) (-879.946) [-874.607] (-879.481) * (-879.069) (-874.141) (-877.514) [-874.326] -- 0:00:46
256000 -- (-874.792) (-879.412) [-876.142] (-876.111) * (-876.119) (-874.625) (-880.614) [-877.056] -- 0:00:46
256500 -- [-875.276] (-875.940) (-876.568) (-878.432) * [-877.948] (-873.708) (-874.566) (-875.651) -- 0:00:46
257000 -- (-877.277) (-875.325) (-879.027) [-875.106] * [-878.078] (-878.568) (-874.976) (-877.466) -- 0:00:46
257500 -- (-875.581) (-878.815) [-875.645] (-878.158) * (-875.198) [-874.478] (-873.925) (-874.912) -- 0:00:46
258000 -- (-877.753) (-878.388) [-877.506] (-875.327) * (-876.118) (-874.360) (-875.099) [-874.803] -- 0:00:46
258500 -- (-875.697) [-875.551] (-878.192) (-873.905) * (-879.339) (-877.875) [-876.305] (-876.207) -- 0:00:45
259000 -- (-874.365) (-879.606) [-876.070] (-875.084) * [-874.999] (-875.775) (-880.269) (-874.022) -- 0:00:45
259500 -- (-876.855) (-876.204) [-874.633] (-873.564) * (-874.527) (-875.261) (-876.625) [-873.697] -- 0:00:45
260000 -- (-876.833) (-876.563) (-874.989) [-875.495] * (-874.667) (-876.216) (-876.407) [-874.542] -- 0:00:45
Average standard deviation of split frequencies: 0.014468
260500 -- (-875.192) (-877.666) [-874.708] (-874.269) * (-877.345) (-876.826) (-874.202) [-873.394] -- 0:00:45
261000 -- (-875.348) [-874.245] (-877.405) (-874.027) * (-874.571) [-874.287] (-873.853) (-876.196) -- 0:00:45
261500 -- (-874.671) (-874.520) [-875.023] (-875.144) * (-873.780) [-874.354] (-874.301) (-877.349) -- 0:00:45
262000 -- (-875.961) (-874.598) (-874.085) [-874.880] * (-873.738) (-876.802) [-875.002] (-876.862) -- 0:00:45
262500 -- (-874.664) [-874.931] (-874.776) (-875.014) * (-875.912) (-876.212) [-878.886] (-876.895) -- 0:00:44
263000 -- (-875.286) (-877.459) [-875.155] (-875.682) * [-874.696] (-878.596) (-878.256) (-874.667) -- 0:00:44
263500 -- (-874.228) (-876.128) [-876.122] (-876.133) * [-874.937] (-876.586) (-874.398) (-875.240) -- 0:00:44
264000 -- (-873.735) (-879.748) (-878.046) [-876.023] * (-880.556) (-874.532) (-875.034) [-874.552] -- 0:00:44
264500 -- [-873.770] (-880.637) (-874.223) (-877.665) * (-875.491) (-874.644) [-873.990] (-876.365) -- 0:00:44
265000 -- (-875.211) (-876.627) (-875.347) [-873.784] * (-876.638) (-880.713) (-879.189) [-874.295] -- 0:00:44
Average standard deviation of split frequencies: 0.013656
265500 -- (-877.361) [-875.495] (-874.724) (-874.855) * (-877.408) (-874.498) [-874.344] (-873.850) -- 0:00:44
266000 -- [-877.473] (-875.063) (-874.307) (-875.868) * (-875.784) (-874.860) (-874.834) [-875.389] -- 0:00:44
266500 -- (-878.094) (-874.909) (-874.935) [-875.065] * (-877.228) (-875.831) [-877.315] (-876.848) -- 0:00:44
267000 -- (-878.515) (-873.771) (-874.666) [-879.760] * [-878.903] (-877.002) (-874.007) (-875.673) -- 0:00:43
267500 -- (-879.579) (-873.985) [-874.172] (-875.396) * [-880.814] (-875.319) (-876.671) (-880.535) -- 0:00:43
268000 -- (-876.002) [-875.166] (-876.484) (-875.301) * (-876.809) (-877.962) (-877.929) [-875.901] -- 0:00:43
268500 -- [-877.438] (-874.567) (-876.034) (-874.628) * [-877.945] (-877.006) (-878.098) (-874.075) -- 0:00:43
269000 -- (-875.876) [-874.741] (-875.605) (-875.724) * (-877.939) (-879.209) (-876.527) [-875.983] -- 0:00:43
269500 -- (-875.704) (-874.741) (-876.647) [-873.977] * (-874.011) [-875.951] (-875.882) (-878.937) -- 0:00:43
270000 -- (-875.478) (-873.957) (-875.486) [-874.131] * (-874.735) [-875.263] (-877.944) (-875.991) -- 0:00:43
Average standard deviation of split frequencies: 0.014650
270500 -- [-874.707] (-874.184) (-876.589) (-874.438) * (-874.899) (-874.841) [-875.989] (-874.955) -- 0:00:45
271000 -- [-877.266] (-874.453) (-876.762) (-874.477) * (-876.468) (-873.727) [-876.826] (-875.252) -- 0:00:45
271500 -- (-876.289) [-875.281] (-876.413) (-874.277) * (-877.589) [-874.353] (-876.677) (-874.054) -- 0:00:45
272000 -- (-878.432) (-875.640) [-874.597] (-874.173) * (-876.728) (-874.213) [-876.550] (-876.069) -- 0:00:45
272500 -- [-878.141] (-875.539) (-878.233) (-875.970) * (-877.429) (-875.365) (-877.794) [-877.371] -- 0:00:45
273000 -- (-877.709) (-876.387) (-875.079) [-875.153] * (-876.232) (-874.133) [-875.579] (-875.726) -- 0:00:45
273500 -- (-883.434) (-876.112) [-874.120] (-876.846) * (-875.637) (-875.729) (-874.843) [-874.278] -- 0:00:45
274000 -- (-876.207) (-880.309) [-873.996] (-875.221) * (-880.695) [-874.081] (-876.445) (-877.036) -- 0:00:45
274500 -- (-875.485) (-875.038) [-875.959] (-875.933) * (-875.657) (-873.711) [-877.693] (-876.294) -- 0:00:44
275000 -- [-876.331] (-875.630) (-880.108) (-877.977) * (-877.241) (-873.959) [-877.699] (-876.007) -- 0:00:44
Average standard deviation of split frequencies: 0.013262
275500 -- (-879.382) (-874.277) [-875.132] (-880.883) * (-876.646) [-874.155] (-876.721) (-875.845) -- 0:00:44
276000 -- [-877.222] (-876.956) (-878.036) (-875.523) * (-875.573) [-877.365] (-874.909) (-875.323) -- 0:00:44
276500 -- (-877.745) (-876.170) (-875.771) [-874.776] * (-874.373) (-879.874) (-876.176) [-886.021] -- 0:00:44
277000 -- (-877.297) (-881.876) [-876.165] (-874.779) * (-876.681) [-873.679] (-875.994) (-877.030) -- 0:00:44
277500 -- [-874.939] (-876.818) (-875.213) (-877.786) * [-876.386] (-873.716) (-875.147) (-877.720) -- 0:00:44
278000 -- (-876.102) (-877.764) [-873.829] (-876.772) * (-874.347) [-875.978] (-874.773) (-874.623) -- 0:00:44
278500 -- (-875.488) (-879.797) [-874.303] (-874.826) * (-875.355) (-873.649) [-875.469] (-881.945) -- 0:00:44
279000 -- (-875.599) (-879.238) [-875.037] (-875.221) * (-875.216) [-875.538] (-873.812) (-878.489) -- 0:00:43
279500 -- (-874.273) [-874.458] (-874.162) (-878.024) * [-878.687] (-874.575) (-874.526) (-876.909) -- 0:00:43
280000 -- (-874.385) [-875.402] (-873.713) (-878.643) * (-876.922) (-876.840) [-877.824] (-877.792) -- 0:00:43
Average standard deviation of split frequencies: 0.012350
280500 -- [-876.371] (-875.156) (-874.881) (-885.271) * [-874.780] (-876.994) (-875.819) (-876.272) -- 0:00:43
281000 -- [-875.300] (-875.143) (-874.612) (-879.455) * (-874.711) [-876.012] (-879.990) (-876.900) -- 0:00:43
281500 -- (-874.144) [-879.157] (-876.972) (-875.804) * [-874.619] (-878.033) (-879.996) (-875.985) -- 0:00:43
282000 -- (-876.631) [-877.463] (-878.527) (-877.263) * [-876.660] (-874.525) (-873.962) (-876.763) -- 0:00:43
282500 -- (-878.012) (-875.583) (-877.236) [-877.522] * (-877.818) (-875.396) (-876.989) [-875.692] -- 0:00:43
283000 -- (-874.284) (-876.597) [-879.750] (-878.261) * (-876.391) (-876.126) (-874.718) [-873.335] -- 0:00:43
283500 -- [-877.467] (-877.887) (-873.573) (-876.758) * [-874.707] (-875.416) (-876.403) (-874.119) -- 0:00:42
284000 -- (-874.936) (-877.765) (-873.807) [-875.384] * (-876.228) (-874.342) [-876.950] (-874.931) -- 0:00:42
284500 -- (-874.126) (-876.875) [-873.864] (-874.153) * (-876.621) [-875.561] (-880.272) (-874.993) -- 0:00:42
285000 -- (-875.251) (-873.633) [-875.737] (-877.883) * (-878.068) [-874.949] (-875.273) (-876.767) -- 0:00:42
Average standard deviation of split frequencies: 0.011926
285500 -- (-874.649) (-874.807) [-876.295] (-874.253) * (-875.833) [-876.334] (-877.421) (-877.759) -- 0:00:42
286000 -- [-875.127] (-877.555) (-878.138) (-874.679) * (-877.695) [-874.351] (-876.115) (-875.626) -- 0:00:42
286500 -- (-876.090) (-877.324) [-875.687] (-875.893) * (-876.216) (-873.997) (-876.310) [-874.222] -- 0:00:42
287000 -- (-880.076) (-876.193) (-878.105) [-875.306] * (-875.632) (-880.692) (-875.306) [-874.840] -- 0:00:42
287500 -- [-877.363] (-876.215) (-875.937) (-876.962) * (-876.664) (-877.580) (-873.440) [-875.418] -- 0:00:44
288000 -- [-876.847] (-875.165) (-875.227) (-877.745) * (-877.378) (-874.695) (-875.145) [-876.399] -- 0:00:44
288500 -- (-873.840) (-874.627) [-874.807] (-874.578) * (-878.113) [-878.065] (-875.553) (-878.088) -- 0:00:44
289000 -- [-874.837] (-876.698) (-878.089) (-874.623) * [-874.631] (-876.830) (-875.628) (-874.414) -- 0:00:44
289500 -- (-874.195) (-874.267) (-883.028) [-875.689] * (-875.563) (-875.640) [-876.579] (-874.266) -- 0:00:44
290000 -- (-874.914) (-877.952) (-878.402) [-874.347] * [-875.408] (-876.471) (-876.884) (-876.198) -- 0:00:44
Average standard deviation of split frequencies: 0.012307
290500 -- (-877.588) (-875.379) [-874.400] (-873.734) * (-877.500) (-874.973) (-878.223) [-873.943] -- 0:00:43
291000 -- (-876.085) (-874.806) (-877.107) [-875.996] * [-876.703] (-876.887) (-875.870) (-877.491) -- 0:00:43
291500 -- [-874.513] (-875.176) (-874.184) (-875.065) * [-875.710] (-874.738) (-876.426) (-874.140) -- 0:00:43
292000 -- (-876.200) (-876.627) (-874.356) [-876.167] * (-874.480) (-875.477) [-874.433] (-874.935) -- 0:00:43
292500 -- [-873.910] (-875.644) (-875.781) (-874.686) * [-874.571] (-877.489) (-874.828) (-876.270) -- 0:00:43
293000 -- [-874.034] (-887.268) (-876.418) (-874.618) * [-874.788] (-877.214) (-878.620) (-879.685) -- 0:00:43
293500 -- (-876.123) [-874.124] (-876.070) (-873.547) * [-875.205] (-877.460) (-877.995) (-874.574) -- 0:00:43
294000 -- (-875.862) [-877.622] (-874.151) (-875.842) * (-874.883) [-875.794] (-875.991) (-874.049) -- 0:00:43
294500 -- (-876.533) (-876.051) [-877.321] (-875.673) * (-874.104) (-874.082) [-879.208] (-873.909) -- 0:00:43
295000 -- (-875.185) [-874.737] (-877.339) (-874.397) * (-876.288) (-877.369) [-879.535] (-874.165) -- 0:00:43
Average standard deviation of split frequencies: 0.011898
295500 -- (-876.693) (-873.916) (-877.242) [-875.947] * [-876.834] (-877.171) (-874.784) (-874.112) -- 0:00:42
296000 -- (-879.836) [-875.708] (-875.802) (-875.151) * (-877.521) (-877.377) [-875.673] (-877.342) -- 0:00:42
296500 -- (-876.393) (-874.012) [-876.373] (-881.753) * (-875.821) (-877.734) [-875.400] (-876.123) -- 0:00:42
297000 -- [-874.719] (-875.448) (-874.397) (-879.558) * (-875.670) (-875.475) (-875.556) [-875.250] -- 0:00:42
297500 -- (-875.349) (-875.468) [-874.837] (-874.051) * (-874.405) [-875.950] (-877.444) (-875.996) -- 0:00:42
298000 -- (-876.405) (-875.085) (-879.548) [-876.970] * [-874.680] (-877.235) (-876.040) (-874.716) -- 0:00:42
298500 -- (-874.868) [-874.981] (-874.176) (-879.645) * [-874.716] (-874.762) (-876.861) (-874.548) -- 0:00:42
299000 -- (-877.276) (-873.687) [-874.749] (-878.869) * (-874.854) (-875.362) [-874.836] (-875.159) -- 0:00:42
299500 -- [-876.389] (-875.910) (-875.575) (-873.790) * (-874.129) (-876.734) (-875.437) [-881.744] -- 0:00:42
300000 -- (-878.524) (-877.064) [-875.575] (-879.040) * (-874.456) (-874.144) (-875.173) [-874.318] -- 0:00:42
Average standard deviation of split frequencies: 0.012451
300500 -- (-876.768) [-875.764] (-874.856) (-875.598) * [-874.634] (-878.482) (-874.157) (-876.318) -- 0:00:41
301000 -- [-875.985] (-879.480) (-873.783) (-874.706) * [-878.229] (-874.541) (-875.643) (-878.547) -- 0:00:41
301500 -- [-876.607] (-881.140) (-876.608) (-875.596) * (-874.925) (-874.681) [-875.023] (-877.997) -- 0:00:41
302000 -- (-879.412) [-874.264] (-877.378) (-878.362) * (-874.735) (-874.767) [-877.012] (-874.439) -- 0:00:41
302500 -- (-874.030) (-877.681) [-876.322] (-877.383) * [-873.452] (-876.764) (-874.997) (-875.413) -- 0:00:41
303000 -- (-878.225) [-879.620] (-875.363) (-876.040) * (-881.028) (-875.596) (-878.277) [-875.514] -- 0:00:41
303500 -- (-874.675) (-877.673) (-876.209) [-874.366] * (-875.991) (-874.722) (-879.369) [-876.717] -- 0:00:41
304000 -- (-873.896) [-877.449] (-882.782) (-877.153) * (-873.560) [-875.439] (-875.215) (-873.995) -- 0:00:41
304500 -- (-873.528) [-877.889] (-879.161) (-876.070) * [-874.376] (-874.311) (-875.390) (-873.988) -- 0:00:43
305000 -- [-875.686] (-875.271) (-874.890) (-874.797) * [-875.677] (-877.175) (-876.986) (-873.664) -- 0:00:43
Average standard deviation of split frequencies: 0.012506
305500 -- (-878.930) (-876.935) (-875.193) [-874.602] * (-875.930) (-874.404) [-878.049] (-873.614) -- 0:00:43
306000 -- (-879.481) (-876.635) (-874.861) [-874.623] * (-876.640) [-875.333] (-876.748) (-874.481) -- 0:00:43
306500 -- [-874.625] (-877.777) (-874.015) (-874.963) * (-878.413) (-875.366) [-873.728] (-876.497) -- 0:00:42
307000 -- (-875.694) [-878.333] (-874.514) (-876.792) * [-875.352] (-879.852) (-873.728) (-878.490) -- 0:00:42
307500 -- [-875.321] (-875.994) (-878.717) (-875.550) * (-875.903) (-879.973) (-873.861) [-878.271] -- 0:00:42
308000 -- (-875.246) (-877.904) (-876.621) [-877.924] * (-881.419) (-878.720) (-875.763) [-875.886] -- 0:00:42
308500 -- (-873.458) (-876.685) (-876.293) [-877.791] * [-874.764] (-878.265) (-876.521) (-879.976) -- 0:00:42
309000 -- (-873.661) (-880.425) (-875.692) [-876.259] * (-875.779) [-873.877] (-879.114) (-875.457) -- 0:00:42
309500 -- (-874.056) (-875.445) [-873.624] (-875.771) * [-874.561] (-873.681) (-879.745) (-875.865) -- 0:00:42
310000 -- (-874.061) [-874.902] (-876.549) (-875.414) * (-874.109) (-874.609) [-876.432] (-875.532) -- 0:00:42
Average standard deviation of split frequencies: 0.012585
310500 -- (-875.300) (-879.620) (-875.706) [-875.236] * (-873.988) (-875.553) [-876.127] (-873.863) -- 0:00:42
311000 -- [-875.320] (-879.659) (-879.211) (-874.645) * (-875.801) (-874.273) [-877.792] (-873.816) -- 0:00:42
311500 -- (-877.944) (-881.853) [-875.579] (-873.641) * [-874.241] (-877.157) (-875.389) (-876.976) -- 0:00:41
312000 -- [-877.306] (-880.989) (-873.460) (-874.724) * (-875.067) [-876.091] (-876.050) (-876.659) -- 0:00:41
312500 -- (-878.415) [-876.610] (-873.576) (-873.532) * [-873.596] (-876.856) (-885.139) (-876.861) -- 0:00:41
313000 -- (-880.679) (-882.465) (-874.567) [-874.324] * [-874.411] (-881.601) (-882.499) (-876.499) -- 0:00:41
313500 -- (-878.438) [-874.488] (-874.567) (-876.827) * (-874.472) (-874.956) (-876.059) [-876.777] -- 0:00:41
314000 -- [-877.341] (-874.449) (-874.953) (-875.484) * (-874.144) (-873.998) [-875.101] (-876.044) -- 0:00:41
314500 -- (-876.727) [-874.605] (-874.799) (-877.712) * (-878.080) (-874.219) [-880.432] (-877.639) -- 0:00:41
315000 -- (-874.315) (-874.726) [-874.782] (-875.269) * (-878.352) (-875.965) (-881.613) [-874.048] -- 0:00:41
Average standard deviation of split frequencies: 0.012100
315500 -- (-875.486) (-875.324) (-879.785) [-877.779] * (-874.640) (-879.178) (-879.883) [-873.657] -- 0:00:41
316000 -- (-875.568) (-877.521) (-875.921) [-875.108] * (-876.138) (-875.093) (-876.021) [-873.737] -- 0:00:41
316500 -- (-874.573) (-873.664) (-879.378) [-875.143] * (-875.073) (-874.003) (-876.468) [-874.429] -- 0:00:41
317000 -- (-874.660) (-878.241) (-874.974) [-874.354] * (-879.485) (-876.262) (-876.264) [-878.254] -- 0:00:40
317500 -- (-874.254) (-876.651) (-877.296) [-873.966] * (-875.478) [-876.698] (-874.892) (-876.317) -- 0:00:40
318000 -- (-875.948) (-875.681) (-877.523) [-873.585] * [-874.989] (-875.668) (-874.071) (-876.362) -- 0:00:40
318500 -- (-876.534) (-874.494) (-874.827) [-874.735] * (-874.909) (-874.649) (-874.443) [-879.848] -- 0:00:40
319000 -- (-880.079) (-876.627) (-877.153) [-879.992] * (-875.592) [-875.160] (-876.553) (-880.017) -- 0:00:40
319500 -- [-880.953] (-875.983) (-876.666) (-874.860) * (-873.947) (-878.467) [-875.700] (-876.294) -- 0:00:40
320000 -- (-876.935) (-874.680) [-873.455] (-876.683) * (-875.684) (-876.232) (-876.565) [-878.174] -- 0:00:40
Average standard deviation of split frequencies: 0.012366
320500 -- (-876.269) (-874.397) (-876.854) [-875.085] * [-877.800] (-877.846) (-874.434) (-874.948) -- 0:00:40
321000 -- (-877.840) (-876.711) (-875.060) [-874.681] * (-879.816) (-876.313) [-875.169] (-877.035) -- 0:00:40
321500 -- (-878.682) (-879.409) [-874.054] (-874.260) * [-874.337] (-875.098) (-873.963) (-874.078) -- 0:00:42
322000 -- (-874.629) [-877.338] (-874.679) (-878.850) * (-879.630) [-875.023] (-875.856) (-874.001) -- 0:00:42
322500 -- (-874.715) [-876.947] (-874.753) (-879.199) * [-874.337] (-876.855) (-879.095) (-876.681) -- 0:00:42
323000 -- (-879.304) [-874.959] (-877.491) (-877.915) * (-874.818) [-875.608] (-879.918) (-878.465) -- 0:00:41
323500 -- [-877.321] (-877.511) (-873.569) (-874.890) * (-876.036) [-874.160] (-876.734) (-874.458) -- 0:00:41
324000 -- (-876.408) (-877.995) [-873.945] (-877.741) * (-874.065) (-874.281) (-877.072) [-875.783] -- 0:00:41
324500 -- [-876.584] (-874.230) (-877.389) (-876.563) * [-874.220] (-880.638) (-876.513) (-876.333) -- 0:00:41
325000 -- (-874.632) (-873.340) [-876.986] (-876.195) * (-879.708) (-875.816) (-875.432) [-874.510] -- 0:00:41
Average standard deviation of split frequencies: 0.011823
325500 -- (-875.124) [-875.299] (-875.038) (-875.035) * (-877.863) [-875.350] (-873.534) (-879.588) -- 0:00:41
326000 -- [-875.538] (-874.540) (-874.368) (-877.802) * (-877.293) (-876.977) [-873.534] (-877.844) -- 0:00:41
326500 -- (-876.048) (-876.371) (-874.587) [-874.448] * (-875.682) [-873.790] (-875.063) (-875.465) -- 0:00:41
327000 -- (-877.672) (-877.650) (-874.107) [-873.682] * [-874.690] (-875.151) (-874.660) (-875.546) -- 0:00:41
327500 -- (-875.267) [-879.854] (-874.492) (-877.289) * (-874.981) [-876.378] (-874.360) (-878.384) -- 0:00:41
328000 -- (-877.144) (-879.217) (-876.376) [-881.386] * (-876.667) (-875.641) (-876.681) [-874.807] -- 0:00:40
328500 -- (-876.664) (-875.468) [-874.244] (-879.388) * (-874.819) (-877.350) [-875.545] (-875.559) -- 0:00:40
329000 -- (-882.323) [-876.999] (-876.500) (-874.167) * (-874.158) (-879.592) [-874.750] (-876.255) -- 0:00:40
329500 -- [-878.785] (-876.649) (-879.469) (-874.211) * (-876.671) [-876.218] (-874.745) (-880.315) -- 0:00:40
330000 -- (-875.225) (-874.455) (-876.253) [-875.469] * [-874.068] (-874.416) (-874.909) (-878.074) -- 0:00:40
Average standard deviation of split frequencies: 0.011824
330500 -- [-874.366] (-879.458) (-873.570) (-875.816) * (-880.070) (-876.020) [-875.475] (-877.846) -- 0:00:40
331000 -- (-875.139) (-877.591) [-876.791] (-876.351) * (-875.356) [-876.070] (-874.668) (-878.064) -- 0:00:40
331500 -- (-876.054) (-876.093) [-876.379] (-876.267) * [-877.455] (-875.808) (-875.319) (-877.949) -- 0:00:40
332000 -- (-880.516) (-876.314) [-875.175] (-875.641) * (-879.884) [-876.514] (-874.625) (-875.826) -- 0:00:40
332500 -- (-875.011) (-876.588) (-876.689) [-877.000] * (-875.937) [-876.329] (-875.505) (-875.688) -- 0:00:40
333000 -- (-874.669) [-876.590] (-874.751) (-877.500) * (-876.879) [-874.740] (-875.979) (-874.299) -- 0:00:40
333500 -- (-874.971) (-882.844) [-874.340] (-876.132) * [-873.794] (-878.814) (-877.372) (-873.625) -- 0:00:39
334000 -- (-874.530) [-880.916] (-881.231) (-875.744) * (-877.514) (-877.515) (-874.758) [-874.264] -- 0:00:39
334500 -- [-874.606] (-878.403) (-879.413) (-879.877) * (-876.809) (-875.123) [-873.750] (-876.064) -- 0:00:39
335000 -- (-875.899) [-876.631] (-876.076) (-884.885) * [-874.367] (-875.926) (-874.931) (-874.345) -- 0:00:39
Average standard deviation of split frequencies: 0.012297
335500 -- [-876.796] (-874.333) (-878.344) (-875.063) * (-880.024) [-875.438] (-879.068) (-873.917) -- 0:00:39
336000 -- (-877.976) (-874.229) [-878.871] (-875.332) * (-877.670) (-876.032) (-874.816) [-874.759] -- 0:00:39
336500 -- (-877.239) (-875.612) (-876.365) [-877.380] * (-875.810) [-876.998] (-874.931) (-875.291) -- 0:00:39
337000 -- [-875.582] (-879.661) (-876.356) (-875.619) * [-875.078] (-877.534) (-875.423) (-875.603) -- 0:00:39
337500 -- [-875.234] (-881.180) (-877.558) (-877.008) * (-876.691) [-875.492] (-876.056) (-873.785) -- 0:00:39
338000 -- [-877.667] (-875.922) (-877.457) (-877.886) * (-877.662) (-875.251) [-874.085] (-876.970) -- 0:00:39
338500 -- (-878.797) [-874.790] (-876.386) (-876.448) * (-875.936) (-874.755) (-877.716) [-874.166] -- 0:00:41
339000 -- (-873.809) (-875.176) (-875.116) [-875.405] * (-874.807) (-876.777) (-877.074) [-877.744] -- 0:00:40
339500 -- (-873.684) [-878.154] (-876.348) (-876.907) * (-876.416) (-876.072) (-875.445) [-877.846] -- 0:00:40
340000 -- (-876.085) [-876.483] (-875.187) (-876.319) * (-874.327) (-874.921) [-874.724] (-877.250) -- 0:00:40
Average standard deviation of split frequencies: 0.012210
340500 -- (-878.906) [-875.883] (-874.642) (-877.082) * (-874.676) [-875.522] (-878.830) (-876.873) -- 0:00:40
341000 -- (-875.823) [-876.247] (-874.893) (-878.254) * (-874.522) (-874.672) [-875.681] (-881.756) -- 0:00:40
341500 -- (-879.024) [-875.230] (-876.051) (-877.015) * (-873.723) (-879.319) (-873.691) [-874.534] -- 0:00:40
342000 -- [-874.041] (-876.832) (-877.281) (-877.047) * (-874.636) [-875.023] (-875.318) (-875.173) -- 0:00:40
342500 -- [-875.247] (-875.896) (-877.545) (-875.536) * [-878.438] (-877.208) (-874.357) (-875.111) -- 0:00:40
343000 -- (-876.090) (-878.979) (-874.999) [-875.225] * (-875.557) (-874.463) (-879.700) [-875.666] -- 0:00:40
343500 -- (-879.362) (-877.293) [-875.185] (-877.792) * (-874.236) [-874.709] (-876.430) (-875.924) -- 0:00:40
344000 -- (-875.686) (-876.871) (-875.388) [-876.707] * (-881.415) (-874.493) [-876.779] (-876.665) -- 0:00:40
344500 -- [-875.304] (-879.848) (-874.249) (-876.617) * (-876.970) (-875.057) [-874.780] (-877.234) -- 0:00:39
345000 -- (-877.149) [-876.670] (-874.933) (-880.601) * [-875.364] (-877.395) (-875.092) (-876.982) -- 0:00:39
Average standard deviation of split frequencies: 0.012422
345500 -- (-876.075) (-881.272) (-874.292) [-879.452] * [-875.851] (-876.606) (-873.424) (-874.997) -- 0:00:39
346000 -- [-874.726] (-879.708) (-874.357) (-875.182) * (-879.051) [-878.342] (-873.743) (-873.803) -- 0:00:39
346500 -- (-878.175) (-874.881) [-874.367] (-876.767) * (-876.544) [-874.699] (-875.496) (-875.736) -- 0:00:39
347000 -- (-874.070) [-873.893] (-874.794) (-878.867) * [-875.939] (-878.908) (-874.300) (-876.708) -- 0:00:39
347500 -- (-875.033) (-875.989) (-874.724) [-875.566] * [-874.690] (-878.020) (-874.715) (-874.579) -- 0:00:39
348000 -- (-873.686) (-876.472) [-874.878] (-875.546) * (-873.857) (-878.050) [-876.020] (-875.605) -- 0:00:39
348500 -- (-877.816) (-879.461) (-880.473) [-875.905] * [-874.835] (-878.034) (-878.750) (-873.914) -- 0:00:39
349000 -- (-875.789) (-877.875) [-874.359] (-874.175) * (-877.587) (-879.493) [-874.721] (-874.845) -- 0:00:39
349500 -- (-876.079) (-875.439) [-873.922] (-874.812) * (-874.183) (-878.054) [-876.123] (-874.414) -- 0:00:39
350000 -- (-877.526) (-875.129) [-874.022] (-879.432) * (-875.722) [-878.153] (-879.222) (-877.198) -- 0:00:39
Average standard deviation of split frequencies: 0.012336
350500 -- (-876.757) [-874.967] (-880.794) (-876.966) * (-877.776) (-875.197) [-877.248] (-878.154) -- 0:00:38
351000 -- (-875.210) (-880.323) (-876.332) [-874.788] * [-875.668] (-875.129) (-877.761) (-879.369) -- 0:00:38
351500 -- (-878.387) [-874.601] (-873.918) (-878.397) * (-875.788) (-878.103) (-873.881) [-876.648] -- 0:00:38
352000 -- (-876.828) [-875.031] (-873.809) (-878.403) * (-878.325) (-876.209) [-876.874] (-876.082) -- 0:00:38
352500 -- (-876.804) (-875.576) (-875.473) [-876.294] * (-873.746) [-875.978] (-876.165) (-876.617) -- 0:00:38
353000 -- (-875.977) (-877.988) [-874.162] (-876.419) * (-875.567) (-875.585) [-876.407] (-875.405) -- 0:00:38
353500 -- (-874.155) (-876.235) [-876.235] (-877.132) * (-876.144) (-874.789) [-878.472] (-876.657) -- 0:00:38
354000 -- (-877.478) [-879.635] (-876.906) (-877.091) * [-874.379] (-876.670) (-876.188) (-877.298) -- 0:00:38
354500 -- (-875.229) [-875.335] (-875.252) (-875.507) * [-875.663] (-877.990) (-874.797) (-874.348) -- 0:00:38
355000 -- (-875.420) (-875.178) (-874.818) [-875.780] * (-874.634) (-875.408) (-877.115) [-874.558] -- 0:00:38
Average standard deviation of split frequencies: 0.011762
355500 -- [-875.401] (-876.921) (-874.099) (-874.323) * (-876.295) (-874.365) [-876.072] (-873.711) -- 0:00:39
356000 -- [-876.519] (-877.945) (-873.713) (-874.974) * [-874.704] (-876.487) (-876.395) (-875.953) -- 0:00:39
356500 -- [-875.706] (-874.875) (-873.936) (-875.416) * (-876.188) (-878.063) [-877.868] (-876.323) -- 0:00:39
357000 -- (-875.370) (-875.677) [-875.338] (-875.531) * [-877.497] (-879.154) (-877.590) (-877.317) -- 0:00:39
357500 -- (-876.153) (-876.025) (-874.593) [-874.278] * (-875.170) (-879.028) (-876.098) [-876.747] -- 0:00:39
358000 -- (-877.768) [-874.065] (-879.389) (-875.689) * [-874.565] (-880.413) (-874.815) (-876.002) -- 0:00:39
358500 -- (-874.676) (-873.948) (-875.859) [-875.428] * (-878.750) (-878.010) [-873.448] (-877.571) -- 0:00:39
359000 -- (-874.616) (-876.004) [-875.199] (-876.086) * (-879.841) (-874.226) [-874.180] (-877.554) -- 0:00:39
359500 -- (-873.959) (-877.186) (-874.384) [-875.104] * (-876.402) [-873.600] (-876.576) (-874.485) -- 0:00:39
360000 -- (-874.064) (-878.410) [-874.382] (-877.977) * (-877.097) [-876.305] (-874.965) (-877.096) -- 0:00:39
Average standard deviation of split frequencies: 0.010918
360500 -- (-875.715) (-880.778) [-874.182] (-876.895) * (-878.551) (-875.815) [-875.688] (-877.330) -- 0:00:39
361000 -- (-876.169) [-874.639] (-875.335) (-877.312) * (-877.751) (-876.276) (-877.382) [-880.853] -- 0:00:38
361500 -- [-875.969] (-876.485) (-874.011) (-875.725) * (-878.589) (-877.092) [-874.943] (-874.350) -- 0:00:38
362000 -- (-878.143) [-877.218] (-873.788) (-874.868) * (-876.660) (-877.676) [-875.481] (-876.729) -- 0:00:38
362500 -- (-876.586) [-876.915] (-873.766) (-875.745) * [-875.610] (-876.544) (-874.982) (-875.673) -- 0:00:38
363000 -- (-875.040) (-876.520) (-875.741) [-877.292] * [-874.033] (-875.968) (-874.307) (-875.073) -- 0:00:38
363500 -- (-875.211) (-875.918) (-874.837) [-877.183] * [-874.073] (-875.247) (-874.928) (-873.919) -- 0:00:38
364000 -- (-876.710) (-874.652) (-879.066) [-875.919] * (-873.911) (-873.847) [-874.896] (-874.630) -- 0:00:38
364500 -- (-874.766) [-875.345] (-875.223) (-876.412) * (-880.002) [-874.216] (-874.017) (-874.824) -- 0:00:38
365000 -- (-876.125) (-875.684) (-874.562) [-877.024] * (-876.150) (-875.605) [-875.774] (-875.929) -- 0:00:38
Average standard deviation of split frequencies: 0.010455
365500 -- [-875.451] (-879.178) (-875.579) (-874.553) * (-877.995) (-874.291) [-877.311] (-877.825) -- 0:00:38
366000 -- (-874.936) [-875.866] (-878.388) (-875.437) * (-877.435) (-876.492) (-876.360) [-877.381] -- 0:00:38
366500 -- (-874.406) (-875.826) [-874.712] (-874.577) * (-875.672) [-875.285] (-878.794) (-876.831) -- 0:00:38
367000 -- (-874.942) (-878.860) (-878.608) [-874.324] * (-875.561) (-874.389) [-875.430] (-875.321) -- 0:00:37
367500 -- (-880.005) (-875.920) [-875.433] (-874.160) * (-878.043) (-874.423) (-874.004) [-873.814] -- 0:00:37
368000 -- (-878.231) (-874.439) (-880.619) [-873.766] * (-876.316) [-874.611] (-874.614) (-874.186) -- 0:00:37
368500 -- (-874.565) (-875.968) [-874.632] (-875.940) * (-876.367) (-873.680) (-874.402) [-874.645] -- 0:00:37
369000 -- (-879.104) (-874.930) (-875.223) [-876.171] * (-876.771) (-875.867) [-876.783] (-874.201) -- 0:00:37
369500 -- (-876.129) [-876.524] (-874.947) (-876.187) * [-878.781] (-874.398) (-875.029) (-876.911) -- 0:00:37
370000 -- (-877.919) (-875.836) [-876.801] (-879.976) * (-877.111) (-875.660) [-878.538] (-876.283) -- 0:00:37
Average standard deviation of split frequencies: 0.010249
370500 -- (-877.920) (-874.716) [-873.587] (-873.793) * (-876.747) (-877.221) (-878.991) [-875.664] -- 0:00:37
371000 -- (-874.085) (-877.886) (-877.117) [-875.283] * [-875.024] (-874.445) (-876.964) (-876.595) -- 0:00:37
371500 -- (-875.771) (-875.614) (-877.554) [-876.561] * (-874.069) (-877.929) (-876.794) [-876.729] -- 0:00:37
372000 -- (-874.481) (-876.444) (-877.019) [-877.570] * (-874.175) (-876.262) [-874.030] (-874.051) -- 0:00:38
372500 -- (-880.003) [-874.351] (-875.415) (-876.900) * (-876.733) (-874.208) (-875.747) [-875.833] -- 0:00:38
373000 -- (-876.669) (-875.101) (-875.775) [-879.485] * (-875.648) [-874.838] (-875.795) (-874.724) -- 0:00:38
373500 -- [-874.941] (-873.647) (-877.153) (-874.372) * (-878.799) (-875.073) [-877.239] (-877.252) -- 0:00:38
374000 -- (-874.616) [-873.525] (-875.697) (-874.707) * (-876.862) (-877.881) [-877.901] (-878.873) -- 0:00:38
374500 -- (-875.045) [-876.478] (-875.605) (-875.604) * (-878.302) (-875.642) [-876.141] (-873.567) -- 0:00:38
375000 -- (-874.394) (-874.063) (-874.952) [-874.785] * (-874.399) (-875.654) (-876.218) [-874.671] -- 0:00:38
Average standard deviation of split frequencies: 0.009882
375500 -- [-875.189] (-875.575) (-874.310) (-875.837) * (-875.217) (-874.533) (-876.220) [-873.851] -- 0:00:38
376000 -- [-874.466] (-874.894) (-876.761) (-875.065) * (-873.573) (-873.818) (-880.712) [-873.905] -- 0:00:38
376500 -- (-877.396) (-877.093) (-875.343) [-874.243] * (-873.645) (-874.124) [-874.590] (-874.720) -- 0:00:38
377000 -- (-875.495) (-876.086) (-874.005) [-874.254] * (-874.667) (-874.777) [-873.729] (-875.945) -- 0:00:38
377500 -- (-874.576) (-879.028) [-873.769] (-875.364) * (-873.404) (-876.601) (-876.039) [-875.831] -- 0:00:37
378000 -- (-875.624) [-877.664] (-875.955) (-877.469) * (-873.857) (-877.980) (-875.342) [-877.359] -- 0:00:37
378500 -- (-875.523) (-881.916) (-875.939) [-877.550] * (-875.058) (-878.100) [-873.574] (-880.251) -- 0:00:37
379000 -- (-879.191) (-877.109) [-876.297] (-877.711) * (-874.649) [-878.167] (-877.238) (-875.422) -- 0:00:37
379500 -- (-877.467) (-875.778) [-873.825] (-875.463) * [-873.597] (-875.171) (-873.646) (-875.799) -- 0:00:37
380000 -- (-874.462) (-876.582) (-876.003) [-874.666] * (-874.475) [-875.409] (-878.889) (-873.736) -- 0:00:37
Average standard deviation of split frequencies: 0.011072
380500 -- (-877.869) [-874.272] (-874.663) (-875.496) * [-876.511] (-875.131) (-875.829) (-874.503) -- 0:00:37
381000 -- [-874.511] (-875.455) (-875.236) (-879.742) * (-876.572) [-876.135] (-874.781) (-878.683) -- 0:00:37
381500 -- [-879.530] (-874.807) (-873.915) (-874.607) * (-874.014) [-878.923] (-875.237) (-875.043) -- 0:00:37
382000 -- (-876.572) (-877.559) [-875.608] (-880.181) * [-873.710] (-874.418) (-876.231) (-876.363) -- 0:00:37
382500 -- (-877.227) (-876.924) [-874.621] (-878.709) * (-875.557) (-873.991) (-877.716) [-877.768] -- 0:00:37
383000 -- (-874.390) [-875.719] (-878.122) (-875.158) * (-878.549) (-879.537) [-879.430] (-879.842) -- 0:00:37
383500 -- (-876.806) (-876.591) (-874.937) [-877.306] * (-875.708) [-877.952] (-878.871) (-879.259) -- 0:00:36
384000 -- (-882.459) (-876.377) [-875.163] (-875.652) * (-876.049) (-877.962) (-882.461) [-876.061] -- 0:00:36
384500 -- (-877.513) (-875.097) [-874.322] (-879.463) * (-874.789) [-876.238] (-877.112) (-880.869) -- 0:00:36
385000 -- (-873.540) (-876.644) [-874.827] (-876.750) * [-875.021] (-876.687) (-874.943) (-873.946) -- 0:00:36
Average standard deviation of split frequencies: 0.011494
385500 -- [-875.525] (-877.697) (-875.921) (-877.752) * [-875.179] (-880.674) (-874.784) (-874.029) -- 0:00:36
386000 -- (-873.754) [-874.756] (-877.257) (-874.768) * (-875.713) (-878.661) (-877.840) [-877.469] -- 0:00:36
386500 -- (-873.668) (-874.863) [-876.041] (-878.731) * (-875.684) [-874.875] (-874.915) (-875.011) -- 0:00:36
387000 -- [-874.294] (-874.524) (-875.035) (-876.938) * (-875.876) (-876.827) [-875.986] (-874.377) -- 0:00:36
387500 -- (-875.494) (-878.007) (-879.189) [-874.782] * (-874.681) (-875.915) [-875.851] (-875.029) -- 0:00:36
388000 -- [-874.739] (-874.629) (-880.156) (-876.658) * [-874.460] (-874.354) (-877.500) (-874.102) -- 0:00:36
388500 -- (-874.368) [-877.868] (-874.243) (-875.001) * (-874.679) (-874.289) [-875.975] (-876.545) -- 0:00:36
389000 -- (-874.338) [-876.384] (-874.483) (-876.142) * [-874.340] (-874.980) (-875.392) (-874.739) -- 0:00:37
389500 -- (-878.581) (-875.413) [-874.389] (-879.606) * (-875.226) [-875.324] (-875.635) (-875.244) -- 0:00:37
390000 -- (-874.522) (-878.041) (-880.189) [-873.849] * (-875.704) (-876.488) (-875.837) [-875.156] -- 0:00:37
Average standard deviation of split frequencies: 0.011765
390500 -- (-873.912) (-874.579) [-875.192] (-875.170) * [-875.569] (-877.478) (-875.416) (-878.748) -- 0:00:37
391000 -- [-876.021] (-874.128) (-874.184) (-874.307) * [-875.702] (-874.486) (-875.414) (-874.281) -- 0:00:37
391500 -- (-873.388) (-875.625) [-876.891] (-877.264) * (-874.205) [-874.478] (-876.286) (-875.309) -- 0:00:37
392000 -- (-875.334) (-874.506) (-875.133) [-873.888] * [-874.478] (-874.802) (-874.620) (-877.318) -- 0:00:37
392500 -- (-875.903) [-874.346] (-874.138) (-874.295) * (-877.537) (-876.188) [-876.383] (-875.424) -- 0:00:37
393000 -- (-875.867) [-876.402] (-873.415) (-874.787) * (-875.614) (-875.522) (-877.286) [-874.517] -- 0:00:37
393500 -- (-875.522) [-879.461] (-874.818) (-875.150) * (-878.361) [-875.796] (-874.889) (-874.788) -- 0:00:36
394000 -- (-875.488) [-874.571] (-873.833) (-875.096) * (-878.190) [-875.958] (-874.048) (-875.609) -- 0:00:36
394500 -- [-878.001] (-874.630) (-877.785) (-874.019) * (-879.147) (-876.006) (-875.461) [-875.670] -- 0:00:36
395000 -- [-876.637] (-876.136) (-876.124) (-876.183) * [-879.352] (-876.112) (-873.906) (-876.751) -- 0:00:36
Average standard deviation of split frequencies: 0.011160
395500 -- (-875.445) (-880.129) (-876.427) [-876.421] * (-876.708) [-875.984] (-875.485) (-876.543) -- 0:00:36
396000 -- (-877.879) (-879.593) [-875.479] (-875.545) * (-878.668) [-876.808] (-875.333) (-877.534) -- 0:00:36
396500 -- [-878.798] (-880.750) (-875.234) (-874.771) * [-876.907] (-876.880) (-876.840) (-877.348) -- 0:00:36
397000 -- (-881.529) (-878.852) [-873.959] (-874.920) * (-875.606) (-875.286) [-874.545] (-875.141) -- 0:00:36
397500 -- (-874.870) (-874.588) (-875.985) [-876.873] * (-875.005) [-874.237] (-874.512) (-876.136) -- 0:00:36
398000 -- [-876.695] (-874.369) (-875.477) (-877.463) * [-875.200] (-876.869) (-877.421) (-877.019) -- 0:00:36
398500 -- (-875.229) (-874.049) (-876.690) [-877.720] * [-875.636] (-878.334) (-880.096) (-875.730) -- 0:00:36
399000 -- (-875.108) [-875.181] (-879.534) (-874.821) * [-874.274] (-881.844) (-877.114) (-876.040) -- 0:00:36
399500 -- (-875.409) [-874.979] (-880.888) (-875.771) * (-874.765) (-874.761) (-877.301) [-873.888] -- 0:00:36
400000 -- (-876.129) [-879.314] (-873.975) (-876.423) * [-876.001] (-876.231) (-876.459) (-876.298) -- 0:00:36
Average standard deviation of split frequencies: 0.011030
400500 -- (-878.839) (-878.297) (-874.791) [-874.425] * [-878.835] (-876.249) (-880.390) (-877.512) -- 0:00:35
401000 -- (-874.590) (-874.132) [-879.071] (-877.027) * [-877.858] (-875.072) (-879.045) (-877.177) -- 0:00:35
401500 -- [-874.898] (-879.828) (-880.830) (-876.371) * [-875.798] (-875.822) (-877.179) (-873.867) -- 0:00:35
402000 -- [-874.890] (-874.835) (-877.108) (-876.237) * (-874.180) (-875.077) [-874.381] (-878.051) -- 0:00:35
402500 -- [-875.721] (-874.926) (-878.924) (-878.867) * (-876.038) [-875.305] (-874.327) (-876.248) -- 0:00:35
403000 -- (-875.232) (-875.184) (-877.322) [-875.922] * (-874.494) (-873.701) [-874.643] (-877.543) -- 0:00:35
403500 -- [-875.871] (-877.168) (-878.044) (-876.059) * [-874.447] (-874.853) (-875.915) (-878.173) -- 0:00:35
404000 -- (-877.624) (-878.516) (-876.498) [-874.525] * [-874.757] (-876.046) (-873.645) (-876.433) -- 0:00:35
404500 -- (-876.249) (-877.833) (-876.066) [-874.817] * (-874.684) (-877.763) (-875.543) [-875.170] -- 0:00:35
405000 -- (-876.763) (-874.072) (-874.304) [-875.003] * [-875.824] (-879.371) (-877.364) (-875.176) -- 0:00:35
Average standard deviation of split frequencies: 0.011466
405500 -- (-876.261) (-878.376) (-875.002) [-876.986] * (-877.235) (-880.365) (-878.191) [-873.602] -- 0:00:36
406000 -- [-875.540] (-876.416) (-877.097) (-878.046) * [-876.132] (-875.023) (-876.425) (-877.945) -- 0:00:36
406500 -- (-875.337) (-874.111) [-876.406] (-875.104) * (-874.618) (-874.018) [-874.606] (-879.335) -- 0:00:36
407000 -- (-875.063) [-876.472] (-874.174) (-875.596) * (-874.999) (-874.743) [-874.376] (-875.645) -- 0:00:36
407500 -- (-876.495) (-877.006) (-876.006) [-875.249] * (-877.915) [-873.733] (-874.907) (-877.472) -- 0:00:36
408000 -- (-875.214) (-876.734) [-876.154] (-875.989) * (-875.207) (-877.331) [-874.733] (-875.428) -- 0:00:36
408500 -- (-878.037) (-876.639) (-876.744) [-876.402] * (-875.581) [-875.866] (-875.789) (-878.124) -- 0:00:36
409000 -- (-876.640) [-875.506] (-875.688) (-876.989) * (-874.245) (-874.881) [-874.708] (-879.086) -- 0:00:36
409500 -- (-881.839) [-875.733] (-882.769) (-876.537) * (-875.991) (-876.477) [-877.257] (-877.787) -- 0:00:36
410000 -- (-875.433) [-878.183] (-877.190) (-875.727) * (-874.065) [-877.302] (-874.132) (-878.782) -- 0:00:35
Average standard deviation of split frequencies: 0.011479
410500 -- (-876.716) (-876.750) (-876.371) [-874.360] * (-874.907) (-876.426) (-874.925) [-878.164] -- 0:00:35
411000 -- (-877.020) [-880.472] (-876.823) (-879.493) * (-875.582) (-878.647) (-874.001) [-878.351] -- 0:00:35
411500 -- (-876.308) [-880.474] (-875.901) (-876.966) * (-878.514) (-875.140) (-873.730) [-875.592] -- 0:00:35
412000 -- (-877.769) [-879.259] (-874.461) (-874.615) * [-881.619] (-874.591) (-873.667) (-876.460) -- 0:00:35
412500 -- [-879.778] (-883.057) (-874.089) (-877.342) * (-876.479) [-876.507] (-875.060) (-876.411) -- 0:00:35
413000 -- (-877.084) (-875.379) (-876.970) [-875.832] * (-876.300) (-874.718) [-874.266] (-875.951) -- 0:00:35
413500 -- (-876.160) (-875.630) [-873.714] (-874.798) * (-875.821) [-875.105] (-874.511) (-875.288) -- 0:00:35
414000 -- (-875.030) [-873.967] (-873.761) (-875.086) * (-874.836) (-875.690) (-874.513) [-874.409] -- 0:00:35
414500 -- (-874.381) (-875.744) [-875.348] (-874.989) * (-875.763) [-875.544] (-874.297) (-874.328) -- 0:00:35
415000 -- (-874.438) (-877.128) [-881.602] (-873.638) * [-873.902] (-876.616) (-875.358) (-875.202) -- 0:00:35
Average standard deviation of split frequencies: 0.011686
415500 -- (-874.789) (-876.059) (-877.790) [-874.263] * (-876.899) (-876.147) (-877.526) [-877.531] -- 0:00:35
416000 -- (-875.690) (-874.367) [-874.754] (-875.233) * (-875.103) (-876.946) (-879.882) [-878.375] -- 0:00:35
416500 -- [-874.520] (-876.350) (-876.516) (-878.309) * (-878.899) (-877.813) (-880.284) [-878.480] -- 0:00:35
417000 -- (-875.582) (-876.484) (-877.744) [-876.721] * (-874.020) (-876.361) (-877.736) [-875.454] -- 0:00:34
417500 -- (-876.547) (-877.339) [-875.839] (-875.791) * (-874.257) [-875.447] (-874.421) (-874.800) -- 0:00:34
418000 -- (-878.154) (-876.445) (-876.171) [-875.138] * [-877.661] (-877.986) (-874.185) (-878.498) -- 0:00:34
418500 -- (-878.287) [-879.826] (-874.711) (-881.100) * [-875.914] (-878.886) (-875.560) (-878.191) -- 0:00:34
419000 -- (-877.302) [-877.496] (-877.392) (-875.613) * (-875.342) (-874.931) [-875.236] (-874.748) -- 0:00:34
419500 -- [-876.555] (-875.305) (-874.651) (-873.832) * (-874.546) (-876.843) (-873.780) [-874.711] -- 0:00:34
420000 -- (-877.561) (-876.768) [-875.493] (-875.369) * (-875.045) [-876.763] (-877.862) (-876.575) -- 0:00:34
Average standard deviation of split frequencies: 0.010506
420500 -- [-873.670] (-877.043) (-881.232) (-873.742) * (-877.992) [-875.722] (-875.994) (-873.730) -- 0:00:34
421000 -- [-874.359] (-877.448) (-876.954) (-874.956) * (-877.080) (-873.745) [-874.570] (-874.669) -- 0:00:34
421500 -- (-882.933) (-874.840) [-876.629] (-876.656) * [-875.071] (-874.595) (-873.990) (-877.021) -- 0:00:34
422000 -- (-876.738) [-874.438] (-875.917) (-874.486) * (-876.798) (-874.866) [-874.338] (-880.112) -- 0:00:35
422500 -- (-875.938) [-875.063] (-879.901) (-874.925) * [-876.046] (-877.210) (-877.422) (-878.767) -- 0:00:35
423000 -- [-876.879] (-874.117) (-875.294) (-877.674) * (-876.386) (-874.530) (-875.277) [-876.506] -- 0:00:35
423500 -- (-875.340) (-876.469) [-875.239] (-875.447) * (-874.842) [-874.140] (-875.784) (-878.607) -- 0:00:35
424000 -- (-875.001) (-879.387) [-876.269] (-879.163) * (-875.854) (-876.234) (-876.250) [-875.151] -- 0:00:35
424500 -- [-876.607] (-878.655) (-876.709) (-874.830) * (-875.070) [-875.507] (-876.424) (-878.377) -- 0:00:35
425000 -- (-878.070) (-875.866) (-876.440) [-875.210] * (-879.324) [-874.436] (-874.047) (-874.373) -- 0:00:35
Average standard deviation of split frequencies: 0.010089
425500 -- (-874.718) (-875.249) [-875.194] (-874.217) * (-879.416) [-874.078] (-879.778) (-875.314) -- 0:00:35
426000 -- (-874.692) (-876.399) [-875.632] (-881.867) * (-877.560) [-874.712] (-877.264) (-874.405) -- 0:00:35
426500 -- (-874.610) (-877.205) [-873.537] (-879.417) * (-877.405) (-881.793) [-875.427] (-874.125) -- 0:00:34
427000 -- (-874.929) (-876.245) [-874.951] (-875.347) * (-875.350) (-876.754) (-874.406) [-876.030] -- 0:00:34
427500 -- [-874.078] (-876.508) (-874.258) (-875.314) * (-877.353) (-875.823) (-875.855) [-875.121] -- 0:00:34
428000 -- (-874.121) (-874.549) [-876.046] (-877.864) * (-875.424) (-874.838) (-876.459) [-876.648] -- 0:00:34
428500 -- (-874.353) (-877.000) [-875.321] (-874.801) * (-877.367) (-875.042) [-873.708] (-874.097) -- 0:00:34
429000 -- (-878.734) (-879.874) [-878.546] (-875.590) * (-875.541) [-876.038] (-873.995) (-875.563) -- 0:00:34
429500 -- (-879.761) (-877.004) (-874.593) [-875.783] * [-875.160] (-876.622) (-875.196) (-875.874) -- 0:00:34
430000 -- [-876.296] (-875.088) (-874.134) (-876.631) * [-876.574] (-877.250) (-876.139) (-883.892) -- 0:00:34
Average standard deviation of split frequencies: 0.010431
430500 -- (-876.381) (-876.480) [-874.715] (-877.968) * (-875.865) [-876.579] (-874.723) (-875.444) -- 0:00:34
431000 -- (-875.310) (-875.507) [-874.320] (-879.684) * (-879.189) [-879.298] (-873.722) (-876.817) -- 0:00:34
431500 -- (-875.734) (-875.544) [-876.531] (-881.932) * (-882.938) [-878.751] (-874.481) (-874.018) -- 0:00:34
432000 -- [-874.981] (-873.491) (-874.622) (-875.852) * (-877.593) (-874.118) (-875.111) [-874.544] -- 0:00:34
432500 -- (-875.016) (-873.608) [-875.726] (-877.687) * (-877.116) (-875.418) (-875.948) [-874.311] -- 0:00:34
433000 -- (-874.228) [-873.732] (-874.666) (-875.870) * [-875.273] (-874.822) (-873.786) (-875.021) -- 0:00:34
433500 -- (-873.854) [-874.756] (-874.663) (-877.434) * (-875.168) [-876.143] (-875.696) (-877.008) -- 0:00:33
434000 -- (-874.810) (-874.388) [-879.405] (-875.769) * (-876.890) [-876.161] (-875.140) (-875.633) -- 0:00:33
434500 -- (-876.234) (-874.830) (-879.306) [-876.006] * [-875.127] (-877.672) (-876.693) (-880.021) -- 0:00:33
435000 -- (-876.941) [-874.056] (-878.362) (-878.649) * [-875.824] (-874.083) (-874.031) (-874.926) -- 0:00:33
Average standard deviation of split frequencies: 0.010001
435500 -- [-875.552] (-878.346) (-878.146) (-876.268) * (-874.342) [-875.391] (-873.679) (-877.105) -- 0:00:33
436000 -- [-875.429] (-875.918) (-875.290) (-877.144) * (-875.187) (-875.227) [-874.239] (-876.179) -- 0:00:33
436500 -- [-882.115] (-875.253) (-874.987) (-875.358) * (-874.841) [-874.851] (-880.114) (-874.911) -- 0:00:33
437000 -- (-877.469) (-874.181) [-875.123] (-875.896) * (-875.939) (-877.688) [-877.082] (-874.550) -- 0:00:33
437500 -- (-873.914) (-873.808) (-875.641) [-874.949] * (-879.525) (-876.357) [-875.062] (-877.094) -- 0:00:33
438000 -- (-874.234) (-873.428) (-875.292) [-879.005] * (-881.666) (-878.759) (-875.320) [-875.741] -- 0:00:33
438500 -- (-875.354) [-874.439] (-876.476) (-874.718) * (-878.051) (-878.108) [-876.274] (-874.172) -- 0:00:34
439000 -- (-875.861) (-874.521) (-875.052) [-875.002] * (-875.303) (-877.833) (-875.155) [-873.388] -- 0:00:34
439500 -- (-875.889) (-876.217) [-873.904] (-876.010) * (-875.303) (-877.163) [-875.552] (-873.696) -- 0:00:34
440000 -- (-876.633) (-875.578) [-875.882] (-876.314) * (-876.048) (-876.368) (-876.350) [-874.279] -- 0:00:34
Average standard deviation of split frequencies: 0.009942
440500 -- (-875.563) (-875.564) [-876.330] (-874.345) * (-880.431) [-874.830] (-876.316) (-876.590) -- 0:00:34
441000 -- [-875.116] (-875.040) (-876.638) (-874.088) * (-876.783) (-874.718) (-877.091) [-875.183] -- 0:00:34
441500 -- [-874.469] (-874.814) (-878.252) (-883.801) * [-875.363] (-874.403) (-875.693) (-875.386) -- 0:00:34
442000 -- (-875.813) [-875.193] (-878.148) (-879.121) * [-874.229] (-874.160) (-875.050) (-875.224) -- 0:00:34
442500 -- (-877.263) [-875.945] (-878.836) (-877.105) * (-874.546) [-877.063] (-878.503) (-874.804) -- 0:00:34
443000 -- (-876.214) (-875.954) (-879.824) [-876.900] * [-878.238] (-877.296) (-878.653) (-874.490) -- 0:00:33
443500 -- (-876.939) (-875.093) (-879.885) [-875.533] * (-875.807) (-874.470) [-874.714] (-873.694) -- 0:00:33
444000 -- [-875.055] (-875.710) (-877.820) (-873.780) * (-877.731) (-874.924) [-875.044] (-875.300) -- 0:00:33
444500 -- (-877.963) (-873.948) [-875.345] (-874.456) * (-873.587) [-874.989] (-876.788) (-873.967) -- 0:00:33
445000 -- (-875.938) (-876.064) [-876.450] (-875.647) * (-874.079) [-875.949] (-877.624) (-875.573) -- 0:00:33
Average standard deviation of split frequencies: 0.009571
445500 -- (-875.996) (-874.834) (-874.383) [-875.500] * (-875.378) (-875.884) [-876.803] (-876.008) -- 0:00:33
446000 -- (-881.860) (-874.556) [-874.972] (-878.447) * [-875.134] (-876.630) (-879.280) (-876.312) -- 0:00:33
446500 -- (-879.730) [-874.525] (-876.226) (-876.329) * (-873.941) (-875.579) [-874.956] (-875.963) -- 0:00:33
447000 -- [-879.446] (-875.837) (-874.950) (-876.885) * (-874.115) (-874.402) [-875.407] (-875.460) -- 0:00:33
447500 -- [-874.923] (-875.214) (-877.797) (-880.717) * [-873.766] (-876.585) (-878.368) (-874.821) -- 0:00:33
448000 -- [-873.846] (-874.174) (-875.709) (-876.734) * [-877.618] (-877.388) (-877.393) (-875.481) -- 0:00:33
448500 -- [-875.254] (-878.409) (-876.210) (-875.448) * (-876.075) (-876.194) (-877.421) [-874.262] -- 0:00:33
449000 -- (-876.925) (-878.091) [-875.049] (-876.238) * (-875.508) (-877.272) [-875.865] (-876.644) -- 0:00:33
449500 -- (-878.095) (-877.035) (-877.029) [-877.880] * (-879.422) [-876.036] (-878.280) (-875.066) -- 0:00:33
450000 -- [-874.905] (-875.730) (-879.812) (-875.675) * (-874.053) (-877.449) [-877.282] (-876.935) -- 0:00:33
Average standard deviation of split frequencies: 0.009906
450500 -- (-878.318) (-876.090) [-878.605] (-875.282) * (-874.486) [-875.550] (-876.680) (-875.179) -- 0:00:32
451000 -- (-875.215) (-874.747) [-877.851] (-878.429) * (-876.588) (-874.212) [-875.520] (-878.807) -- 0:00:32
451500 -- (-877.685) (-876.876) [-875.796] (-876.198) * (-876.334) (-876.438) (-877.669) [-874.214] -- 0:00:32
452000 -- [-873.778] (-876.779) (-874.726) (-879.425) * (-875.921) (-878.297) (-876.261) [-874.322] -- 0:00:32
452500 -- [-873.447] (-878.777) (-875.400) (-874.388) * (-877.991) (-876.337) [-874.711] (-874.941) -- 0:00:32
453000 -- (-873.853) [-877.079] (-877.160) (-877.225) * (-880.239) (-875.796) [-874.986] (-875.274) -- 0:00:32
453500 -- [-874.675] (-877.093) (-878.559) (-879.884) * (-878.348) [-882.666] (-877.514) (-877.397) -- 0:00:32
454000 -- (-877.582) (-875.881) (-875.710) [-877.875] * (-876.689) [-877.931] (-876.023) (-878.771) -- 0:00:32
454500 -- [-875.962] (-879.148) (-876.659) (-877.003) * (-878.051) [-878.067] (-875.461) (-873.757) -- 0:00:32
455000 -- (-877.250) (-875.621) (-877.260) [-876.164] * (-876.486) (-878.338) (-874.593) [-874.802] -- 0:00:32
Average standard deviation of split frequencies: 0.010095
455500 -- [-877.436] (-876.191) (-877.322) (-876.032) * [-878.607] (-877.297) (-877.367) (-874.817) -- 0:00:33
456000 -- (-876.625) (-876.375) (-874.553) [-876.274] * (-877.986) [-876.321] (-876.536) (-876.649) -- 0:00:33
456500 -- (-874.042) (-876.814) [-875.551] (-877.613) * (-873.696) (-875.903) (-875.814) [-875.112] -- 0:00:33
457000 -- (-874.060) (-878.111) (-874.580) [-874.544] * (-873.697) (-874.003) [-874.281] (-876.434) -- 0:00:33
457500 -- (-875.095) (-875.024) [-876.511] (-878.921) * [-874.325] (-875.790) (-875.474) (-874.534) -- 0:00:33
458000 -- [-875.224] (-874.538) (-877.079) (-879.420) * (-877.752) (-876.637) [-873.887] (-876.771) -- 0:00:33
458500 -- [-873.707] (-874.164) (-875.668) (-875.365) * (-877.809) (-875.921) (-874.025) [-875.185] -- 0:00:33
459000 -- (-875.012) (-877.463) [-874.778] (-874.217) * (-875.817) (-875.379) [-879.121] (-876.314) -- 0:00:33
459500 -- (-875.173) (-874.248) (-875.438) [-873.690] * (-874.469) (-877.646) (-875.985) [-876.241] -- 0:00:32
460000 -- (-873.812) [-874.139] (-875.500) (-874.494) * (-874.180) [-873.507] (-877.942) (-877.333) -- 0:00:32
Average standard deviation of split frequencies: 0.010041
460500 -- [-875.454] (-873.498) (-875.282) (-875.019) * (-874.213) (-873.858) (-874.582) [-875.823] -- 0:00:32
461000 -- (-878.789) (-874.837) (-873.635) [-875.259] * (-873.806) [-873.793] (-875.337) (-875.502) -- 0:00:32
461500 -- [-877.066] (-876.274) (-873.635) (-875.842) * (-875.180) [-874.941] (-875.520) (-873.947) -- 0:00:32
462000 -- (-877.210) [-874.251] (-874.122) (-876.298) * [-875.011] (-876.914) (-875.052) (-873.626) -- 0:00:32
462500 -- (-880.335) (-875.779) [-873.886] (-880.567) * (-880.400) [-875.093] (-878.577) (-874.581) -- 0:00:32
463000 -- (-876.509) [-877.341] (-877.815) (-874.809) * [-873.806] (-873.841) (-877.580) (-877.031) -- 0:00:32
463500 -- (-874.198) (-880.309) [-876.964] (-880.111) * (-876.616) [-875.378] (-875.044) (-874.988) -- 0:00:32
464000 -- (-874.111) (-874.261) (-877.376) [-874.109] * [-875.596] (-876.337) (-874.851) (-876.118) -- 0:00:32
464500 -- (-876.083) (-878.076) (-877.628) [-876.224] * [-875.348] (-874.708) (-875.013) (-875.183) -- 0:00:32
465000 -- (-876.063) [-877.121] (-877.782) (-873.741) * (-878.392) [-875.363] (-875.837) (-876.864) -- 0:00:32
Average standard deviation of split frequencies: 0.009164
465500 -- (-875.816) (-875.358) (-875.401) [-874.464] * [-875.723] (-875.594) (-874.815) (-875.260) -- 0:00:32
466000 -- [-874.239] (-879.730) (-874.419) (-879.057) * (-880.810) [-874.707] (-874.508) (-878.076) -- 0:00:32
466500 -- (-875.174) (-874.350) (-874.954) [-874.864] * (-880.377) [-877.791] (-874.691) (-878.784) -- 0:00:32
467000 -- (-877.595) (-876.978) (-875.677) [-877.767] * (-879.612) [-877.088] (-877.130) (-883.472) -- 0:00:31
467500 -- (-875.487) (-875.089) [-875.466] (-875.675) * (-879.149) (-878.009) (-877.196) [-877.351] -- 0:00:31
468000 -- (-875.686) (-875.140) [-875.840] (-874.433) * (-875.176) (-875.058) [-874.610] (-876.565) -- 0:00:31
468500 -- (-876.547) [-875.799] (-875.445) (-875.517) * [-873.896] (-875.058) (-873.792) (-877.119) -- 0:00:31
469000 -- (-875.467) (-875.150) [-875.623] (-876.570) * (-877.631) (-875.349) (-875.485) [-874.695] -- 0:00:31
469500 -- (-877.369) [-875.980] (-875.503) (-880.874) * (-874.440) (-874.783) (-875.882) [-878.301] -- 0:00:31
470000 -- (-878.020) [-877.911] (-878.082) (-881.211) * [-875.997] (-875.239) (-878.015) (-878.964) -- 0:00:31
Average standard deviation of split frequencies: 0.008792
470500 -- [-876.867] (-879.150) (-879.037) (-878.208) * (-873.674) (-874.169) (-873.344) [-874.740] -- 0:00:31
471000 -- (-878.125) (-874.253) [-876.241] (-874.255) * [-875.697] (-878.120) (-874.154) (-876.791) -- 0:00:31
471500 -- [-877.045] (-878.360) (-874.149) (-874.907) * (-874.829) [-876.678] (-875.568) (-875.791) -- 0:00:31
472000 -- [-875.242] (-875.920) (-876.604) (-876.334) * [-876.477] (-874.832) (-874.744) (-879.122) -- 0:00:32
472500 -- (-874.743) [-876.738] (-880.008) (-875.766) * [-874.698] (-874.278) (-880.057) (-879.257) -- 0:00:32
473000 -- (-875.455) (-875.729) [-875.729] (-875.233) * (-875.674) [-874.822] (-876.297) (-875.770) -- 0:00:32
473500 -- [-875.045] (-877.101) (-876.463) (-878.929) * (-875.334) [-874.737] (-874.753) (-880.602) -- 0:00:32
474000 -- (-880.504) [-874.454] (-875.469) (-879.117) * [-877.013] (-874.942) (-875.550) (-874.059) -- 0:00:32
474500 -- (-887.397) (-875.334) (-877.040) [-876.770] * (-876.368) (-875.319) [-874.062] (-875.259) -- 0:00:32
475000 -- (-877.671) (-876.021) [-875.674] (-874.976) * (-874.217) (-875.206) [-875.663] (-876.475) -- 0:00:32
Average standard deviation of split frequencies: 0.009298
475500 -- (-881.139) (-879.148) [-875.914] (-874.450) * (-877.932) (-874.031) [-874.587] (-875.898) -- 0:00:31
476000 -- (-874.599) (-874.315) [-875.866] (-877.042) * (-875.072) (-873.843) (-882.314) [-877.736] -- 0:00:31
476500 -- [-874.607] (-874.786) (-877.265) (-874.870) * [-875.701] (-875.302) (-878.031) (-877.940) -- 0:00:31
477000 -- (-876.595) (-877.862) (-874.370) [-874.477] * (-874.586) [-877.248] (-876.434) (-877.055) -- 0:00:31
477500 -- (-877.184) (-877.176) [-875.320] (-873.973) * [-874.877] (-880.065) (-873.841) (-874.643) -- 0:00:31
478000 -- [-877.281] (-876.706) (-876.236) (-875.605) * (-874.336) [-874.606] (-874.466) (-876.158) -- 0:00:31
478500 -- (-874.903) (-875.951) [-880.087] (-874.206) * [-873.625] (-875.390) (-875.231) (-878.524) -- 0:00:31
479000 -- (-876.848) (-875.514) (-876.032) [-875.208] * (-877.159) [-877.115] (-874.429) (-873.786) -- 0:00:31
479500 -- (-881.099) [-875.213] (-876.134) (-876.402) * [-878.898] (-880.691) (-874.101) (-875.551) -- 0:00:31
480000 -- (-876.411) (-875.499) [-874.331] (-874.326) * (-880.002) [-876.264] (-874.597) (-874.009) -- 0:00:31
Average standard deviation of split frequencies: 0.009634
480500 -- (-875.047) [-873.756] (-874.918) (-873.914) * (-879.622) [-874.563] (-874.607) (-874.138) -- 0:00:31
481000 -- (-877.215) (-875.872) [-874.807] (-878.131) * (-877.425) (-876.751) (-878.343) [-874.252] -- 0:00:31
481500 -- (-874.984) (-876.550) [-875.897] (-876.313) * (-876.086) (-874.684) (-875.027) [-874.109] -- 0:00:31
482000 -- (-874.053) (-874.162) (-874.880) [-876.083] * (-878.513) (-876.657) (-877.498) [-874.352] -- 0:00:31
482500 -- (-875.693) [-874.373] (-874.211) (-875.988) * (-876.182) [-876.750] (-876.696) (-874.035) -- 0:00:31
483000 -- (-879.398) (-874.056) (-875.200) [-874.868] * (-874.758) (-875.658) [-873.565] (-874.498) -- 0:00:31
483500 -- (-875.297) (-877.356) (-876.376) [-880.340] * [-874.191] (-875.189) (-875.257) (-875.911) -- 0:00:30
484000 -- [-876.178] (-878.252) (-876.372) (-876.736) * (-877.362) (-874.672) [-874.145] (-879.434) -- 0:00:30
484500 -- (-874.104) (-875.271) [-874.883] (-873.446) * (-875.012) (-874.171) [-874.920] (-876.075) -- 0:00:30
485000 -- (-874.020) (-874.329) (-875.089) [-875.524] * [-876.353] (-874.717) (-874.519) (-874.377) -- 0:00:30
Average standard deviation of split frequencies: 0.009985
485500 -- (-874.788) (-877.348) (-874.500) [-873.804] * [-875.663] (-874.644) (-875.161) (-875.098) -- 0:00:30
486000 -- (-874.610) [-876.212] (-876.294) (-874.257) * (-876.799) (-874.344) (-875.734) [-874.344] -- 0:00:31
486500 -- [-881.294] (-874.656) (-878.110) (-876.810) * (-874.958) (-878.546) [-875.467] (-874.690) -- 0:00:31
487000 -- (-875.127) [-873.628] (-876.511) (-876.647) * (-877.311) (-876.041) [-874.924] (-875.059) -- 0:00:31
487500 -- (-880.796) (-874.714) (-875.848) [-879.564] * (-874.437) (-876.375) (-875.720) [-874.857] -- 0:00:31
488000 -- (-877.105) (-876.587) [-873.667] (-882.167) * (-876.364) (-875.703) (-876.753) [-874.384] -- 0:00:31
488500 -- (-875.505) (-878.579) (-873.614) [-877.843] * (-879.661) (-874.381) (-877.698) [-879.376] -- 0:00:31
489000 -- (-876.260) (-875.002) (-875.259) [-876.322] * (-878.288) (-876.755) [-878.789] (-882.698) -- 0:00:31
489500 -- (-877.128) (-874.642) [-874.363] (-876.069) * (-873.656) [-875.955] (-876.713) (-877.682) -- 0:00:31
490000 -- (-874.152) (-874.947) [-875.893] (-875.110) * (-873.810) (-876.883) (-875.528) [-874.145] -- 0:00:31
Average standard deviation of split frequencies: 0.010173
490500 -- (-880.263) (-877.614) [-874.829] (-875.851) * [-876.018] (-877.807) (-876.747) (-873.771) -- 0:00:31
491000 -- (-873.769) [-874.831] (-878.372) (-874.706) * (-875.057) [-874.342] (-875.684) (-874.558) -- 0:00:31
491500 -- (-874.939) [-877.289] (-879.224) (-882.174) * (-875.544) (-875.482) (-878.413) [-874.603] -- 0:00:31
492000 -- (-874.968) (-878.645) (-874.986) [-873.700] * (-875.824) (-877.028) (-874.900) [-877.836] -- 0:00:30
492500 -- [-874.902] (-879.032) (-875.434) (-880.745) * (-874.838) (-874.391) [-876.129] (-876.436) -- 0:00:30
493000 -- (-876.272) [-875.458] (-873.890) (-878.406) * (-875.184) [-874.150] (-878.075) (-875.546) -- 0:00:30
493500 -- [-875.264] (-875.513) (-878.238) (-877.707) * [-874.951] (-875.511) (-876.475) (-875.698) -- 0:00:30
494000 -- (-874.297) [-875.415] (-879.625) (-876.994) * [-874.466] (-874.467) (-876.724) (-875.463) -- 0:00:30
494500 -- (-876.655) (-876.529) [-879.969] (-875.054) * (-877.685) (-875.553) [-874.225] (-876.187) -- 0:00:30
495000 -- (-875.951) [-875.585] (-877.957) (-875.789) * (-875.377) [-874.956] (-874.465) (-873.980) -- 0:00:30
Average standard deviation of split frequencies: 0.010566
495500 -- (-875.607) (-877.575) (-877.087) [-875.374] * (-878.102) [-874.963] (-875.037) (-874.950) -- 0:00:30
496000 -- (-879.526) [-877.049] (-880.022) (-874.255) * (-877.162) [-879.308] (-875.099) (-875.468) -- 0:00:30
496500 -- (-874.579) (-877.814) (-876.315) [-876.497] * (-879.420) (-874.869) [-875.147] (-875.606) -- 0:00:30
497000 -- (-875.184) [-876.589] (-877.067) (-875.222) * (-876.221) (-877.163) (-875.124) [-877.011] -- 0:00:30
497500 -- (-875.727) [-875.829] (-876.643) (-874.268) * (-873.803) (-875.119) (-874.209) [-875.699] -- 0:00:30
498000 -- [-874.232] (-875.696) (-875.149) (-876.157) * [-874.753] (-875.851) (-874.803) (-882.900) -- 0:00:30
498500 -- [-877.480] (-874.551) (-873.967) (-880.154) * (-876.879) (-873.942) [-874.855] (-873.697) -- 0:00:30
499000 -- [-875.131] (-878.297) (-874.212) (-874.750) * (-874.668) (-876.091) [-873.927] (-873.662) -- 0:00:30
499500 -- [-876.318] (-877.444) (-876.675) (-875.436) * (-876.321) (-874.702) (-874.799) [-874.476] -- 0:00:30
500000 -- (-875.890) (-874.002) (-874.746) [-875.781] * (-876.473) (-873.910) [-875.184] (-881.382) -- 0:00:30
Average standard deviation of split frequencies: 0.010080
500500 -- [-875.738] (-874.607) (-874.234) (-875.698) * (-875.980) (-876.252) (-876.147) [-873.815] -- 0:00:29
501000 -- (-877.871) (-878.950) [-876.268] (-875.778) * (-878.221) (-875.413) (-877.282) [-874.417] -- 0:00:29
501500 -- (-875.341) (-876.090) (-874.051) [-874.430] * (-882.189) (-877.346) (-876.700) [-874.089] -- 0:00:30
502000 -- [-874.707] (-875.602) (-874.396) (-874.613) * [-877.127] (-875.667) (-875.883) (-875.254) -- 0:00:30
502500 -- (-876.654) (-877.791) (-875.202) [-874.890] * (-883.519) [-878.273] (-876.202) (-877.048) -- 0:00:30
503000 -- (-880.307) [-876.445] (-875.816) (-874.225) * (-876.297) (-878.174) [-874.473] (-877.930) -- 0:00:30
503500 -- (-875.243) [-874.948] (-876.836) (-877.914) * [-875.144] (-876.402) (-875.725) (-876.766) -- 0:00:30
504000 -- [-874.725] (-878.898) (-875.407) (-875.263) * [-874.600] (-876.474) (-876.367) (-877.132) -- 0:00:30
504500 -- (-874.449) (-883.659) [-876.140] (-874.785) * [-875.684] (-879.868) (-877.855) (-879.962) -- 0:00:30
505000 -- (-875.681) (-877.391) [-876.449] (-874.388) * [-877.846] (-886.074) (-875.389) (-877.495) -- 0:00:30
Average standard deviation of split frequencies: 0.010303
505500 -- [-874.789] (-875.435) (-874.488) (-874.531) * (-874.743) [-876.008] (-876.468) (-876.771) -- 0:00:30
506000 -- (-874.817) (-874.822) (-877.681) [-875.201] * (-876.023) [-875.513] (-877.195) (-876.510) -- 0:00:30
506500 -- (-873.906) (-878.964) (-874.377) [-874.664] * (-875.371) (-877.312) [-875.057] (-880.953) -- 0:00:30
507000 -- (-875.904) [-875.116] (-875.313) (-874.628) * (-876.276) [-875.587] (-874.000) (-875.566) -- 0:00:30
507500 -- (-875.303) (-875.375) [-877.383] (-874.826) * (-875.299) (-877.373) [-873.435] (-880.340) -- 0:00:30
508000 -- (-874.047) (-874.376) (-876.889) [-874.638] * [-875.090] (-874.718) (-873.858) (-876.518) -- 0:00:30
508500 -- [-876.275] (-877.139) (-877.222) (-874.797) * (-876.139) [-876.419] (-874.809) (-880.716) -- 0:00:29
509000 -- (-875.745) (-882.426) [-875.546] (-874.531) * (-877.507) (-873.886) [-875.029] (-876.223) -- 0:00:29
509500 -- (-877.343) (-875.601) [-874.518] (-876.432) * (-873.800) (-873.883) (-877.045) [-876.346] -- 0:00:29
510000 -- [-877.133] (-878.045) (-875.081) (-875.211) * (-873.706) (-874.587) (-875.252) [-876.463] -- 0:00:29
Average standard deviation of split frequencies: 0.009666
510500 -- (-875.217) (-876.297) [-874.914] (-875.501) * (-876.153) [-874.054] (-874.574) (-876.124) -- 0:00:29
511000 -- (-876.720) (-876.022) [-875.684] (-876.006) * (-873.815) (-875.571) [-876.233] (-878.069) -- 0:00:29
511500 -- (-877.296) (-878.115) [-876.165] (-880.868) * [-874.552] (-875.576) (-874.237) (-876.159) -- 0:00:29
512000 -- (-877.699) (-878.509) [-874.794] (-877.451) * [-876.930] (-881.758) (-875.697) (-874.029) -- 0:00:29
512500 -- (-874.258) [-876.884] (-879.232) (-875.654) * (-877.426) (-874.944) [-875.576] (-874.323) -- 0:00:29
513000 -- (-876.066) (-874.682) (-874.549) [-876.242] * (-879.570) (-873.680) [-876.038] (-874.018) -- 0:00:29
513500 -- (-879.222) [-874.841] (-874.893) (-874.613) * [-875.769] (-877.615) (-877.926) (-876.250) -- 0:00:29
514000 -- [-874.380] (-873.620) (-875.486) (-875.675) * (-875.746) [-877.106] (-880.228) (-876.636) -- 0:00:29
514500 -- (-876.341) (-874.579) (-877.329) [-875.555] * (-875.746) [-878.204] (-877.068) (-876.811) -- 0:00:29
515000 -- (-875.305) (-873.640) [-874.734] (-874.242) * (-875.820) (-885.030) [-874.506] (-874.405) -- 0:00:29
Average standard deviation of split frequencies: 0.009535
515500 -- (-875.250) (-881.451) [-877.746] (-875.127) * [-879.651] (-878.423) (-878.779) (-881.418) -- 0:00:29
516000 -- [-874.416] (-877.221) (-875.409) (-875.332) * [-874.516] (-878.717) (-879.644) (-878.981) -- 0:00:29
516500 -- (-878.292) (-875.728) (-877.187) [-874.829] * (-875.586) (-876.694) (-877.011) [-877.686] -- 0:00:29
517000 -- (-876.111) (-875.342) [-875.689] (-874.635) * (-875.824) (-874.192) [-878.289] (-874.415) -- 0:00:28
517500 -- (-875.961) (-874.507) (-874.191) [-874.532] * [-876.145] (-876.287) (-876.036) (-873.979) -- 0:00:28
518000 -- (-874.942) (-875.431) [-876.364] (-873.736) * [-874.656] (-876.914) (-875.861) (-875.242) -- 0:00:28
518500 -- [-879.816] (-874.237) (-874.663) (-875.887) * [-876.862] (-874.694) (-875.363) (-873.813) -- 0:00:29
519000 -- (-876.684) (-878.363) [-874.408] (-880.836) * (-874.862) (-875.598) [-873.783] (-874.781) -- 0:00:29
519500 -- (-877.295) [-878.159] (-875.153) (-877.960) * (-874.293) (-876.770) [-876.058] (-874.421) -- 0:00:29
520000 -- [-875.694] (-876.955) (-878.207) (-876.572) * (-875.033) (-875.545) (-874.983) [-877.735] -- 0:00:29
Average standard deviation of split frequencies: 0.009235
520500 -- (-874.446) (-875.547) [-876.861] (-874.324) * [-874.234] (-873.603) (-877.627) (-875.593) -- 0:00:29
521000 -- [-873.917] (-879.525) (-877.545) (-873.975) * [-874.471] (-874.299) (-876.384) (-880.026) -- 0:00:29
521500 -- (-874.902) (-882.419) [-873.816] (-875.892) * (-874.397) (-875.364) [-874.611] (-878.571) -- 0:00:29
522000 -- [-876.892] (-876.329) (-875.108) (-875.048) * (-876.662) (-878.943) [-873.806] (-877.080) -- 0:00:29
522500 -- (-875.895) (-874.316) [-875.587] (-875.236) * (-878.009) (-876.976) (-873.825) [-875.915] -- 0:00:29
523000 -- [-878.218] (-874.405) (-874.181) (-876.660) * [-875.296] (-875.685) (-875.500) (-875.241) -- 0:00:29
523500 -- (-876.062) [-874.893] (-874.286) (-874.618) * (-875.464) (-876.842) [-875.974] (-875.416) -- 0:00:29
524000 -- (-875.882) (-876.246) (-877.980) [-873.690] * (-878.237) (-875.724) (-876.132) [-875.197] -- 0:00:29
524500 -- (-874.317) (-873.769) (-878.895) [-874.368] * (-875.244) [-875.437] (-880.828) (-877.076) -- 0:00:29
525000 -- (-875.167) (-876.869) (-879.153) [-874.726] * [-874.086] (-874.902) (-875.841) (-875.301) -- 0:00:28
Average standard deviation of split frequencies: 0.009858
525500 -- (-874.255) (-876.330) (-875.740) [-874.135] * (-874.591) [-876.530] (-874.580) (-874.181) -- 0:00:28
526000 -- (-873.693) [-874.820] (-877.848) (-878.509) * (-879.133) (-874.388) (-874.485) [-877.532] -- 0:00:28
526500 -- (-873.475) (-873.370) [-874.875] (-874.899) * (-876.969) [-876.505] (-874.270) (-877.042) -- 0:00:28
527000 -- (-876.867) [-874.147] (-877.158) (-874.494) * (-876.155) (-877.978) [-875.986] (-875.504) -- 0:00:28
527500 -- (-878.006) [-874.721] (-877.095) (-878.790) * (-879.364) [-874.020] (-880.477) (-874.528) -- 0:00:28
528000 -- (-877.447) (-875.675) (-876.763) [-877.341] * (-875.348) (-874.231) [-874.671] (-873.380) -- 0:00:28
528500 -- (-878.095) (-873.781) (-873.877) [-874.095] * (-875.812) [-874.047] (-874.905) (-874.536) -- 0:00:28
529000 -- (-876.137) [-873.445] (-875.704) (-874.694) * (-875.345) [-874.647] (-874.977) (-874.229) -- 0:00:28
529500 -- (-876.731) [-874.187] (-875.608) (-878.869) * (-877.948) (-877.788) [-876.365] (-874.469) -- 0:00:28
530000 -- [-877.102] (-875.624) (-879.265) (-878.292) * (-877.772) [-878.163] (-876.479) (-878.437) -- 0:00:28
Average standard deviation of split frequencies: 0.010049
530500 -- (-877.705) (-876.311) (-875.175) [-876.151] * (-873.922) [-875.571] (-877.493) (-879.799) -- 0:00:28
531000 -- (-879.414) (-875.255) (-875.167) [-874.880] * [-876.130] (-875.327) (-877.468) (-879.475) -- 0:00:28
531500 -- (-878.668) [-874.713] (-876.636) (-874.736) * [-877.067] (-874.012) (-874.573) (-876.345) -- 0:00:28
532000 -- (-874.388) (-874.005) (-873.703) [-874.667] * (-874.153) (-876.415) (-874.398) [-874.665] -- 0:00:28
532500 -- (-875.632) (-875.201) (-875.781) [-877.465] * (-875.923) [-875.003] (-876.739) (-876.129) -- 0:00:28
533000 -- (-874.394) [-874.297] (-878.049) (-875.597) * (-877.212) [-875.677] (-875.474) (-875.001) -- 0:00:28
533500 -- (-874.856) [-876.125] (-876.666) (-877.829) * (-877.136) [-873.700] (-874.269) (-874.755) -- 0:00:27
534000 -- (-875.569) (-880.311) (-876.838) [-875.738] * (-878.074) (-875.448) [-876.253] (-876.016) -- 0:00:27
534500 -- (-875.513) (-874.566) [-882.035] (-875.992) * (-878.574) (-875.904) [-874.572] (-880.129) -- 0:00:27
535000 -- (-876.310) [-874.438] (-879.639) (-875.772) * (-876.222) (-874.140) [-876.998] (-875.814) -- 0:00:28
Average standard deviation of split frequencies: 0.010224
535500 -- (-874.647) (-875.334) (-881.967) [-875.393] * (-874.802) (-874.834) [-875.927] (-875.531) -- 0:00:28
536000 -- (-877.230) [-873.993] (-876.540) (-875.157) * (-878.387) (-876.650) [-874.234] (-877.073) -- 0:00:28
536500 -- (-874.942) (-873.800) (-875.110) [-876.647] * (-875.456) [-880.242] (-873.949) (-874.501) -- 0:00:28
537000 -- [-875.614] (-874.951) (-874.232) (-877.060) * (-875.380) (-874.409) [-875.287] (-875.269) -- 0:00:28
537500 -- (-875.341) (-874.035) (-875.223) [-875.908] * [-877.304] (-874.336) (-875.197) (-875.850) -- 0:00:28
538000 -- [-875.228] (-876.067) (-875.855) (-875.525) * (-877.166) (-876.213) [-876.440] (-874.655) -- 0:00:28
538500 -- (-877.183) [-875.730] (-874.721) (-874.311) * (-877.432) [-875.935] (-877.106) (-880.549) -- 0:00:28
539000 -- (-876.195) (-873.987) [-875.684] (-875.644) * (-878.856) (-875.296) [-875.917] (-876.053) -- 0:00:28
539500 -- (-875.511) [-874.079] (-874.795) (-876.484) * (-877.164) [-875.270] (-874.231) (-875.504) -- 0:00:28
540000 -- (-882.948) (-876.533) [-873.649] (-876.434) * (-878.950) (-876.057) (-875.478) [-873.809] -- 0:00:28
Average standard deviation of split frequencies: 0.010844
540500 -- (-877.090) (-873.773) [-873.702] (-875.589) * (-875.578) (-877.001) [-876.555] (-878.003) -- 0:00:28
541000 -- (-876.876) (-875.485) (-873.513) [-874.708] * (-882.800) (-876.941) [-877.492] (-877.309) -- 0:00:27
541500 -- [-876.678] (-878.101) (-877.937) (-877.249) * [-875.174] (-875.064) (-878.636) (-877.244) -- 0:00:27
542000 -- (-875.339) (-874.805) [-876.773] (-875.898) * (-877.310) [-877.026] (-880.332) (-875.825) -- 0:00:27
542500 -- [-874.983] (-876.896) (-878.623) (-877.270) * (-875.332) [-875.312] (-875.321) (-879.908) -- 0:00:27
543000 -- (-876.028) (-880.009) (-874.594) [-876.919] * (-878.601) (-879.231) [-874.693] (-873.412) -- 0:00:27
543500 -- [-875.692] (-877.834) (-875.863) (-877.696) * (-876.063) (-876.420) (-877.040) [-874.056] -- 0:00:27
544000 -- (-874.009) [-876.074] (-874.357) (-876.724) * (-876.448) (-876.382) (-875.817) [-874.542] -- 0:00:27
544500 -- (-875.355) (-876.274) (-876.197) [-875.563] * (-874.360) (-874.713) [-874.397] (-875.815) -- 0:00:27
545000 -- (-876.038) (-875.827) [-874.772] (-875.219) * (-876.754) (-875.802) [-877.062] (-875.878) -- 0:00:27
Average standard deviation of split frequencies: 0.010522
545500 -- (-877.626) [-875.640] (-878.109) (-873.873) * (-876.582) (-874.857) [-875.136] (-875.613) -- 0:00:27
546000 -- (-876.415) [-875.169] (-877.614) (-876.650) * [-874.136] (-874.542) (-875.035) (-876.838) -- 0:00:27
546500 -- [-874.408] (-875.759) (-874.574) (-876.724) * (-874.966) (-875.973) [-873.953] (-876.110) -- 0:00:27
547000 -- (-878.132) (-875.747) (-874.712) [-875.531] * (-876.579) [-876.863] (-879.087) (-875.135) -- 0:00:27
547500 -- (-875.395) (-877.355) [-875.709] (-874.356) * (-875.749) (-876.885) (-874.351) [-876.121] -- 0:00:27
548000 -- (-875.000) (-877.879) (-874.889) [-873.716] * (-876.653) (-878.993) [-874.088] (-879.898) -- 0:00:27
548500 -- (-877.229) (-877.501) (-876.429) [-875.475] * (-874.649) (-877.100) [-875.885] (-876.337) -- 0:00:27
549000 -- [-874.688] (-875.634) (-877.115) (-874.573) * (-876.524) (-876.687) (-874.215) [-873.820] -- 0:00:27
549500 -- (-875.117) [-873.963] (-875.561) (-875.912) * (-879.444) (-874.571) (-881.597) [-875.402] -- 0:00:27
550000 -- (-873.928) (-877.206) (-874.952) [-875.506] * (-876.781) [-879.916] (-873.951) (-879.911) -- 0:00:27
Average standard deviation of split frequencies: 0.010444
550500 -- (-876.796) [-875.345] (-875.278) (-875.187) * [-873.469] (-874.405) (-876.048) (-877.161) -- 0:00:26
551000 -- (-874.623) [-873.752] (-876.164) (-874.980) * (-874.046) [-873.958] (-878.493) (-876.108) -- 0:00:27
551500 -- (-876.530) (-873.805) (-877.362) [-876.978] * (-874.747) (-873.494) (-874.548) [-875.870] -- 0:00:27
552000 -- (-876.034) (-874.041) (-874.419) [-873.930] * (-875.065) (-875.879) [-874.077] (-874.344) -- 0:00:27
552500 -- (-880.181) (-875.071) (-875.660) [-875.369] * (-877.068) (-875.048) [-874.107] (-877.696) -- 0:00:27
553000 -- (-878.385) (-875.490) [-875.247] (-876.394) * (-874.848) [-876.260] (-874.125) (-876.718) -- 0:00:27
553500 -- (-879.066) [-874.670] (-877.185) (-874.785) * (-874.835) [-878.693] (-875.520) (-874.448) -- 0:00:27
554000 -- (-875.271) (-875.152) (-874.865) [-873.861] * (-876.582) (-876.583) (-875.700) [-875.660] -- 0:00:27
554500 -- (-875.985) (-874.287) [-876.869] (-874.790) * [-875.460] (-878.162) (-876.808) (-875.749) -- 0:00:27
555000 -- [-876.959] (-874.219) (-875.686) (-877.453) * (-878.323) (-877.982) [-879.128] (-876.287) -- 0:00:27
Average standard deviation of split frequencies: 0.010570
555500 -- (-874.433) (-874.356) [-876.147] (-874.224) * (-873.764) (-875.476) (-874.900) [-876.277] -- 0:00:27
556000 -- [-876.782] (-874.933) (-881.245) (-876.238) * (-874.829) (-876.348) (-874.389) [-874.909] -- 0:00:27
556500 -- [-876.465] (-876.854) (-879.509) (-876.844) * (-874.771) (-877.917) (-874.971) [-874.378] -- 0:00:27
557000 -- (-879.163) (-879.809) (-873.888) [-874.994] * (-875.438) (-877.434) [-880.202] (-875.355) -- 0:00:27
557500 -- [-875.644] (-875.861) (-873.870) (-874.725) * [-875.500] (-874.210) (-880.911) (-877.041) -- 0:00:26
558000 -- (-873.620) [-873.920] (-876.595) (-877.251) * (-877.182) [-873.732] (-875.850) (-877.419) -- 0:00:26
558500 -- [-878.103] (-875.926) (-877.343) (-879.550) * [-875.039] (-873.619) (-874.734) (-876.712) -- 0:00:26
559000 -- (-878.349) (-876.306) [-874.578] (-875.993) * (-876.592) [-873.383] (-874.542) (-877.095) -- 0:00:26
559500 -- (-876.595) (-877.280) (-875.059) [-875.485] * [-875.907] (-874.980) (-873.768) (-875.542) -- 0:00:26
560000 -- [-879.445] (-879.764) (-874.677) (-878.535) * (-880.256) (-877.272) [-874.118] (-879.572) -- 0:00:26
Average standard deviation of split frequencies: 0.009354
560500 -- (-876.273) [-874.736] (-875.446) (-878.784) * (-887.338) [-876.913] (-874.360) (-879.509) -- 0:00:26
561000 -- (-877.699) (-878.512) [-876.363] (-877.328) * (-887.670) (-875.588) (-873.870) [-875.347] -- 0:00:26
561500 -- (-875.163) [-882.461] (-881.300) (-875.666) * (-874.857) (-876.686) [-876.725] (-877.167) -- 0:00:26
562000 -- (-875.839) [-875.601] (-875.550) (-874.628) * [-875.564] (-876.511) (-874.541) (-876.842) -- 0:00:26
562500 -- (-874.713) [-874.896] (-876.919) (-873.677) * (-874.446) (-874.702) (-875.447) [-873.858] -- 0:00:26
563000 -- (-878.382) (-874.515) [-874.789] (-874.034) * (-874.284) (-875.610) (-877.588) [-874.652] -- 0:00:26
563500 -- (-875.962) (-879.370) (-875.416) [-878.495] * (-874.059) (-875.891) (-874.022) [-874.612] -- 0:00:26
564000 -- (-874.446) [-875.249] (-873.919) (-876.443) * (-877.682) (-876.375) (-876.985) [-875.524] -- 0:00:26
564500 -- [-873.914] (-876.722) (-877.436) (-878.342) * (-878.431) (-875.121) (-873.760) [-878.392] -- 0:00:26
565000 -- (-875.140) [-875.025] (-876.543) (-876.163) * (-875.066) (-876.225) (-878.258) [-874.720] -- 0:00:26
Average standard deviation of split frequencies: 0.009422
565500 -- [-873.779] (-877.748) (-878.440) (-875.405) * (-879.962) [-878.294] (-876.549) (-875.022) -- 0:00:26
566000 -- (-874.478) (-875.896) (-878.201) [-874.787] * (-875.686) (-874.177) (-879.144) [-874.761] -- 0:00:26
566500 -- [-874.499] (-874.673) (-876.371) (-875.478) * (-875.152) [-876.072] (-877.129) (-875.100) -- 0:00:26
567000 -- (-878.385) [-876.224] (-875.841) (-876.859) * (-874.916) (-874.926) [-876.462] (-876.257) -- 0:00:25
567500 -- (-879.105) [-875.114] (-881.526) (-876.703) * (-874.380) [-875.538] (-876.783) (-878.902) -- 0:00:25
568000 -- [-875.395] (-876.680) (-876.255) (-877.051) * [-873.868] (-874.620) (-875.434) (-878.703) -- 0:00:26
568500 -- (-875.747) (-879.748) (-875.340) [-875.192] * (-874.055) (-877.095) [-874.351] (-877.822) -- 0:00:26
569000 -- (-879.191) (-876.821) [-879.611] (-874.187) * (-876.310) [-879.222] (-874.818) (-875.283) -- 0:00:26
569500 -- [-875.555] (-879.982) (-875.661) (-876.384) * (-873.986) (-875.054) (-874.435) [-878.802] -- 0:00:26
570000 -- [-877.139] (-877.574) (-876.207) (-876.206) * (-877.608) (-874.521) [-875.212] (-876.928) -- 0:00:26
Average standard deviation of split frequencies: 0.009252
570500 -- (-875.296) (-874.889) [-874.958] (-879.901) * [-878.893] (-875.560) (-876.060) (-876.658) -- 0:00:26
571000 -- [-874.820] (-876.482) (-873.922) (-878.512) * [-874.841] (-874.640) (-876.487) (-876.698) -- 0:00:26
571500 -- (-878.443) (-876.104) (-876.466) [-877.199] * [-878.536] (-874.636) (-878.704) (-880.220) -- 0:00:26
572000 -- (-879.722) (-875.484) (-876.469) [-876.886] * [-873.622] (-876.402) (-876.813) (-880.025) -- 0:00:26
572500 -- (-877.082) (-876.342) [-875.714] (-874.732) * (-873.637) (-880.021) [-874.735] (-874.646) -- 0:00:26
573000 -- (-874.562) [-878.616] (-876.987) (-875.577) * (-874.564) (-877.916) (-873.840) [-876.664] -- 0:00:26
573500 -- [-878.805] (-875.996) (-876.263) (-877.728) * (-877.060) [-875.306] (-879.503) (-876.547) -- 0:00:26
574000 -- (-874.908) (-874.518) (-875.681) [-873.798] * (-883.760) [-876.142] (-880.083) (-874.433) -- 0:00:25
574500 -- [-875.986] (-874.153) (-875.048) (-876.716) * [-878.007] (-874.714) (-875.024) (-875.985) -- 0:00:25
575000 -- (-878.159) (-874.845) (-875.328) [-874.599] * (-874.682) (-877.143) (-875.671) [-875.010] -- 0:00:25
Average standard deviation of split frequencies: 0.009221
575500 -- (-878.994) [-874.698] (-874.377) (-876.574) * (-877.137) (-878.340) (-876.812) [-874.014] -- 0:00:25
576000 -- (-877.408) (-877.952) (-877.263) [-876.137] * (-877.131) (-878.835) (-878.264) [-874.113] -- 0:00:25
576500 -- (-881.906) (-873.751) [-875.190] (-874.922) * (-874.931) [-880.859] (-876.457) (-877.997) -- 0:00:25
577000 -- (-876.970) [-873.750] (-875.783) (-874.076) * (-876.546) (-876.523) (-875.414) [-876.949] -- 0:00:25
577500 -- (-876.124) (-876.800) (-875.797) [-874.064] * (-877.572) (-876.455) (-876.432) [-875.708] -- 0:00:25
578000 -- (-877.399) (-877.051) (-876.047) [-874.196] * [-880.309] (-874.980) (-875.347) (-875.897) -- 0:00:25
578500 -- (-876.990) (-879.198) [-874.700] (-874.299) * (-881.290) (-874.200) (-875.661) [-874.377] -- 0:00:25
579000 -- (-880.107) (-876.261) (-875.125) [-874.018] * (-875.079) (-877.070) [-874.832] (-876.220) -- 0:00:25
579500 -- (-875.201) [-876.451] (-874.120) (-873.750) * [-875.345] (-874.038) (-874.638) (-875.612) -- 0:00:25
580000 -- (-874.878) (-874.627) (-875.484) [-874.183] * (-875.203) (-874.179) [-874.169] (-877.793) -- 0:00:25
Average standard deviation of split frequencies: 0.009309
580500 -- (-874.583) [-873.540] (-877.199) (-880.240) * (-876.334) (-874.008) [-874.420] (-877.120) -- 0:00:25
581000 -- [-875.006] (-873.988) (-875.195) (-877.918) * (-873.711) (-874.663) [-875.817] (-874.476) -- 0:00:25
581500 -- (-873.603) (-874.483) (-878.063) [-874.907] * (-874.284) [-874.663] (-875.215) (-884.108) -- 0:00:25
582000 -- (-873.580) [-874.687] (-873.511) (-875.016) * [-874.906] (-875.544) (-873.816) (-874.996) -- 0:00:25
582500 -- (-877.980) (-878.413) [-876.238] (-878.849) * [-876.559] (-877.370) (-876.069) (-875.840) -- 0:00:25
583000 -- (-877.019) (-881.285) (-877.812) [-875.813] * [-876.716] (-884.432) (-874.396) (-873.777) -- 0:00:25
583500 -- (-874.790) [-880.045] (-878.267) (-876.671) * [-875.060] (-877.774) (-874.631) (-876.532) -- 0:00:24
584000 -- [-877.389] (-877.100) (-876.156) (-876.187) * (-877.402) [-876.426] (-880.989) (-876.429) -- 0:00:24
584500 -- [-879.550] (-874.537) (-875.086) (-875.884) * (-879.352) [-874.512] (-878.156) (-874.617) -- 0:00:25
585000 -- [-875.159] (-874.175) (-874.836) (-876.035) * [-875.656] (-875.016) (-875.483) (-874.108) -- 0:00:25
Average standard deviation of split frequencies: 0.009117
585500 -- (-875.077) [-873.801] (-874.604) (-877.206) * (-880.494) (-876.551) (-876.995) [-875.407] -- 0:00:25
586000 -- [-878.311] (-875.126) (-874.100) (-876.530) * (-875.465) (-874.532) [-874.905] (-875.365) -- 0:00:25
586500 -- (-876.094) (-880.763) (-873.951) [-874.248] * (-875.653) (-874.910) (-876.022) [-875.633] -- 0:00:25
587000 -- (-874.397) (-876.813) (-876.574) [-874.481] * (-877.631) [-875.063] (-873.741) (-876.667) -- 0:00:25
587500 -- [-878.910] (-877.166) (-879.873) (-880.833) * (-873.992) (-877.137) [-875.645] (-874.672) -- 0:00:25
588000 -- [-877.510] (-875.389) (-877.480) (-876.374) * (-874.672) (-874.567) (-876.211) [-874.874] -- 0:00:25
588500 -- (-876.024) (-875.761) (-882.326) [-874.311] * [-875.405] (-873.997) (-877.337) (-876.418) -- 0:00:25
589000 -- [-876.393] (-877.809) (-879.004) (-877.794) * (-878.866) (-877.479) (-874.623) [-875.814] -- 0:00:25
589500 -- (-881.829) [-877.713] (-876.246) (-875.472) * (-874.267) (-877.713) [-874.706] (-876.020) -- 0:00:25
590000 -- (-877.397) (-883.889) (-874.128) [-874.157] * [-876.328] (-875.727) (-875.987) (-878.373) -- 0:00:25
Average standard deviation of split frequencies: 0.009205
590500 -- (-875.832) [-875.309] (-876.937) (-876.564) * [-877.603] (-876.745) (-875.742) (-875.806) -- 0:00:24
591000 -- (-876.075) [-875.126] (-876.731) (-875.160) * (-876.856) [-874.209] (-874.105) (-877.006) -- 0:00:24
591500 -- (-877.306) (-873.872) [-877.287] (-875.780) * (-873.941) (-874.542) [-874.565] (-873.660) -- 0:00:24
592000 -- (-876.725) (-873.843) (-879.907) [-875.354] * (-875.841) (-878.350) (-877.213) [-874.652] -- 0:00:24
592500 -- [-874.186] (-874.069) (-879.464) (-875.394) * [-877.376] (-877.030) (-876.830) (-877.330) -- 0:00:24
593000 -- (-877.424) (-877.419) (-885.789) [-874.815] * [-876.096] (-877.693) (-875.871) (-874.953) -- 0:00:24
593500 -- (-874.966) (-876.257) [-874.822] (-875.087) * [-878.909] (-873.705) (-875.610) (-876.372) -- 0:00:24
594000 -- [-874.638] (-874.985) (-876.303) (-877.485) * (-877.550) [-877.018] (-875.504) (-874.414) -- 0:00:24
594500 -- (-879.172) (-874.973) [-874.531] (-878.867) * [-875.714] (-877.445) (-879.178) (-874.728) -- 0:00:24
595000 -- (-877.380) (-875.263) (-878.356) [-874.877] * (-877.609) [-877.918] (-878.062) (-874.166) -- 0:00:24
Average standard deviation of split frequencies: 0.009386
595500 -- (-879.720) (-875.201) [-874.683] (-874.681) * (-877.373) [-875.326] (-874.328) (-876.066) -- 0:00:24
596000 -- (-880.289) [-877.457] (-877.080) (-874.667) * (-877.007) [-876.514] (-876.994) (-877.196) -- 0:00:24
596500 -- (-874.827) [-877.209] (-876.820) (-881.811) * (-877.017) (-878.775) [-874.814] (-877.156) -- 0:00:24
597000 -- [-876.300] (-875.506) (-874.951) (-878.099) * [-875.331] (-876.811) (-875.072) (-877.099) -- 0:00:24
597500 -- (-875.891) (-873.911) (-874.371) [-874.874] * (-875.876) (-876.113) [-874.337] (-875.691) -- 0:00:24
598000 -- (-877.382) (-876.078) [-874.563] (-875.378) * (-874.793) [-876.411] (-875.045) (-879.052) -- 0:00:24
598500 -- (-876.875) [-875.050] (-874.155) (-879.432) * (-874.603) [-874.577] (-875.945) (-876.880) -- 0:00:24
599000 -- (-877.520) (-874.841) [-876.869] (-874.988) * (-874.640) [-874.657] (-878.292) (-878.409) -- 0:00:24
599500 -- (-881.337) (-876.588) [-877.056] (-874.596) * (-874.128) (-875.395) (-875.723) [-878.874] -- 0:00:24
600000 -- [-876.109] (-874.991) (-874.879) (-874.015) * (-874.128) (-874.296) [-873.736] (-874.067) -- 0:00:24
Average standard deviation of split frequencies: 0.009208
600500 -- (-873.603) (-875.952) [-874.548] (-877.635) * (-876.460) (-876.010) [-873.914] (-874.332) -- 0:00:24
601000 -- [-874.225] (-874.000) (-875.796) (-875.781) * [-876.244] (-878.099) (-876.945) (-875.115) -- 0:00:24
601500 -- (-874.273) (-874.810) [-875.765] (-874.222) * (-876.017) (-874.679) (-873.750) [-874.196] -- 0:00:24
602000 -- (-875.485) [-876.207] (-876.444) (-874.478) * (-875.294) (-874.597) [-874.416] (-877.385) -- 0:00:24
602500 -- (-874.682) [-874.111] (-875.905) (-876.372) * [-874.850] (-875.575) (-874.570) (-876.220) -- 0:00:24
603000 -- [-875.253] (-877.736) (-875.192) (-877.226) * [-875.967] (-878.136) (-874.212) (-875.325) -- 0:00:24
603500 -- (-874.675) (-878.950) (-875.202) [-877.195] * (-874.617) (-875.907) (-876.501) [-876.070] -- 0:00:24
604000 -- [-876.466] (-879.067) (-877.773) (-883.466) * (-873.959) (-877.512) (-874.193) [-874.688] -- 0:00:24
604500 -- [-880.233] (-877.061) (-875.624) (-883.054) * (-874.303) [-878.864] (-875.553) (-876.705) -- 0:00:24
605000 -- (-879.108) (-878.159) [-876.332] (-880.207) * (-876.629) [-878.246] (-876.954) (-874.269) -- 0:00:24
Average standard deviation of split frequencies: 0.009594
605500 -- (-875.013) (-878.310) [-875.007] (-877.854) * (-876.721) (-877.717) (-877.072) [-875.115] -- 0:00:24
606000 -- (-874.404) (-874.740) [-874.778] (-875.141) * [-878.984] (-875.163) (-876.029) (-876.316) -- 0:00:24
606500 -- [-877.574] (-873.912) (-879.559) (-877.683) * (-874.146) (-876.238) [-874.194] (-874.411) -- 0:00:24
607000 -- (-880.374) [-874.937] (-876.191) (-874.802) * (-874.429) (-874.041) [-873.990] (-874.977) -- 0:00:23
607500 -- (-880.734) (-875.593) [-874.377] (-876.578) * (-877.748) (-875.482) [-874.561] (-876.071) -- 0:00:23
608000 -- (-875.229) [-875.886] (-873.636) (-877.308) * (-876.556) [-874.959] (-876.628) (-874.994) -- 0:00:23
608500 -- (-875.634) (-876.161) [-873.634] (-873.743) * (-876.446) [-875.438] (-877.601) (-875.950) -- 0:00:23
609000 -- (-881.868) (-874.972) [-877.390] (-879.565) * (-876.272) [-875.280] (-874.363) (-874.917) -- 0:00:23
609500 -- (-882.432) (-877.685) (-878.291) [-874.860] * [-875.079] (-877.167) (-878.558) (-873.602) -- 0:00:23
610000 -- (-877.555) [-875.991] (-874.613) (-875.112) * (-874.882) (-874.169) (-875.983) [-876.395] -- 0:00:23
Average standard deviation of split frequencies: 0.009006
610500 -- [-875.360] (-875.916) (-876.325) (-874.802) * (-875.678) (-875.573) [-874.452] (-874.742) -- 0:00:23
611000 -- (-880.899) (-875.257) (-881.159) [-874.260] * [-875.103] (-874.261) (-877.029) (-874.011) -- 0:00:23
611500 -- [-875.879] (-875.315) (-877.568) (-873.887) * (-875.393) [-876.841] (-878.361) (-874.380) -- 0:00:23
612000 -- (-874.224) (-874.173) [-877.329] (-876.799) * (-880.803) (-878.187) [-879.992] (-879.264) -- 0:00:23
612500 -- (-874.875) [-875.177] (-874.143) (-876.105) * (-877.620) [-878.660] (-874.830) (-876.826) -- 0:00:23
613000 -- (-878.447) (-875.754) (-875.389) [-875.845] * (-876.611) [-876.520] (-875.360) (-876.805) -- 0:00:23
613500 -- (-878.003) (-875.562) (-877.101) [-875.432] * (-876.790) (-877.486) [-873.614] (-878.684) -- 0:00:23
614000 -- (-874.133) [-875.149] (-878.787) (-879.338) * (-876.359) (-875.913) (-873.382) [-877.238] -- 0:00:23
614500 -- [-875.013] (-875.450) (-877.079) (-875.047) * [-874.862] (-873.903) (-878.638) (-878.048) -- 0:00:23
615000 -- (-877.988) (-873.965) [-878.550] (-873.483) * (-874.083) (-874.426) [-875.657] (-875.811) -- 0:00:23
Average standard deviation of split frequencies: 0.009081
615500 -- (-877.456) (-876.500) [-875.606] (-876.202) * (-875.313) [-877.069] (-875.258) (-876.732) -- 0:00:23
616000 -- (-879.587) (-874.639) [-874.798] (-879.501) * (-878.412) (-877.166) [-873.854] (-874.399) -- 0:00:23
616500 -- (-876.385) (-875.908) (-874.334) [-874.815] * (-873.910) (-876.485) (-873.495) [-875.439] -- 0:00:23
617000 -- (-878.171) (-873.627) (-875.125) [-875.391] * (-875.484) (-876.853) (-874.466) [-876.812] -- 0:00:23
617500 -- (-876.082) (-875.421) [-874.362] (-873.939) * (-875.230) [-878.338] (-875.521) (-877.550) -- 0:00:23
618000 -- (-879.150) (-875.571) [-875.464] (-876.755) * (-876.394) (-875.843) [-876.522] (-876.471) -- 0:00:23
618500 -- [-875.495] (-875.217) (-877.381) (-873.634) * (-875.619) [-873.914] (-876.635) (-874.796) -- 0:00:23
619000 -- (-879.950) (-875.398) [-874.583] (-873.787) * [-874.967] (-878.137) (-878.041) (-877.685) -- 0:00:23
619500 -- [-876.540] (-878.486) (-874.756) (-875.660) * (-875.285) (-878.509) (-874.607) [-876.627] -- 0:00:23
620000 -- [-875.560] (-875.631) (-874.201) (-878.480) * [-875.795] (-873.696) (-873.776) (-876.458) -- 0:00:23
Average standard deviation of split frequencies: 0.008557
620500 -- (-876.738) (-876.985) (-878.897) [-875.166] * (-879.922) (-873.681) [-877.511] (-877.548) -- 0:00:23
621000 -- (-880.560) [-875.597] (-877.757) (-875.623) * (-874.813) (-877.055) [-877.406] (-874.520) -- 0:00:23
621500 -- (-874.326) [-875.920] (-881.899) (-874.881) * (-873.992) [-873.821] (-877.985) (-875.041) -- 0:00:23
622000 -- (-875.203) (-877.184) (-880.406) [-875.820] * [-874.326] (-874.564) (-878.422) (-876.990) -- 0:00:23
622500 -- (-875.613) (-873.667) (-875.667) [-875.131] * [-875.583] (-874.869) (-876.120) (-876.014) -- 0:00:23
623000 -- [-874.254] (-874.831) (-874.857) (-875.089) * (-876.153) (-875.172) [-875.919] (-876.153) -- 0:00:22
623500 -- (-875.705) (-879.378) (-875.129) [-874.163] * (-879.387) [-876.391] (-874.472) (-875.949) -- 0:00:22
624000 -- (-876.015) [-873.629] (-874.175) (-875.167) * (-874.218) [-876.471] (-875.977) (-875.118) -- 0:00:22
624500 -- (-874.957) (-880.084) [-876.810] (-873.774) * (-874.173) (-874.934) (-876.349) [-879.018] -- 0:00:22
625000 -- (-873.957) [-873.936] (-880.038) (-873.841) * (-874.324) [-875.184] (-874.093) (-874.593) -- 0:00:22
Average standard deviation of split frequencies: 0.008434
625500 -- [-875.471] (-876.208) (-874.806) (-877.013) * (-877.634) (-875.019) [-875.009] (-874.319) -- 0:00:22
626000 -- (-874.386) (-875.654) (-875.182) [-873.659] * (-875.187) (-875.149) (-875.072) [-876.877] -- 0:00:22
626500 -- (-879.107) (-875.767) (-878.945) [-873.768] * [-874.995] (-874.750) (-875.177) (-879.113) -- 0:00:22
627000 -- [-878.497] (-876.056) (-876.517) (-876.587) * (-876.580) (-877.325) [-877.835] (-880.102) -- 0:00:22
627500 -- (-876.352) (-876.819) [-875.862] (-879.016) * (-877.732) (-877.526) (-877.023) [-878.522] -- 0:00:22
628000 -- [-874.141] (-878.269) (-874.717) (-877.072) * [-875.677] (-875.824) (-879.858) (-875.184) -- 0:00:22
628500 -- [-875.102] (-876.114) (-876.444) (-876.137) * (-880.251) (-875.258) [-874.547] (-874.229) -- 0:00:22
629000 -- [-874.393] (-877.459) (-873.760) (-876.251) * (-876.605) (-875.598) [-875.446] (-876.913) -- 0:00:22
629500 -- (-874.596) (-877.671) (-875.211) [-876.423] * (-876.715) (-875.905) (-874.639) [-875.255] -- 0:00:22
630000 -- (-875.711) (-878.661) (-876.474) [-876.106] * (-879.169) (-876.657) (-875.466) [-876.606] -- 0:00:22
Average standard deviation of split frequencies: 0.008023
630500 -- (-874.269) [-878.516] (-875.648) (-876.473) * (-876.274) (-877.749) (-877.352) [-875.543] -- 0:00:22
631000 -- [-875.875] (-875.913) (-874.990) (-874.317) * (-875.070) [-876.153] (-875.204) (-875.609) -- 0:00:22
631500 -- (-875.906) (-876.380) (-875.920) [-875.234] * [-874.798] (-876.564) (-876.077) (-875.436) -- 0:00:22
632000 -- (-875.616) (-874.360) [-875.962] (-875.150) * (-874.933) (-877.285) [-875.588] (-876.383) -- 0:00:22
632500 -- (-876.538) (-874.320) [-875.278] (-880.702) * (-877.021) (-880.775) (-873.994) [-874.358] -- 0:00:22
633000 -- (-877.717) (-875.281) [-875.677] (-877.898) * (-877.234) (-874.217) (-875.938) [-876.585] -- 0:00:22
633500 -- (-876.031) (-877.481) [-874.090] (-876.986) * (-876.448) (-875.881) (-874.758) [-876.880] -- 0:00:22
634000 -- [-878.280] (-877.628) (-875.306) (-875.003) * (-874.165) [-876.621] (-873.958) (-876.048) -- 0:00:22
634500 -- (-874.095) [-874.427] (-877.670) (-873.808) * (-882.049) (-876.543) [-874.645] (-877.255) -- 0:00:22
635000 -- (-875.632) [-874.996] (-876.543) (-877.264) * (-876.687) [-875.907] (-875.371) (-875.584) -- 0:00:22
Average standard deviation of split frequencies: 0.007956
635500 -- (-875.335) [-874.029] (-875.975) (-877.608) * (-875.914) (-880.045) [-876.046] (-879.320) -- 0:00:22
636000 -- (-877.426) [-874.660] (-879.889) (-875.681) * (-874.680) [-878.018] (-875.260) (-878.834) -- 0:00:22
636500 -- (-877.092) (-874.295) [-874.063] (-876.591) * (-876.235) (-875.641) (-876.791) [-874.740] -- 0:00:22
637000 -- (-875.993) [-875.475] (-878.668) (-876.507) * (-874.640) (-879.124) [-876.896] (-875.674) -- 0:00:22
637500 -- (-874.696) [-875.686] (-877.811) (-877.185) * (-876.154) [-878.416] (-876.193) (-876.482) -- 0:00:22
638000 -- [-874.558] (-879.337) (-881.859) (-878.422) * (-874.583) (-876.906) (-877.020) [-874.773] -- 0:00:22
638500 -- [-873.407] (-874.560) (-875.622) (-876.329) * (-874.598) [-875.166] (-875.975) (-874.869) -- 0:00:22
639000 -- (-879.462) (-877.202) (-875.376) [-874.681] * (-876.827) (-876.647) [-878.335] (-880.239) -- 0:00:22
639500 -- [-876.000] (-879.445) (-876.582) (-878.686) * (-875.973) [-874.235] (-880.682) (-875.950) -- 0:00:21
640000 -- [-878.789] (-875.741) (-875.689) (-874.770) * (-875.016) (-875.375) (-876.324) [-877.308] -- 0:00:21
Average standard deviation of split frequencies: 0.007947
640500 -- (-874.595) (-875.130) (-876.672) [-873.931] * (-876.425) [-875.307] (-876.439) (-876.320) -- 0:00:21
641000 -- (-877.661) [-880.105] (-874.086) (-877.879) * (-876.072) (-876.569) [-879.052] (-876.478) -- 0:00:21
641500 -- (-874.201) (-879.258) [-874.650] (-874.864) * (-878.528) (-880.587) (-881.095) [-874.928] -- 0:00:21
642000 -- [-876.413] (-876.732) (-874.999) (-878.916) * (-878.691) [-878.041] (-876.230) (-875.007) -- 0:00:21
642500 -- (-874.547) [-874.506] (-876.697) (-878.088) * [-875.361] (-876.255) (-874.159) (-878.525) -- 0:00:21
643000 -- (-876.536) (-875.404) (-876.729) [-875.492] * (-881.543) (-875.323) [-877.808] (-874.831) -- 0:00:21
643500 -- (-874.298) (-875.673) (-876.016) [-878.330] * (-876.811) (-877.319) [-878.854] (-874.812) -- 0:00:21
644000 -- (-875.846) [-874.936] (-875.055) (-875.627) * (-880.356) (-874.429) [-879.094] (-875.009) -- 0:00:21
644500 -- (-877.633) (-875.467) [-876.277] (-874.527) * (-874.700) (-876.169) [-874.929] (-875.782) -- 0:00:21
645000 -- (-874.640) (-876.541) [-881.939] (-874.222) * [-876.371] (-874.417) (-878.635) (-877.281) -- 0:00:21
Average standard deviation of split frequencies: 0.007686
645500 -- (-875.402) (-875.084) (-875.328) [-876.999] * (-875.155) (-877.026) (-877.357) [-875.718] -- 0:00:21
646000 -- (-876.932) (-874.559) [-875.364] (-878.158) * [-874.470] (-875.339) (-877.821) (-877.467) -- 0:00:21
646500 -- (-875.450) (-874.497) [-875.844] (-877.388) * [-875.448] (-875.203) (-873.614) (-878.753) -- 0:00:21
647000 -- [-877.180] (-875.522) (-876.074) (-875.629) * (-877.308) (-875.966) (-875.979) [-876.976] -- 0:00:21
647500 -- (-874.942) [-875.182] (-875.993) (-874.938) * (-876.777) [-878.845] (-877.913) (-878.061) -- 0:00:21
648000 -- (-879.118) (-874.103) [-875.258] (-876.952) * [-875.852] (-874.167) (-874.989) (-875.523) -- 0:00:21
648500 -- (-873.752) (-875.883) [-873.901] (-877.974) * (-874.900) (-874.024) [-875.403] (-875.219) -- 0:00:21
649000 -- (-875.514) [-877.499] (-876.726) (-874.780) * (-876.192) (-873.506) [-874.539] (-875.558) -- 0:00:21
649500 -- (-875.111) (-876.001) (-879.315) [-876.881] * (-877.654) [-873.482] (-876.092) (-873.986) -- 0:00:21
650000 -- (-873.510) (-878.089) [-873.692] (-874.659) * (-876.202) (-874.461) (-874.783) [-877.195] -- 0:00:21
Average standard deviation of split frequencies: 0.007776
650500 -- (-874.867) (-876.625) (-873.692) [-874.944] * (-874.674) [-875.092] (-875.993) (-876.156) -- 0:00:21
651000 -- (-874.281) [-875.059] (-877.066) (-878.294) * (-876.347) [-875.994] (-875.341) (-874.925) -- 0:00:21
651500 -- (-876.768) (-875.468) [-876.713] (-875.610) * (-874.631) (-877.825) [-877.913] (-876.804) -- 0:00:21
652000 -- (-874.575) (-880.570) (-874.322) [-876.283] * (-875.171) [-875.407] (-875.992) (-875.506) -- 0:00:21
652500 -- (-876.470) (-879.073) (-874.256) [-874.518] * (-873.967) (-878.224) (-879.440) [-875.888] -- 0:00:21
653000 -- (-874.589) (-875.331) [-874.924] (-881.262) * (-876.587) [-875.265] (-879.133) (-874.617) -- 0:00:21
653500 -- (-876.050) (-876.407) (-873.643) [-874.576] * (-874.819) (-874.313) [-876.663] (-876.007) -- 0:00:21
654000 -- [-876.447] (-876.089) (-876.394) (-875.615) * [-877.292] (-875.738) (-880.622) (-875.325) -- 0:00:21
654500 -- [-874.671] (-877.704) (-875.098) (-878.464) * [-878.173] (-874.318) (-875.570) (-874.546) -- 0:00:21
655000 -- (-876.065) [-875.024] (-875.038) (-879.995) * (-873.809) [-874.778] (-874.766) (-875.827) -- 0:00:21
Average standard deviation of split frequencies: 0.007330
655500 -- (-877.262) [-876.784] (-875.492) (-881.104) * (-874.823) (-873.973) [-878.679] (-873.625) -- 0:00:21
656000 -- (-874.290) (-877.237) [-876.209] (-877.631) * (-876.501) (-877.031) (-879.465) [-875.978] -- 0:00:20
656500 -- (-876.518) [-875.685] (-878.237) (-876.966) * (-874.759) [-877.710] (-879.376) (-876.306) -- 0:00:20
657000 -- [-875.804] (-874.129) (-878.449) (-875.617) * [-875.069] (-876.165) (-880.965) (-875.513) -- 0:00:20
657500 -- (-878.569) [-874.178] (-878.769) (-874.350) * (-876.555) [-874.338] (-878.607) (-876.570) -- 0:00:20
658000 -- (-878.341) (-874.773) (-878.144) [-875.472] * (-875.420) (-877.608) (-875.406) [-876.163] -- 0:00:20
658500 -- (-875.696) [-876.131] (-874.436) (-876.703) * (-875.222) (-878.579) (-876.969) [-875.633] -- 0:00:20
659000 -- [-875.672] (-875.284) (-875.429) (-874.829) * [-875.314] (-875.044) (-875.299) (-876.429) -- 0:00:20
659500 -- (-874.044) [-876.622] (-873.653) (-877.347) * [-875.424] (-874.760) (-873.858) (-874.622) -- 0:00:20
660000 -- (-876.244) [-874.318] (-876.016) (-878.279) * [-874.699] (-876.986) (-873.629) (-874.178) -- 0:00:20
Average standard deviation of split frequencies: 0.007468
660500 -- (-877.041) (-875.974) [-875.960] (-877.201) * (-875.744) (-877.634) [-873.635] (-876.226) -- 0:00:20
661000 -- (-876.222) (-877.506) (-874.049) [-878.120] * [-877.420] (-873.925) (-876.101) (-874.506) -- 0:00:20
661500 -- [-873.886] (-874.993) (-873.614) (-876.269) * [-874.776] (-877.746) (-875.868) (-874.108) -- 0:00:20
662000 -- (-875.213) (-875.073) [-875.900] (-877.080) * (-877.027) (-876.272) [-875.168] (-876.136) -- 0:00:20
662500 -- (-875.568) [-875.784] (-873.525) (-875.292) * [-875.731] (-879.483) (-876.359) (-878.976) -- 0:00:20
663000 -- (-881.342) [-874.319] (-876.232) (-875.068) * (-874.896) (-876.786) [-875.215] (-875.037) -- 0:00:20
663500 -- (-883.463) (-876.998) (-875.932) [-875.153] * (-875.787) (-875.234) [-875.502] (-874.991) -- 0:00:20
664000 -- [-879.964] (-876.663) (-875.242) (-878.008) * (-876.524) (-880.924) [-874.414] (-875.889) -- 0:00:20
664500 -- [-875.514] (-875.850) (-874.805) (-878.002) * [-873.810] (-875.412) (-874.095) (-875.296) -- 0:00:20
665000 -- (-876.372) (-876.026) [-873.997] (-877.114) * [-874.557] (-873.911) (-876.289) (-874.715) -- 0:00:20
Average standard deviation of split frequencies: 0.007975
665500 -- (-874.470) [-880.441] (-876.549) (-878.278) * (-874.246) [-875.171] (-873.743) (-874.900) -- 0:00:20
666000 -- [-875.163] (-877.192) (-875.151) (-877.917) * (-877.639) (-874.053) [-878.852] (-874.551) -- 0:00:20
666500 -- (-874.862) (-875.042) [-876.590] (-876.741) * (-874.886) [-873.835] (-874.774) (-874.800) -- 0:00:20
667000 -- (-874.277) [-874.749] (-875.164) (-877.367) * (-877.511) (-874.453) [-876.302] (-874.164) -- 0:00:20
667500 -- (-875.314) (-874.721) (-877.239) [-875.481] * (-876.714) [-874.231] (-879.488) (-875.393) -- 0:00:20
668000 -- (-881.688) (-876.150) (-877.882) [-873.484] * (-878.663) (-875.209) (-877.372) [-875.877] -- 0:00:20
668500 -- (-877.083) (-874.095) (-877.607) [-876.652] * (-876.163) (-874.150) (-881.457) [-876.277] -- 0:00:20
669000 -- (-876.603) (-874.472) [-873.620] (-876.264) * (-877.524) (-874.079) [-877.834] (-876.765) -- 0:00:20
669500 -- [-877.955] (-874.133) (-875.321) (-875.901) * (-876.756) (-873.860) [-880.264] (-876.541) -- 0:00:20
670000 -- [-874.825] (-874.012) (-875.425) (-877.739) * (-877.679) (-877.577) (-873.694) [-876.554] -- 0:00:20
Average standard deviation of split frequencies: 0.007826
670500 -- [-877.603] (-876.007) (-875.767) (-874.242) * (-877.465) [-875.807] (-874.698) (-876.152) -- 0:00:20
671000 -- [-875.090] (-876.760) (-877.109) (-879.535) * (-873.988) (-877.133) (-875.363) [-875.522] -- 0:00:20
671500 -- (-874.969) (-879.962) [-874.559] (-874.894) * (-874.938) (-880.248) [-875.905] (-875.763) -- 0:00:20
672000 -- (-874.916) (-878.211) [-873.892] (-875.934) * (-874.511) (-876.808) (-876.782) [-875.199] -- 0:00:20
672500 -- (-875.083) [-875.424] (-873.699) (-873.827) * (-873.988) (-876.295) [-876.051] (-876.554) -- 0:00:19
673000 -- (-873.658) (-876.197) (-874.345) [-874.031] * [-875.841] (-879.507) (-875.198) (-876.336) -- 0:00:19
673500 -- [-874.560] (-874.615) (-877.570) (-875.507) * (-875.472) [-875.224] (-875.629) (-876.909) -- 0:00:19
674000 -- (-874.673) (-874.938) [-873.932] (-875.482) * (-874.558) [-874.990] (-875.199) (-877.648) -- 0:00:19
674500 -- (-874.169) [-875.073] (-875.957) (-877.135) * (-876.669) (-877.158) (-878.156) [-875.820] -- 0:00:19
675000 -- (-875.930) [-874.461] (-880.920) (-878.783) * [-876.605] (-875.584) (-877.872) (-876.994) -- 0:00:19
Average standard deviation of split frequencies: 0.007857
675500 -- [-883.351] (-874.017) (-875.510) (-878.048) * [-876.387] (-874.909) (-874.430) (-873.952) -- 0:00:19
676000 -- (-875.808) [-874.812] (-878.785) (-876.331) * (-875.225) [-874.452] (-876.399) (-873.427) -- 0:00:19
676500 -- (-877.218) (-873.901) [-876.576] (-881.196) * (-877.238) (-876.609) [-873.623] (-877.268) -- 0:00:19
677000 -- (-875.272) [-875.447] (-874.718) (-877.895) * (-876.238) (-876.005) [-874.571] (-877.325) -- 0:00:19
677500 -- [-874.277] (-875.475) (-874.956) (-876.387) * (-876.930) [-873.665] (-874.837) (-874.224) -- 0:00:19
678000 -- (-873.855) [-876.319] (-876.556) (-873.702) * (-881.087) (-874.354) [-874.958] (-878.319) -- 0:00:19
678500 -- (-877.596) (-878.981) [-875.415] (-874.561) * [-875.169] (-873.512) (-878.625) (-876.009) -- 0:00:19
679000 -- [-875.131] (-876.279) (-877.084) (-874.355) * (-876.550) (-875.887) (-875.159) [-878.361] -- 0:00:19
679500 -- (-878.589) (-876.022) [-876.164] (-873.909) * [-873.387] (-873.955) (-879.786) (-874.010) -- 0:00:19
680000 -- (-876.681) (-877.184) [-875.809] (-874.900) * [-873.387] (-875.549) (-878.424) (-873.911) -- 0:00:19
Average standard deviation of split frequencies: 0.007618
680500 -- (-875.009) (-874.546) [-874.936] (-876.506) * [-875.602] (-878.297) (-879.939) (-874.201) -- 0:00:19
681000 -- [-873.636] (-874.526) (-876.683) (-879.593) * (-877.825) [-878.352] (-876.997) (-874.664) -- 0:00:19
681500 -- [-874.502] (-877.579) (-875.000) (-877.777) * (-878.968) (-876.650) (-873.635) [-877.226] -- 0:00:19
682000 -- (-873.994) (-873.886) (-877.445) [-877.957] * (-877.338) (-882.298) (-876.446) [-879.147] -- 0:00:19
682500 -- (-874.705) (-874.715) (-877.596) [-874.530] * (-880.359) (-879.892) (-875.601) [-874.281] -- 0:00:19
683000 -- (-875.678) (-878.998) (-880.323) [-874.819] * (-874.606) (-885.588) (-874.666) [-874.064] -- 0:00:19
683500 -- (-888.704) (-876.782) [-874.401] (-876.199) * [-874.481] (-877.876) (-877.446) (-874.769) -- 0:00:19
684000 -- [-873.784] (-875.803) (-873.762) (-875.091) * (-874.906) (-874.646) [-877.168] (-874.059) -- 0:00:19
684500 -- [-875.539] (-873.655) (-874.060) (-874.571) * (-874.700) [-874.016] (-874.655) (-873.793) -- 0:00:19
685000 -- (-873.743) (-875.992) (-874.050) [-873.979] * [-874.469] (-879.205) (-876.456) (-877.104) -- 0:00:19
Average standard deviation of split frequencies: 0.007788
685500 -- (-877.476) (-876.878) [-874.817] (-874.968) * (-876.530) (-880.522) (-878.055) [-873.589] -- 0:00:19
686000 -- (-877.356) (-879.193) [-873.600] (-877.346) * (-874.981) [-876.109] (-878.703) (-873.822) -- 0:00:19
686500 -- (-875.386) (-875.730) (-873.946) [-874.436] * (-877.495) (-874.788) [-877.860] (-874.224) -- 0:00:19
687000 -- [-874.803] (-874.232) (-875.212) (-877.021) * (-877.082) [-878.289] (-877.547) (-874.089) -- 0:00:19
687500 -- (-874.645) (-874.856) (-875.220) [-875.031] * [-876.560] (-875.385) (-875.960) (-874.882) -- 0:00:19
688000 -- [-877.583] (-873.880) (-878.211) (-880.225) * (-880.242) [-875.726] (-881.040) (-874.411) -- 0:00:19
688500 -- (-876.135) (-879.763) (-875.999) [-875.220] * (-877.382) (-874.348) [-876.571] (-877.985) -- 0:00:19
689000 -- [-876.382] (-875.659) (-876.793) (-876.346) * [-876.010] (-876.480) (-875.381) (-877.693) -- 0:00:18
689500 -- (-877.073) (-876.867) [-877.117] (-876.204) * (-878.064) (-879.674) (-877.432) [-875.601] -- 0:00:18
690000 -- (-875.719) (-876.544) (-877.560) [-874.480] * (-880.429) [-875.662] (-878.461) (-875.887) -- 0:00:18
Average standard deviation of split frequencies: 0.007917
690500 -- (-876.490) (-874.927) [-875.343] (-875.300) * (-879.322) (-875.815) (-875.164) [-875.577] -- 0:00:18
691000 -- (-875.543) [-874.995] (-879.059) (-873.835) * (-882.354) (-876.526) (-875.108) [-878.102] -- 0:00:18
691500 -- (-876.104) [-876.459] (-875.712) (-873.600) * (-878.944) [-875.963] (-875.126) (-878.255) -- 0:00:18
692000 -- (-875.456) (-875.253) [-876.635] (-874.106) * (-879.098) (-875.059) [-874.822] (-876.758) -- 0:00:18
692500 -- [-876.307] (-873.579) (-879.057) (-876.703) * (-876.754) [-875.388] (-876.615) (-878.232) -- 0:00:18
693000 -- [-874.724] (-874.267) (-879.296) (-875.181) * (-874.345) (-875.941) [-877.003] (-876.872) -- 0:00:18
693500 -- (-877.615) (-874.256) [-875.863] (-879.254) * (-881.747) [-874.286] (-874.847) (-877.121) -- 0:00:18
694000 -- [-874.494] (-875.265) (-877.923) (-875.281) * [-874.091] (-876.806) (-877.333) (-879.794) -- 0:00:18
694500 -- (-876.285) [-873.497] (-881.528) (-874.776) * (-874.728) (-876.210) (-874.486) [-878.207] -- 0:00:18
695000 -- (-876.659) (-878.427) [-876.825] (-874.917) * (-875.008) (-874.596) [-873.989] (-875.446) -- 0:00:18
Average standard deviation of split frequencies: 0.007812
695500 -- (-875.209) (-878.642) [-874.981] (-878.072) * (-875.351) (-875.728) (-875.139) [-875.534] -- 0:00:18
696000 -- (-876.954) (-874.946) [-873.862] (-874.404) * [-879.806] (-876.918) (-878.582) (-877.848) -- 0:00:18
696500 -- (-876.716) (-875.061) (-874.389) [-874.332] * (-876.270) [-873.893] (-875.066) (-876.201) -- 0:00:18
697000 -- (-874.127) (-873.976) [-877.203] (-874.132) * (-879.897) [-875.536] (-877.652) (-874.246) -- 0:00:18
697500 -- (-874.056) [-874.412] (-878.641) (-875.475) * (-874.149) (-875.537) (-877.783) [-873.756] -- 0:00:18
698000 -- (-878.613) [-875.072] (-878.807) (-878.677) * (-874.446) (-875.110) [-874.462] (-876.594) -- 0:00:18
698500 -- (-874.074) [-875.948] (-876.194) (-878.860) * [-874.728] (-874.418) (-876.428) (-878.122) -- 0:00:18
699000 -- (-874.192) (-874.904) (-874.458) [-874.798] * (-876.242) [-875.921] (-875.987) (-874.575) -- 0:00:18
699500 -- (-876.910) (-875.555) (-874.698) [-874.217] * (-876.308) (-877.365) [-875.294] (-876.742) -- 0:00:18
700000 -- (-875.737) [-874.926] (-875.503) (-876.289) * [-878.269] (-875.357) (-875.547) (-875.007) -- 0:00:18
Average standard deviation of split frequencies: 0.007849
700500 -- (-874.428) (-874.946) [-877.825] (-878.836) * (-875.234) [-874.789] (-875.294) (-875.017) -- 0:00:18
701000 -- [-874.967] (-883.424) (-874.600) (-874.704) * (-874.397) (-875.337) (-876.858) [-876.812] -- 0:00:18
701500 -- (-875.741) (-873.702) (-875.531) [-874.291] * (-876.709) (-876.451) (-877.412) [-876.626] -- 0:00:18
702000 -- (-875.772) (-874.823) (-880.494) [-877.577] * [-875.595] (-877.119) (-878.393) (-875.869) -- 0:00:18
702500 -- (-875.327) [-878.489] (-876.732) (-875.732) * (-874.879) (-882.672) (-878.180) [-873.754] -- 0:00:18
703000 -- (-874.701) (-881.599) [-875.754] (-873.982) * (-876.706) (-876.850) [-876.661] (-874.735) -- 0:00:18
703500 -- (-874.264) (-875.458) [-879.094] (-876.629) * (-874.918) (-876.606) (-874.587) [-874.522] -- 0:00:18
704000 -- (-874.451) [-874.300] (-877.524) (-875.517) * [-878.601] (-879.449) (-875.569) (-878.070) -- 0:00:18
704500 -- [-875.077] (-875.407) (-875.565) (-876.384) * [-875.241] (-875.991) (-874.701) (-877.056) -- 0:00:18
705000 -- (-874.553) (-874.618) (-874.145) [-877.531] * [-875.690] (-875.235) (-875.114) (-878.030) -- 0:00:17
Average standard deviation of split frequencies: 0.007968
705500 -- [-873.903] (-875.960) (-878.280) (-876.330) * [-874.526] (-881.704) (-876.192) (-875.103) -- 0:00:17
706000 -- [-875.547] (-877.191) (-877.674) (-877.312) * (-874.755) [-876.741] (-878.670) (-874.562) -- 0:00:17
706500 -- [-874.612] (-875.566) (-875.609) (-875.213) * [-875.726] (-878.021) (-877.004) (-875.512) -- 0:00:17
707000 -- (-877.875) (-874.277) [-875.634] (-875.494) * (-881.037) [-875.187] (-874.890) (-874.987) -- 0:00:17
707500 -- (-873.775) (-874.787) [-873.769] (-874.505) * (-878.182) (-874.749) [-873.994] (-874.926) -- 0:00:17
708000 -- [-873.386] (-873.774) (-873.801) (-875.250) * [-875.175] (-876.957) (-876.334) (-874.125) -- 0:00:17
708500 -- [-873.956] (-874.881) (-873.885) (-875.861) * [-875.315] (-879.074) (-877.576) (-877.569) -- 0:00:17
709000 -- (-874.076) [-873.929] (-873.885) (-878.327) * (-875.860) (-875.534) [-879.972] (-874.522) -- 0:00:17
709500 -- (-874.320) (-874.642) (-879.813) [-874.595] * (-875.582) [-874.446] (-878.703) (-879.888) -- 0:00:17
710000 -- (-874.044) [-875.306] (-878.968) (-873.441) * (-874.621) (-877.290) [-876.560] (-877.118) -- 0:00:17
Average standard deviation of split frequencies: 0.007380
710500 -- [-876.318] (-876.721) (-876.659) (-874.370) * (-876.068) (-879.182) (-876.276) [-877.741] -- 0:00:17
711000 -- [-874.629] (-876.819) (-876.449) (-875.820) * [-876.771] (-877.852) (-876.712) (-878.486) -- 0:00:17
711500 -- (-875.734) (-875.000) (-875.314) [-878.112] * (-876.105) (-877.180) (-875.963) [-877.391] -- 0:00:17
712000 -- (-875.071) (-875.902) [-875.193] (-876.394) * [-877.168] (-876.264) (-876.937) (-874.290) -- 0:00:17
712500 -- (-874.231) (-875.102) [-874.462] (-875.482) * [-874.975] (-877.904) (-878.024) (-877.325) -- 0:00:17
713000 -- (-873.815) (-876.503) (-877.442) [-875.122] * (-875.859) (-876.446) [-875.805] (-879.114) -- 0:00:17
713500 -- (-873.815) [-874.634] (-875.942) (-874.071) * (-878.583) (-876.913) (-878.652) [-878.322] -- 0:00:17
714000 -- (-875.394) (-875.464) (-874.922) [-877.702] * (-876.103) (-881.002) [-874.474] (-879.733) -- 0:00:17
714500 -- (-873.587) (-874.588) [-876.533] (-880.872) * (-876.392) (-877.861) [-873.849] (-875.416) -- 0:00:17
715000 -- [-874.817] (-874.646) (-874.086) (-875.914) * (-873.817) [-876.069] (-874.239) (-875.291) -- 0:00:17
Average standard deviation of split frequencies: 0.007242
715500 -- (-874.011) (-877.853) (-874.132) [-875.230] * (-875.540) [-874.595] (-873.771) (-880.463) -- 0:00:17
716000 -- [-874.257] (-873.865) (-875.573) (-874.804) * [-877.164] (-874.654) (-875.241) (-875.912) -- 0:00:17
716500 -- [-874.723] (-874.477) (-875.560) (-875.128) * [-877.087] (-873.865) (-875.993) (-873.992) -- 0:00:17
717000 -- (-876.136) (-876.121) [-875.549] (-874.219) * (-880.499) [-874.142] (-875.495) (-874.562) -- 0:00:17
717500 -- (-875.021) [-878.353] (-877.308) (-881.970) * (-881.610) (-876.857) (-877.521) [-876.864] -- 0:00:17
718000 -- [-876.226] (-878.992) (-875.950) (-874.316) * [-875.087] (-877.661) (-878.021) (-874.246) -- 0:00:17
718500 -- [-875.214] (-876.740) (-876.071) (-880.338) * (-875.724) (-875.321) [-876.445] (-874.405) -- 0:00:17
719000 -- (-881.167) [-873.770] (-875.744) (-876.762) * (-874.055) (-875.195) (-875.048) [-875.134] -- 0:00:17
719500 -- [-875.547] (-874.439) (-875.699) (-875.608) * (-877.644) (-876.923) (-875.274) [-875.100] -- 0:00:17
720000 -- [-875.264] (-874.723) (-876.160) (-874.963) * (-882.165) [-874.105] (-877.819) (-874.332) -- 0:00:17
Average standard deviation of split frequencies: 0.006705
720500 -- (-875.455) (-874.902) [-876.292] (-874.660) * [-878.193] (-874.086) (-877.074) (-874.580) -- 0:00:17
721000 -- (-876.591) [-875.394] (-878.956) (-875.048) * (-875.733) (-875.183) (-877.095) [-875.090] -- 0:00:17
721500 -- (-874.110) [-876.188] (-877.597) (-878.868) * [-874.340] (-875.870) (-876.192) (-874.794) -- 0:00:16
722000 -- (-875.622) [-874.073] (-875.967) (-875.388) * (-879.052) [-876.441] (-876.615) (-877.074) -- 0:00:16
722500 -- (-874.069) (-875.912) (-878.031) [-874.115] * (-875.495) (-875.689) (-875.595) [-875.108] -- 0:00:16
723000 -- (-874.069) (-878.608) (-877.222) [-875.875] * (-877.179) (-874.868) (-876.568) [-878.740] -- 0:00:16
723500 -- (-874.069) (-877.058) (-876.908) [-876.245] * [-877.635] (-878.774) (-873.652) (-876.521) -- 0:00:16
724000 -- (-873.577) (-876.580) (-877.606) [-875.467] * (-874.534) (-877.949) [-875.055] (-875.417) -- 0:00:16
724500 -- (-876.026) (-881.630) (-875.881) [-875.183] * [-874.299] (-879.538) (-874.909) (-877.801) -- 0:00:16
725000 -- [-876.556] (-882.081) (-873.733) (-878.358) * (-874.325) (-875.503) (-874.703) [-876.199] -- 0:00:16
Average standard deviation of split frequencies: 0.007264
725500 -- (-874.630) [-874.600] (-875.839) (-884.665) * (-874.332) [-875.300] (-875.555) (-874.228) -- 0:00:16
726000 -- (-875.542) (-875.391) [-874.689] (-875.049) * (-874.291) (-875.181) [-874.502] (-874.081) -- 0:00:16
726500 -- (-877.454) [-875.951] (-875.537) (-876.091) * (-874.685) [-876.002] (-877.233) (-874.574) -- 0:00:16
727000 -- (-877.012) (-876.153) (-879.222) [-875.812] * (-874.774) (-876.489) [-874.637] (-873.874) -- 0:00:16
727500 -- (-881.190) (-875.685) [-874.739] (-875.320) * (-878.151) (-876.346) [-874.186] (-876.529) -- 0:00:16
728000 -- (-875.221) (-874.751) (-874.290) [-875.149] * [-875.113] (-876.240) (-874.652) (-876.828) -- 0:00:16
728500 -- (-876.425) [-878.670] (-880.079) (-875.439) * (-876.817) (-877.453) [-877.082] (-876.706) -- 0:00:16
729000 -- (-874.343) [-874.816] (-877.153) (-876.050) * (-874.183) (-877.837) [-874.254] (-879.809) -- 0:00:16
729500 -- [-876.507] (-875.617) (-876.621) (-875.389) * (-878.549) (-874.920) [-876.229] (-879.127) -- 0:00:16
730000 -- (-877.765) (-873.739) [-875.074] (-877.196) * [-876.121] (-875.774) (-875.472) (-879.609) -- 0:00:16
Average standard deviation of split frequencies: 0.006895
730500 -- (-874.258) [-873.887] (-877.673) (-874.861) * [-877.151] (-875.911) (-874.082) (-876.015) -- 0:00:16
731000 -- [-876.912] (-875.968) (-876.877) (-875.780) * [-876.901] (-876.978) (-873.987) (-875.695) -- 0:00:16
731500 -- (-878.442) [-876.392] (-873.910) (-875.484) * (-876.411) (-875.255) [-876.030] (-876.000) -- 0:00:16
732000 -- (-874.462) (-876.944) (-874.649) [-874.640] * (-875.747) [-874.342] (-877.028) (-874.921) -- 0:00:16
732500 -- (-876.789) [-875.378] (-874.612) (-874.974) * (-877.537) [-882.248] (-874.443) (-875.488) -- 0:00:16
733000 -- (-875.458) (-875.047) (-875.471) [-876.681] * [-875.704] (-876.879) (-874.845) (-874.390) -- 0:00:16
733500 -- (-876.634) (-876.549) (-874.811) [-876.304] * (-876.137) (-876.515) (-875.986) [-874.161] -- 0:00:16
734000 -- (-876.891) (-877.946) (-875.505) [-876.193] * (-879.128) (-876.692) (-883.449) [-874.861] -- 0:00:16
734500 -- (-876.469) (-875.190) (-875.010) [-874.361] * (-878.908) (-874.827) (-877.964) [-874.495] -- 0:00:16
735000 -- (-876.433) (-874.929) (-875.689) [-874.156] * (-874.785) [-877.577] (-876.512) (-874.355) -- 0:00:16
Average standard deviation of split frequencies: 0.006925
735500 -- [-876.719] (-876.768) (-877.124) (-874.235) * (-875.535) (-875.192) (-875.779) [-875.334] -- 0:00:16
736000 -- (-877.463) [-876.619] (-876.084) (-874.263) * [-874.839] (-876.145) (-879.569) (-875.186) -- 0:00:16
736500 -- [-874.241] (-874.594) (-873.891) (-875.972) * (-875.263) (-876.440) (-878.366) [-874.502] -- 0:00:16
737000 -- [-873.930] (-874.148) (-873.650) (-876.138) * (-877.865) (-875.201) (-874.932) [-877.937] -- 0:00:16
737500 -- (-876.337) (-874.742) [-874.878] (-878.795) * (-874.462) (-876.138) [-876.158] (-875.985) -- 0:00:16
738000 -- (-876.558) [-875.697] (-874.989) (-873.981) * (-878.088) (-878.920) [-875.749] (-875.348) -- 0:00:15
738500 -- [-874.498] (-874.676) (-877.293) (-873.596) * [-874.303] (-876.939) (-877.103) (-879.548) -- 0:00:15
739000 -- (-874.799) (-878.972) [-875.382] (-877.104) * (-874.272) (-875.635) (-875.492) [-878.469] -- 0:00:15
739500 -- [-877.885] (-876.077) (-875.498) (-877.551) * [-875.608] (-875.224) (-876.403) (-874.149) -- 0:00:15
740000 -- (-874.640) [-878.156] (-874.991) (-875.210) * (-877.601) (-875.028) (-876.041) [-874.626] -- 0:00:15
Average standard deviation of split frequencies: 0.006874
740500 -- (-874.693) (-876.061) (-874.083) [-875.240] * (-879.123) (-875.058) [-875.749] (-875.056) -- 0:00:15
741000 -- [-876.648] (-873.908) (-874.400) (-876.788) * (-876.113) (-876.284) [-875.406] (-874.299) -- 0:00:15
741500 -- [-876.105] (-878.048) (-875.126) (-874.942) * (-875.610) [-874.800] (-877.602) (-874.756) -- 0:00:15
742000 -- (-877.935) [-875.153] (-875.145) (-874.371) * [-874.913] (-877.053) (-877.569) (-875.285) -- 0:00:15
742500 -- (-876.562) [-874.418] (-874.741) (-875.483) * (-874.930) (-875.183) [-878.006] (-874.622) -- 0:00:15
743000 -- (-876.250) (-876.053) (-877.074) [-875.977] * (-874.847) (-874.317) (-876.982) [-875.398] -- 0:00:15
743500 -- (-874.605) [-876.840] (-876.666) (-879.689) * (-879.538) [-875.784] (-875.061) (-875.397) -- 0:00:15
744000 -- (-880.347) (-874.253) [-874.942] (-874.884) * [-877.545] (-877.224) (-874.685) (-875.372) -- 0:00:15
744500 -- (-878.069) (-874.357) (-876.909) [-874.697] * [-875.598] (-875.938) (-878.637) (-875.534) -- 0:00:15
745000 -- (-882.012) (-874.403) [-875.057] (-875.651) * (-877.600) (-878.724) [-873.818] (-874.805) -- 0:00:15
Average standard deviation of split frequencies: 0.006833
745500 -- (-877.177) (-874.060) (-875.386) [-877.089] * [-874.741] (-874.738) (-873.609) (-876.811) -- 0:00:15
746000 -- (-876.542) [-875.301] (-875.587) (-875.466) * (-875.507) (-876.752) [-877.044] (-875.497) -- 0:00:15
746500 -- (-876.354) (-877.285) (-875.362) [-875.557] * [-875.947] (-881.018) (-873.988) (-875.561) -- 0:00:15
747000 -- (-875.834) (-878.073) [-880.298] (-876.017) * [-874.114] (-876.527) (-877.827) (-874.539) -- 0:00:15
747500 -- [-874.452] (-876.297) (-879.152) (-879.449) * (-875.955) (-875.395) (-874.779) [-876.590] -- 0:00:15
748000 -- [-879.711] (-876.088) (-877.764) (-880.074) * (-876.243) (-877.982) (-875.231) [-874.686] -- 0:00:15
748500 -- [-877.179] (-878.136) (-876.937) (-877.599) * (-875.162) [-875.759] (-875.826) (-874.585) -- 0:00:15
749000 -- (-877.345) (-879.187) (-874.419) [-874.038] * (-877.853) (-875.547) (-876.025) [-873.980] -- 0:00:15
749500 -- (-874.778) (-876.335) (-874.446) [-874.848] * (-874.653) (-874.761) [-873.700] (-874.622) -- 0:00:15
750000 -- (-874.780) (-876.259) [-873.455] (-875.820) * (-876.624) (-875.117) [-874.445] (-876.092) -- 0:00:15
Average standard deviation of split frequencies: 0.006437
750500 -- (-874.901) (-873.565) [-875.774] (-877.642) * [-875.408] (-874.970) (-875.485) (-875.717) -- 0:00:15
751000 -- [-874.083] (-875.223) (-874.951) (-874.818) * (-877.321) (-878.218) (-876.011) [-878.577] -- 0:00:15
751500 -- (-875.740) [-874.451] (-874.805) (-876.883) * (-874.444) [-875.373] (-873.871) (-877.227) -- 0:00:15
752000 -- (-874.610) [-880.104] (-876.651) (-876.229) * (-874.756) (-874.605) [-875.409] (-876.341) -- 0:00:15
752500 -- [-874.804] (-875.850) (-884.104) (-874.291) * [-874.558] (-876.016) (-874.199) (-880.174) -- 0:00:15
753000 -- [-875.779] (-876.389) (-879.438) (-873.729) * (-874.121) [-875.032] (-873.809) (-880.437) -- 0:00:15
753500 -- [-874.948] (-876.307) (-874.692) (-874.980) * [-875.575] (-875.452) (-875.622) (-879.142) -- 0:00:15
754000 -- [-874.394] (-874.771) (-874.555) (-875.937) * (-874.783) [-877.609] (-875.025) (-877.491) -- 0:00:15
754500 -- [-877.113] (-874.744) (-875.219) (-875.538) * (-874.248) [-875.027] (-875.265) (-876.756) -- 0:00:14
755000 -- [-876.599] (-876.355) (-875.965) (-874.114) * (-875.370) [-873.602] (-875.396) (-875.240) -- 0:00:14
Average standard deviation of split frequencies: 0.006402
755500 -- (-875.353) (-878.445) (-873.887) [-875.484] * [-876.803] (-875.300) (-876.234) (-876.468) -- 0:00:14
756000 -- (-876.690) [-873.809] (-875.076) (-874.545) * (-875.852) [-874.972] (-877.390) (-876.175) -- 0:00:14
756500 -- (-874.247) [-874.835] (-874.417) (-874.850) * (-875.394) (-875.518) (-875.123) [-877.487] -- 0:00:14
757000 -- [-880.962] (-874.765) (-882.062) (-876.271) * [-875.057] (-875.963) (-875.020) (-874.580) -- 0:00:14
757500 -- (-878.350) (-876.298) [-873.894] (-878.812) * (-873.831) (-875.984) [-878.318] (-876.473) -- 0:00:14
758000 -- [-878.867] (-875.047) (-874.461) (-877.552) * (-875.172) (-874.884) [-876.856] (-880.490) -- 0:00:14
758500 -- (-876.988) (-878.422) [-874.035] (-876.591) * (-876.979) (-877.147) [-874.468] (-876.078) -- 0:00:14
759000 -- (-876.725) (-874.870) (-874.733) [-877.862] * [-874.883] (-874.413) (-879.546) (-875.556) -- 0:00:14
759500 -- (-876.151) (-874.490) [-874.588] (-882.195) * (-874.083) [-875.146] (-874.068) (-874.799) -- 0:00:14
760000 -- (-877.818) [-873.929] (-877.113) (-877.339) * (-879.635) (-873.823) (-874.754) [-874.799] -- 0:00:14
Average standard deviation of split frequencies: 0.006156
760500 -- (-876.411) (-874.963) [-875.156] (-877.313) * (-877.142) (-876.935) (-877.858) [-874.002] -- 0:00:14
761000 -- [-875.899] (-877.435) (-875.094) (-878.252) * (-876.114) (-877.418) (-878.423) [-876.394] -- 0:00:14
761500 -- (-874.122) (-878.429) [-874.883] (-874.522) * (-876.178) (-874.735) [-877.641] (-873.600) -- 0:00:14
762000 -- (-876.561) (-877.009) [-875.049] (-874.318) * (-876.246) (-875.082) (-879.505) [-875.989] -- 0:00:14
762500 -- [-878.537] (-875.102) (-876.191) (-874.061) * (-876.894) (-874.256) [-878.285] (-881.601) -- 0:00:14
763000 -- (-876.590) [-880.223] (-875.831) (-874.548) * (-876.264) (-876.253) (-875.927) [-878.513] -- 0:00:14
763500 -- [-875.373] (-876.080) (-876.782) (-874.676) * [-874.223] (-873.464) (-873.972) (-876.565) -- 0:00:14
764000 -- [-876.190] (-875.692) (-875.462) (-881.150) * (-875.620) (-877.911) (-875.953) [-876.311] -- 0:00:14
764500 -- [-876.656] (-876.348) (-877.420) (-880.769) * (-874.877) (-875.343) (-875.468) [-873.989] -- 0:00:14
765000 -- (-876.256) [-874.689] (-874.670) (-876.519) * (-875.515) [-877.357] (-875.740) (-875.771) -- 0:00:14
Average standard deviation of split frequencies: 0.005621
765500 -- [-878.248] (-876.064) (-876.211) (-876.240) * (-875.545) (-874.543) (-874.153) [-875.394] -- 0:00:14
766000 -- (-874.053) (-873.631) [-875.073] (-877.399) * (-875.407) [-873.632] (-875.690) (-874.099) -- 0:00:14
766500 -- (-873.974) (-875.385) [-873.948] (-878.102) * (-876.688) [-873.999] (-875.744) (-876.752) -- 0:00:14
767000 -- [-875.619] (-874.848) (-874.575) (-875.612) * [-875.597] (-874.897) (-874.803) (-873.706) -- 0:00:14
767500 -- (-877.869) (-877.383) [-876.975] (-874.502) * (-877.150) [-874.963] (-874.688) (-873.630) -- 0:00:14
768000 -- (-875.728) [-876.810] (-874.984) (-875.947) * [-876.974] (-874.635) (-873.737) (-875.408) -- 0:00:14
768500 -- [-878.311] (-875.213) (-874.801) (-879.530) * [-878.588] (-877.524) (-874.213) (-876.173) -- 0:00:14
769000 -- (-879.017) (-875.806) (-875.357) [-874.177] * [-875.488] (-875.216) (-876.362) (-877.887) -- 0:00:14
769500 -- (-877.985) [-875.942] (-876.666) (-874.960) * (-876.664) (-876.972) [-878.008] (-873.630) -- 0:00:14
770000 -- (-878.269) (-876.698) [-876.231] (-874.063) * [-877.623] (-876.456) (-874.971) (-874.274) -- 0:00:14
Average standard deviation of split frequencies: 0.005831
770500 -- (-877.279) (-877.063) (-880.633) [-874.185] * (-875.956) (-877.312) [-873.958] (-876.273) -- 0:00:13
771000 -- [-876.984] (-879.638) (-874.768) (-874.168) * (-876.868) (-875.436) (-873.771) [-873.849] -- 0:00:13
771500 -- (-876.905) (-876.487) (-874.416) [-878.484] * [-876.176] (-875.988) (-876.053) (-878.351) -- 0:00:13
772000 -- [-874.752] (-875.176) (-877.068) (-875.718) * [-876.313] (-874.718) (-876.615) (-879.751) -- 0:00:13
772500 -- (-878.706) [-874.387] (-875.828) (-877.961) * (-874.486) (-875.118) [-878.711] (-879.142) -- 0:00:13
773000 -- (-877.288) [-873.625] (-875.334) (-876.187) * (-874.307) (-873.563) [-877.611] (-878.613) -- 0:00:13
773500 -- [-874.190] (-874.723) (-874.159) (-874.678) * (-876.265) [-876.352] (-874.118) (-874.718) -- 0:00:13
774000 -- (-880.232) (-874.740) [-875.779] (-878.883) * [-873.982] (-875.252) (-875.184) (-876.401) -- 0:00:13
774500 -- [-877.347] (-874.591) (-875.969) (-875.707) * [-878.886] (-876.010) (-875.438) (-877.492) -- 0:00:13
775000 -- (-878.173) (-874.435) [-876.214] (-876.291) * (-873.924) [-874.306] (-876.236) (-874.491) -- 0:00:13
Average standard deviation of split frequencies: 0.005994
775500 -- (-874.313) [-875.263] (-874.620) (-875.043) * (-876.578) [-877.616] (-873.986) (-875.761) -- 0:00:13
776000 -- (-874.118) [-874.478] (-875.426) (-875.006) * (-874.210) (-876.718) [-874.568] (-874.874) -- 0:00:13
776500 -- (-875.159) (-876.646) (-875.088) [-878.567] * (-877.012) (-876.161) [-875.059] (-876.156) -- 0:00:13
777000 -- (-880.208) (-877.563) (-874.157) [-874.908] * [-876.146] (-880.588) (-875.373) (-879.184) -- 0:00:13
777500 -- (-877.178) [-874.210] (-873.944) (-879.115) * [-877.230] (-875.857) (-874.771) (-873.902) -- 0:00:13
778000 -- (-876.795) (-874.274) (-874.113) [-873.999] * [-877.393] (-874.528) (-878.505) (-879.840) -- 0:00:13
778500 -- (-874.270) [-874.552] (-874.590) (-873.608) * [-874.034] (-873.647) (-875.640) (-876.991) -- 0:00:13
779000 -- (-874.731) [-875.518] (-874.716) (-874.254) * (-875.907) [-875.495] (-874.028) (-874.478) -- 0:00:13
779500 -- [-873.539] (-875.704) (-878.130) (-876.220) * (-876.105) (-874.556) [-873.730] (-879.404) -- 0:00:13
780000 -- (-876.186) (-875.961) (-875.642) [-874.488] * (-875.474) (-873.915) [-873.776] (-878.127) -- 0:00:13
Average standard deviation of split frequencies: 0.006441
780500 -- (-874.683) (-874.767) [-876.992] (-877.679) * [-875.858] (-875.226) (-874.913) (-875.318) -- 0:00:13
781000 -- (-874.684) (-874.506) [-876.556] (-875.536) * (-877.507) (-874.196) [-874.254] (-874.820) -- 0:00:13
781500 -- (-875.357) (-880.156) (-880.324) [-875.735] * (-875.189) (-875.711) (-875.906) [-875.414] -- 0:00:13
782000 -- (-876.039) (-875.473) [-875.521] (-875.296) * (-876.596) (-876.537) [-874.409] (-876.855) -- 0:00:13
782500 -- (-879.239) (-875.766) (-876.320) [-879.089] * (-875.416) (-874.995) [-875.414] (-876.842) -- 0:00:13
783000 -- (-876.159) (-874.141) [-873.783] (-881.407) * [-875.185] (-876.552) (-875.644) (-875.679) -- 0:00:13
783500 -- [-874.786] (-874.329) (-873.633) (-880.110) * (-874.552) [-877.851] (-875.818) (-874.666) -- 0:00:13
784000 -- (-877.198) (-876.409) [-875.410] (-875.228) * [-874.329] (-875.552) (-875.764) (-875.914) -- 0:00:13
784500 -- (-876.291) (-877.521) [-874.718] (-874.698) * [-873.818] (-875.548) (-875.449) (-876.597) -- 0:00:13
785000 -- (-879.272) (-874.831) [-874.460] (-875.444) * (-875.124) [-878.566] (-876.222) (-876.232) -- 0:00:13
Average standard deviation of split frequencies: 0.006437
785500 -- (-879.752) (-877.461) [-878.100] (-874.995) * (-874.146) [-873.402] (-876.535) (-873.914) -- 0:00:13
786000 -- [-876.367] (-879.657) (-878.077) (-873.355) * (-874.489) [-873.431] (-884.576) (-875.503) -- 0:00:13
786500 -- (-874.971) (-876.018) (-875.707) [-873.693] * (-876.373) (-876.504) [-877.946] (-874.269) -- 0:00:13
787000 -- (-879.394) (-874.436) (-874.375) [-874.440] * (-874.565) (-874.641) (-874.776) [-877.274] -- 0:00:12
787500 -- (-875.397) [-875.754] (-874.706) (-874.987) * (-874.293) (-878.443) [-875.992] (-875.339) -- 0:00:12
788000 -- (-876.961) (-874.489) (-878.568) [-873.565] * (-873.841) (-876.444) (-874.841) [-875.927] -- 0:00:12
788500 -- (-875.284) [-875.162] (-875.748) (-874.996) * (-876.845) (-876.004) [-875.140] (-874.502) -- 0:00:12
789000 -- (-874.484) [-876.260] (-874.526) (-878.081) * (-874.152) (-875.648) [-875.241] (-874.132) -- 0:00:12
789500 -- (-874.821) (-875.624) (-874.265) [-878.922] * (-877.207) [-876.638] (-875.302) (-874.315) -- 0:00:12
790000 -- (-878.810) (-876.015) [-877.931] (-880.079) * [-874.044] (-877.360) (-878.345) (-874.946) -- 0:00:12
Average standard deviation of split frequencies: 0.006320
790500 -- [-877.074] (-874.190) (-875.448) (-877.587) * (-875.096) [-877.394] (-876.460) (-874.838) -- 0:00:12
791000 -- (-875.591) (-874.468) [-876.314] (-878.544) * (-875.694) (-876.877) (-875.756) [-877.372] -- 0:00:12
791500 -- (-878.953) (-876.199) [-876.807] (-875.994) * (-874.705) (-876.974) [-875.350] (-874.980) -- 0:00:12
792000 -- [-873.984] (-877.673) (-877.895) (-875.347) * (-876.672) (-874.709) [-874.239] (-874.906) -- 0:00:12
792500 -- (-873.776) (-877.537) (-875.908) [-874.667] * (-875.804) [-875.972] (-874.073) (-875.349) -- 0:00:12
793000 -- (-880.743) (-873.766) (-875.832) [-875.950] * (-874.229) (-876.816) [-874.310] (-874.283) -- 0:00:12
793500 -- [-876.812] (-875.700) (-873.852) (-877.874) * [-874.802] (-877.206) (-876.582) (-873.606) -- 0:00:12
794000 -- (-877.238) (-877.540) [-878.048] (-876.250) * (-875.591) (-883.828) [-875.625] (-878.272) -- 0:00:12
794500 -- [-875.278] (-874.653) (-873.480) (-875.305) * (-875.411) (-876.232) (-875.660) [-874.834] -- 0:00:12
795000 -- [-874.351] (-874.724) (-873.451) (-876.454) * (-875.562) (-874.375) (-874.915) [-873.569] -- 0:00:12
Average standard deviation of split frequencies: 0.006593
795500 -- (-877.600) [-874.889] (-873.724) (-876.821) * [-874.761] (-874.348) (-881.271) (-876.869) -- 0:00:12
796000 -- (-876.912) (-875.571) [-875.844] (-875.477) * [-874.194] (-876.802) (-877.084) (-875.365) -- 0:00:12
796500 -- (-873.665) [-877.741] (-874.937) (-876.060) * [-876.672] (-877.155) (-880.904) (-879.873) -- 0:00:12
797000 -- [-874.980] (-874.884) (-875.610) (-876.743) * (-873.615) (-875.854) (-879.386) [-874.281] -- 0:00:12
797500 -- (-876.947) (-877.875) [-875.859] (-875.016) * [-874.664] (-878.792) (-874.721) (-878.403) -- 0:00:12
798000 -- (-879.550) (-875.273) (-878.495) [-876.438] * [-874.499] (-874.182) (-878.475) (-876.739) -- 0:00:12
798500 -- (-876.766) [-875.789] (-875.082) (-873.845) * (-874.749) [-875.124] (-876.718) (-877.984) -- 0:00:12
799000 -- (-875.864) [-877.051] (-876.419) (-874.233) * (-878.428) (-876.484) [-879.846] (-876.247) -- 0:00:12
799500 -- (-874.131) (-874.555) (-874.794) [-873.778] * (-875.025) (-873.579) [-873.657] (-877.958) -- 0:00:12
800000 -- [-876.290] (-880.795) (-874.504) (-878.079) * (-873.806) [-874.200] (-874.590) (-875.710) -- 0:00:12
Average standard deviation of split frequencies: 0.006359
800500 -- [-875.740] (-877.459) (-880.468) (-876.196) * (-874.979) (-875.080) [-875.120] (-879.756) -- 0:00:12
801000 -- (-879.257) (-876.417) (-875.793) [-874.680] * [-879.029] (-875.788) (-878.488) (-873.837) -- 0:00:12
801500 -- [-876.876] (-874.223) (-877.193) (-875.679) * (-877.373) [-875.842] (-882.449) (-878.508) -- 0:00:12
802000 -- (-877.297) (-873.664) [-873.676] (-875.727) * (-875.562) (-878.249) [-877.127] (-874.496) -- 0:00:12
802500 -- (-875.407) [-873.767] (-875.930) (-875.449) * (-877.190) (-875.060) (-879.625) [-878.010] -- 0:00:12
803000 -- (-877.661) [-875.604] (-875.389) (-879.879) * (-874.993) (-878.576) [-874.965] (-875.866) -- 0:00:12
803500 -- [-875.559] (-876.237) (-875.208) (-877.642) * (-873.545) (-873.953) (-873.723) [-874.949] -- 0:00:11
804000 -- (-874.675) [-874.668] (-875.286) (-879.836) * [-874.180] (-877.367) (-873.867) (-874.345) -- 0:00:11
804500 -- (-873.591) (-873.724) (-877.452) [-875.148] * (-874.820) (-877.137) [-875.020] (-875.621) -- 0:00:11
805000 -- (-874.552) (-876.137) [-876.897] (-874.910) * (-875.247) (-873.820) (-875.562) [-873.681] -- 0:00:11
Average standard deviation of split frequencies: 0.006278
805500 -- (-874.842) [-874.906] (-874.261) (-877.087) * [-874.180] (-877.350) (-875.494) (-873.777) -- 0:00:11
806000 -- (-877.230) [-875.230] (-875.109) (-875.219) * (-875.507) (-876.106) [-877.025] (-873.779) -- 0:00:11
806500 -- [-878.133] (-876.060) (-874.993) (-882.208) * (-875.674) [-874.737] (-876.310) (-876.987) -- 0:00:11
807000 -- [-875.923] (-875.307) (-875.525) (-877.108) * (-876.683) (-875.853) (-877.383) [-878.076] -- 0:00:11
807500 -- (-878.281) (-873.683) (-877.504) [-879.457] * (-874.586) (-873.854) (-877.516) [-873.348] -- 0:00:11
808000 -- (-875.103) (-873.563) (-875.425) [-877.377] * (-874.865) (-875.084) (-879.626) [-875.564] -- 0:00:11
808500 -- (-875.109) (-875.735) (-875.973) [-873.870] * (-878.236) [-874.599] (-875.898) (-874.542) -- 0:00:11
809000 -- [-875.085] (-874.102) (-875.456) (-874.140) * (-880.337) (-874.506) [-879.482] (-874.875) -- 0:00:11
809500 -- [-876.193] (-873.706) (-875.170) (-879.833) * (-876.902) (-874.431) [-876.911] (-881.407) -- 0:00:11
810000 -- (-873.745) [-873.985] (-878.883) (-875.401) * (-878.539) (-875.197) (-880.100) [-875.700] -- 0:00:11
Average standard deviation of split frequencies: 0.006280
810500 -- (-874.344) (-876.213) [-874.239] (-877.077) * (-876.382) (-875.307) [-877.615] (-878.684) -- 0:00:11
811000 -- (-875.710) (-879.037) [-875.351] (-877.658) * [-874.324] (-878.937) (-878.765) (-876.427) -- 0:00:11
811500 -- (-877.032) [-876.176] (-879.387) (-875.301) * (-875.062) (-875.051) [-877.473] (-875.333) -- 0:00:11
812000 -- (-876.436) [-876.305] (-875.646) (-875.286) * [-873.602] (-874.067) (-875.659) (-875.892) -- 0:00:11
812500 -- (-878.539) (-877.725) (-875.100) [-875.526] * (-874.585) (-878.126) (-876.117) [-874.205] -- 0:00:11
813000 -- (-874.362) [-875.165] (-877.803) (-878.079) * [-877.837] (-875.853) (-874.885) (-879.544) -- 0:00:11
813500 -- [-874.735] (-875.938) (-877.916) (-878.375) * [-874.856] (-875.999) (-876.258) (-876.346) -- 0:00:11
814000 -- [-874.302] (-875.041) (-876.526) (-875.668) * (-878.984) (-877.003) (-874.394) [-878.023] -- 0:00:11
814500 -- [-876.470] (-881.005) (-874.560) (-874.425) * (-875.397) [-876.861] (-880.340) (-878.674) -- 0:00:11
815000 -- (-874.451) (-875.498) [-875.914] (-874.927) * (-874.539) (-877.565) (-878.925) [-875.008] -- 0:00:11
Average standard deviation of split frequencies: 0.006124
815500 -- (-874.837) [-874.944] (-876.857) (-876.728) * (-873.915) (-876.664) (-878.145) [-874.581] -- 0:00:11
816000 -- (-875.649) (-875.315) [-874.448] (-875.596) * (-875.529) (-876.497) [-877.707] (-874.416) -- 0:00:11
816500 -- (-875.175) [-876.613] (-877.679) (-874.497) * (-875.135) [-877.383] (-875.988) (-877.327) -- 0:00:11
817000 -- [-874.979] (-876.172) (-874.842) (-875.304) * [-875.621] (-875.505) (-875.406) (-874.666) -- 0:00:11
817500 -- (-874.912) (-878.796) [-875.728] (-875.053) * (-877.596) [-875.341] (-876.758) (-877.625) -- 0:00:11
818000 -- [-880.288] (-876.003) (-877.177) (-876.803) * (-875.960) (-876.363) [-878.324] (-877.288) -- 0:00:11
818500 -- (-874.779) (-875.959) (-877.108) [-875.259] * (-875.288) (-876.953) [-875.203] (-875.242) -- 0:00:11
819000 -- (-877.044) (-873.892) (-875.785) [-875.353] * [-876.202] (-873.810) (-873.685) (-876.905) -- 0:00:11
819500 -- (-873.811) [-876.466] (-874.555) (-877.043) * (-873.928) (-876.625) (-874.982) [-875.136] -- 0:00:11
820000 -- (-876.458) (-875.064) (-873.850) [-877.815] * [-874.469] (-876.386) (-874.975) (-876.044) -- 0:00:10
Average standard deviation of split frequencies: 0.006242
820500 -- (-874.474) (-874.698) (-876.666) [-874.841] * (-876.197) (-874.854) [-875.973] (-874.720) -- 0:00:10
821000 -- (-874.265) [-875.604] (-873.657) (-874.698) * (-876.538) [-874.848] (-875.856) (-875.218) -- 0:00:10
821500 -- (-879.663) (-877.079) [-873.976] (-873.986) * (-875.649) [-876.788] (-875.587) (-875.142) -- 0:00:10
822000 -- (-880.121) [-876.112] (-877.050) (-876.587) * (-876.895) (-876.307) [-874.812] (-874.517) -- 0:00:10
822500 -- (-877.836) (-875.139) [-875.206] (-876.165) * (-877.228) [-875.578] (-877.134) (-874.620) -- 0:00:10
823000 -- (-875.313) (-877.368) (-878.900) [-874.842] * [-879.190] (-878.265) (-876.182) (-876.249) -- 0:00:10
823500 -- (-874.297) (-875.236) (-876.175) [-874.251] * (-879.679) [-874.329] (-875.648) (-874.269) -- 0:00:10
824000 -- [-875.001] (-875.432) (-873.829) (-873.875) * (-876.200) (-873.733) (-878.188) [-875.511] -- 0:00:10
824500 -- (-875.084) [-876.729] (-876.287) (-875.394) * (-877.850) (-873.822) [-877.345] (-877.829) -- 0:00:10
825000 -- (-875.809) [-877.473] (-876.126) (-876.773) * (-875.295) [-876.523] (-876.913) (-876.074) -- 0:00:10
Average standard deviation of split frequencies: 0.005707
825500 -- (-875.998) [-875.795] (-876.669) (-874.631) * [-874.489] (-873.662) (-875.920) (-880.443) -- 0:00:10
826000 -- (-874.670) (-875.552) (-878.814) [-875.905] * (-874.160) [-876.960] (-874.158) (-879.942) -- 0:00:10
826500 -- (-877.017) (-876.111) [-873.843] (-875.675) * (-874.642) (-875.842) (-874.157) [-877.449] -- 0:00:10
827000 -- [-878.135] (-876.102) (-877.853) (-874.458) * [-879.973] (-874.261) (-876.424) (-877.805) -- 0:00:10
827500 -- (-877.600) (-874.761) [-879.058] (-874.200) * (-875.538) (-877.461) [-876.619] (-876.161) -- 0:00:10
828000 -- (-873.588) (-873.844) (-879.007) [-874.263] * (-874.791) (-880.863) [-879.211] (-874.375) -- 0:00:10
828500 -- (-877.144) (-875.222) (-875.784) [-874.606] * (-875.678) (-875.665) [-877.870] (-876.638) -- 0:00:10
829000 -- (-876.239) [-874.211] (-877.231) (-876.418) * [-876.957] (-874.303) (-876.580) (-875.281) -- 0:00:10
829500 -- (-878.776) (-874.576) (-881.096) [-874.428] * (-874.443) [-874.021] (-886.122) (-876.407) -- 0:00:10
830000 -- (-874.282) [-874.357] (-881.965) (-876.126) * (-877.658) (-876.335) (-887.461) [-876.758] -- 0:00:10
Average standard deviation of split frequencies: 0.005826
830500 -- (-875.233) (-874.049) [-875.242] (-874.692) * (-877.593) (-875.528) [-874.393] (-879.165) -- 0:00:10
831000 -- (-875.103) [-874.551] (-874.460) (-877.276) * (-876.964) (-881.903) [-876.062] (-876.602) -- 0:00:10
831500 -- [-874.729] (-878.358) (-875.188) (-876.100) * [-874.831] (-874.841) (-874.395) (-876.278) -- 0:00:10
832000 -- (-876.536) [-878.028] (-876.809) (-875.951) * (-882.960) (-874.482) [-874.144] (-876.523) -- 0:00:10
832500 -- (-876.951) (-878.145) (-873.827) [-874.576] * (-874.248) (-875.076) [-875.545] (-875.408) -- 0:00:10
833000 -- (-875.239) (-881.774) [-875.608] (-877.247) * (-874.803) [-875.734] (-874.284) (-874.931) -- 0:00:10
833500 -- (-878.055) (-875.537) [-874.954] (-874.574) * [-874.593] (-874.982) (-875.134) (-876.815) -- 0:00:10
834000 -- (-876.715) (-875.766) (-874.264) [-878.344] * [-879.615] (-875.110) (-874.838) (-874.106) -- 0:00:10
834500 -- (-874.169) (-879.057) [-874.494] (-876.379) * (-879.213) (-876.028) (-874.331) [-876.855] -- 0:00:10
835000 -- (-880.591) (-875.899) (-873.620) [-878.470] * (-876.942) (-875.804) (-875.906) [-874.989] -- 0:00:10
Average standard deviation of split frequencies: 0.006052
835500 -- (-873.741) [-875.084] (-873.757) (-876.372) * (-874.516) (-878.613) (-875.979) [-875.460] -- 0:00:10
836000 -- (-876.096) [-874.055] (-874.789) (-875.617) * (-877.396) (-876.785) (-875.453) [-878.445] -- 0:00:10
836500 -- (-880.634) (-876.217) [-876.528] (-877.712) * (-877.157) (-877.287) [-874.508] (-876.601) -- 0:00:09
837000 -- [-873.919] (-873.314) (-874.559) (-876.481) * (-877.291) (-876.123) [-874.608] (-875.351) -- 0:00:09
837500 -- (-879.779) (-875.264) (-874.518) [-876.385] * (-876.703) [-876.214] (-874.636) (-880.285) -- 0:00:09
838000 -- (-876.572) (-875.678) [-876.373] (-874.814) * (-874.156) [-874.445] (-878.500) (-880.029) -- 0:00:09
838500 -- (-878.938) [-875.228] (-873.797) (-873.625) * (-876.326) (-877.477) [-879.010] (-875.713) -- 0:00:09
839000 -- (-877.448) [-876.644] (-877.995) (-875.140) * (-878.024) (-877.051) (-879.892) [-875.089] -- 0:00:09
839500 -- [-874.476] (-879.098) (-880.114) (-873.702) * (-879.894) [-873.777] (-885.185) (-876.939) -- 0:00:09
840000 -- [-873.457] (-876.766) (-875.635) (-875.440) * (-875.506) (-874.196) (-878.109) [-875.148] -- 0:00:09
Average standard deviation of split frequencies: 0.006505
840500 -- (-875.909) (-878.674) (-875.146) [-873.835] * [-876.507] (-874.017) (-879.998) (-876.723) -- 0:00:09
841000 -- (-874.734) [-873.997] (-878.511) (-876.492) * (-876.167) (-875.280) [-877.449] (-877.780) -- 0:00:09
841500 -- (-874.597) (-874.969) (-876.572) [-873.769] * (-876.323) (-874.739) (-876.163) [-873.789] -- 0:00:09
842000 -- (-877.047) (-880.438) [-876.023] (-874.369) * [-880.415] (-875.728) (-875.919) (-875.684) -- 0:00:09
842500 -- (-876.302) (-877.142) (-875.215) [-877.647] * (-875.255) [-874.982] (-874.235) (-874.444) -- 0:00:09
843000 -- (-873.935) [-876.390] (-874.913) (-874.425) * (-876.805) (-878.896) [-874.204] (-879.430) -- 0:00:09
843500 -- (-875.196) (-876.020) [-875.171] (-875.432) * (-877.383) (-876.872) (-877.405) [-874.629] -- 0:00:09
844000 -- [-873.417] (-876.935) (-876.343) (-875.204) * (-878.196) [-877.527] (-876.050) (-874.509) -- 0:00:09
844500 -- (-873.472) (-875.740) [-878.431] (-873.409) * [-875.338] (-875.774) (-876.234) (-876.562) -- 0:00:09
845000 -- [-875.367] (-876.548) (-876.782) (-877.216) * [-874.490] (-874.292) (-874.866) (-879.051) -- 0:00:09
Average standard deviation of split frequencies: 0.006464
845500 -- (-877.377) (-875.403) [-878.187] (-876.644) * (-875.356) (-874.816) (-876.034) [-875.143] -- 0:00:09
846000 -- (-874.279) [-874.067] (-876.855) (-874.973) * (-876.149) (-876.535) (-876.216) [-874.051] -- 0:00:09
846500 -- (-874.053) [-873.657] (-875.416) (-877.669) * (-875.341) [-875.301] (-876.118) (-874.070) -- 0:00:09
847000 -- (-877.547) (-876.123) (-875.780) [-876.323] * [-874.538] (-873.986) (-874.515) (-875.938) -- 0:00:09
847500 -- (-876.256) [-875.248] (-877.277) (-874.728) * (-874.792) (-875.251) [-874.385] (-873.743) -- 0:00:09
848000 -- (-878.002) (-877.781) [-876.243] (-878.056) * [-875.119] (-873.566) (-875.845) (-877.372) -- 0:00:09
848500 -- (-877.591) (-876.565) (-880.751) [-875.012] * [-875.902] (-874.177) (-875.303) (-873.854) -- 0:00:09
849000 -- (-876.995) [-878.837] (-875.205) (-880.248) * (-874.740) (-874.161) [-877.679] (-874.089) -- 0:00:09
849500 -- (-877.022) (-876.631) [-874.560] (-876.371) * (-877.884) (-876.441) [-876.882] (-874.206) -- 0:00:09
850000 -- (-881.004) (-874.375) (-877.700) [-876.889] * [-874.100] (-876.949) (-874.990) (-877.742) -- 0:00:09
Average standard deviation of split frequencies: 0.006539
850500 -- (-878.577) [-873.528] (-878.974) (-875.474) * [-879.229] (-876.159) (-876.878) (-874.548) -- 0:00:09
851000 -- (-877.833) (-874.032) [-875.751] (-879.365) * (-877.710) (-877.009) (-875.927) [-879.982] -- 0:00:09
851500 -- (-876.112) (-875.698) [-875.684] (-876.516) * (-876.546) (-874.287) (-874.353) [-876.049] -- 0:00:09
852000 -- (-880.536) (-875.542) (-877.488) [-875.857] * [-874.879] (-873.646) (-874.270) (-878.548) -- 0:00:09
852500 -- [-877.498] (-874.748) (-876.156) (-876.629) * (-874.112) (-873.906) (-878.342) [-875.936] -- 0:00:08
853000 -- (-877.581) (-874.748) (-875.563) [-876.285] * [-874.290] (-874.703) (-873.937) (-874.913) -- 0:00:08
853500 -- [-878.620] (-880.114) (-873.787) (-876.062) * (-876.213) [-873.838] (-877.860) (-874.619) -- 0:00:08
854000 -- (-877.445) (-875.971) [-875.008] (-876.476) * (-874.763) [-875.065] (-879.133) (-877.065) -- 0:00:08
854500 -- [-877.473] (-877.380) (-875.044) (-878.499) * (-874.159) [-874.968] (-876.756) (-874.552) -- 0:00:08
855000 -- (-879.223) (-875.964) [-874.987] (-875.996) * (-875.436) [-874.961] (-873.845) (-874.043) -- 0:00:08
Average standard deviation of split frequencies: 0.006131
855500 -- [-873.930] (-874.806) (-875.466) (-878.782) * (-875.166) (-877.106) [-876.747] (-876.649) -- 0:00:08
856000 -- [-874.026] (-877.042) (-876.647) (-873.979) * (-875.669) (-877.761) (-876.541) [-877.424] -- 0:00:08
856500 -- [-874.008] (-874.319) (-877.855) (-876.817) * (-876.918) [-874.340] (-873.771) (-878.366) -- 0:00:08
857000 -- (-875.618) (-878.955) (-876.079) [-874.151] * [-874.708] (-874.993) (-873.864) (-877.968) -- 0:00:08
857500 -- (-874.592) (-879.746) (-874.798) [-875.594] * [-874.062] (-873.693) (-874.005) (-875.281) -- 0:00:08
858000 -- (-877.930) (-877.046) [-876.695] (-876.136) * (-878.819) (-874.738) [-875.501] (-878.392) -- 0:00:08
858500 -- (-876.510) (-878.874) (-875.071) [-875.336] * (-875.411) (-874.375) [-877.875] (-876.487) -- 0:00:08
859000 -- (-876.145) [-876.111] (-875.199) (-873.954) * (-874.910) (-874.156) (-876.293) [-878.131] -- 0:00:08
859500 -- (-876.020) (-875.957) (-876.554) [-874.160] * (-875.599) [-878.708] (-875.426) (-875.690) -- 0:00:08
860000 -- [-875.726] (-875.366) (-878.094) (-874.578) * (-874.499) [-875.617] (-874.921) (-875.816) -- 0:00:08
Average standard deviation of split frequencies: 0.005696
860500 -- (-879.393) [-873.972] (-875.403) (-875.352) * (-876.608) (-880.321) (-874.172) [-875.917] -- 0:00:08
861000 -- (-879.416) (-876.077) (-875.337) [-874.834] * (-879.738) [-875.852] (-876.138) (-874.444) -- 0:00:08
861500 -- (-876.110) (-875.516) (-875.660) [-877.186] * (-876.310) (-876.786) (-874.837) [-873.666] -- 0:00:08
862000 -- (-878.002) (-874.602) [-879.610] (-874.511) * (-875.969) (-876.682) [-876.724] (-874.847) -- 0:00:08
862500 -- (-876.331) (-876.499) (-874.622) [-875.514] * (-874.911) [-877.858] (-875.345) (-875.166) -- 0:00:08
863000 -- (-873.762) (-878.791) (-875.751) [-877.054] * [-876.777] (-875.743) (-875.680) (-873.921) -- 0:00:08
863500 -- (-875.179) [-877.569] (-874.854) (-874.544) * (-874.202) (-878.029) (-876.739) [-874.106] -- 0:00:08
864000 -- (-875.269) (-874.526) (-874.111) [-875.373] * (-877.969) (-875.284) (-875.820) [-876.492] -- 0:00:08
864500 -- (-875.644) [-874.948] (-876.361) (-879.756) * [-875.964] (-875.944) (-875.951) (-882.734) -- 0:00:08
865000 -- [-873.999] (-874.353) (-875.967) (-877.415) * (-878.534) (-880.614) [-876.274] (-877.417) -- 0:00:08
Average standard deviation of split frequencies: 0.005806
865500 -- (-876.154) [-874.909] (-876.128) (-875.117) * (-880.545) (-878.030) (-878.816) [-874.448] -- 0:00:08
866000 -- (-875.040) (-875.506) [-876.783] (-874.774) * (-875.893) (-883.178) (-880.983) [-877.546] -- 0:00:08
866500 -- (-879.478) (-875.297) [-874.471] (-873.440) * (-877.559) (-876.766) (-876.096) [-874.147] -- 0:00:08
867000 -- (-879.934) (-873.833) [-879.130] (-873.652) * [-881.271] (-876.425) (-876.164) (-875.747) -- 0:00:08
867500 -- (-880.871) (-874.866) (-875.928) [-873.511] * (-874.831) (-875.004) (-878.070) [-876.314] -- 0:00:08
868000 -- (-879.458) [-875.198] (-874.473) (-874.218) * (-876.797) [-875.031] (-874.566) (-876.681) -- 0:00:08
868500 -- (-878.236) (-875.562) (-873.973) [-876.108] * (-876.710) (-874.751) (-875.233) [-874.431] -- 0:00:08
869000 -- (-877.713) [-875.698] (-874.502) (-876.258) * (-874.991) (-875.224) (-876.872) [-876.448] -- 0:00:07
869500 -- [-875.780] (-874.880) (-874.644) (-875.496) * (-874.222) [-875.448] (-879.214) (-874.997) -- 0:00:07
870000 -- (-876.253) (-875.255) [-874.397] (-873.844) * (-875.878) (-878.889) [-873.731] (-875.819) -- 0:00:07
Average standard deviation of split frequencies: 0.005739
870500 -- (-876.031) [-880.073] (-876.104) (-874.580) * (-881.489) (-875.633) [-873.825] (-875.607) -- 0:00:07
871000 -- [-879.375] (-876.178) (-878.920) (-875.503) * (-876.072) (-875.749) [-874.568] (-875.586) -- 0:00:07
871500 -- (-876.004) (-877.798) [-875.277] (-875.205) * [-875.395] (-880.428) (-875.044) (-876.183) -- 0:00:07
872000 -- (-877.177) (-876.677) [-877.167] (-878.130) * [-876.391] (-878.944) (-877.141) (-876.304) -- 0:00:07
872500 -- (-874.551) (-875.836) [-875.152] (-875.931) * [-877.164] (-878.753) (-880.227) (-880.021) -- 0:00:07
873000 -- (-875.347) (-880.300) (-876.843) [-876.040] * (-877.806) (-879.234) [-876.031] (-876.983) -- 0:00:07
873500 -- (-873.769) (-877.088) [-878.650] (-876.359) * (-877.562) (-878.004) (-875.312) [-876.961] -- 0:00:07
874000 -- (-875.243) [-878.725] (-878.076) (-874.610) * (-877.243) (-875.240) (-876.316) [-875.567] -- 0:00:07
874500 -- (-874.991) (-876.588) (-875.790) [-873.809] * (-876.749) (-877.524) [-875.136] (-875.377) -- 0:00:07
875000 -- (-875.080) (-876.802) (-878.143) [-874.620] * (-876.061) (-875.181) [-874.418] (-880.697) -- 0:00:07
Average standard deviation of split frequencies: 0.005489
875500 -- (-874.799) [-876.671] (-875.025) (-875.210) * (-874.858) [-877.935] (-875.613) (-878.930) -- 0:00:07
876000 -- (-875.212) (-876.284) (-878.539) [-876.540] * (-875.986) (-877.637) [-874.473] (-874.346) -- 0:00:07
876500 -- [-874.799] (-874.643) (-879.702) (-876.624) * (-875.602) [-875.800] (-875.018) (-875.266) -- 0:00:07
877000 -- (-874.446) [-875.639] (-875.514) (-878.522) * (-877.677) (-875.771) (-875.842) [-874.320] -- 0:00:07
877500 -- (-873.923) (-878.533) [-875.304] (-877.108) * (-879.482) (-876.836) [-877.022] (-874.317) -- 0:00:07
878000 -- (-874.850) (-874.128) (-874.322) [-875.048] * (-877.071) [-875.178] (-874.335) (-884.768) -- 0:00:07
878500 -- (-874.875) (-875.180) (-874.762) [-878.288] * (-878.455) [-874.967] (-876.699) (-878.468) -- 0:00:07
879000 -- (-878.478) [-874.389] (-875.109) (-876.595) * (-875.283) (-875.765) (-875.878) [-875.275] -- 0:00:07
879500 -- (-875.911) (-877.125) [-876.288] (-874.984) * (-876.437) (-874.896) [-878.272] (-879.251) -- 0:00:07
880000 -- (-876.387) [-875.823] (-875.261) (-874.391) * (-873.752) (-874.136) (-878.419) [-876.709] -- 0:00:07
Average standard deviation of split frequencies: 0.005817
880500 -- (-875.808) [-876.280] (-876.200) (-875.794) * (-873.724) [-877.182] (-878.930) (-877.658) -- 0:00:07
881000 -- [-875.501] (-876.483) (-876.838) (-875.865) * [-873.524] (-875.670) (-874.956) (-878.317) -- 0:00:07
881500 -- [-874.820] (-876.478) (-876.181) (-876.765) * (-880.271) (-874.674) (-875.153) [-875.809] -- 0:00:07
882000 -- [-877.400] (-875.509) (-881.087) (-878.911) * (-876.952) (-874.659) (-878.408) [-874.865] -- 0:00:07
882500 -- (-878.603) [-875.452] (-877.814) (-874.676) * (-877.183) (-876.071) [-876.661] (-876.172) -- 0:00:07
883000 -- [-875.274] (-879.092) (-874.375) (-876.457) * (-878.133) [-878.032] (-875.144) (-876.471) -- 0:00:07
883500 -- (-877.463) [-877.774] (-876.878) (-874.361) * (-875.411) (-876.198) (-875.438) [-875.120] -- 0:00:07
884000 -- (-880.954) (-878.779) (-877.419) [-874.141] * [-874.609] (-880.753) (-875.159) (-874.924) -- 0:00:07
884500 -- [-876.591] (-874.008) (-874.951) (-874.407) * (-874.645) (-880.457) (-876.814) [-877.609] -- 0:00:07
885000 -- (-877.919) (-874.978) [-876.858] (-875.001) * (-874.651) (-874.407) [-875.603] (-874.843) -- 0:00:07
Average standard deviation of split frequencies: 0.005569
885500 -- (-881.879) [-875.723] (-876.880) (-874.729) * (-875.098) [-875.213] (-876.433) (-874.518) -- 0:00:06
886000 -- (-873.593) (-878.639) (-874.019) [-874.710] * (-876.670) (-876.952) (-881.181) [-877.034] -- 0:00:06
886500 -- (-877.231) (-874.492) [-875.309] (-874.756) * (-875.889) (-878.454) [-875.434] (-878.113) -- 0:00:06
887000 -- (-874.929) (-876.505) [-874.488] (-875.387) * (-873.850) (-877.215) (-876.063) [-878.668] -- 0:00:06
887500 -- (-874.907) (-879.178) (-874.253) [-874.300] * [-877.473] (-874.905) (-875.482) (-873.658) -- 0:00:06
888000 -- (-875.683) (-879.907) (-877.137) [-876.863] * (-874.619) (-875.684) [-876.462] (-876.116) -- 0:00:06
888500 -- (-874.811) (-875.146) [-874.325] (-877.723) * (-873.994) (-875.770) (-873.538) [-876.296] -- 0:00:06
889000 -- (-873.941) (-874.576) (-882.047) [-876.042] * (-874.580) [-874.358] (-875.718) (-876.348) -- 0:00:06
889500 -- (-879.106) (-875.034) (-874.287) [-875.849] * (-874.970) (-879.002) (-873.945) [-875.308] -- 0:00:06
890000 -- (-874.448) [-875.994] (-878.166) (-875.316) * (-878.629) [-876.516] (-873.542) (-876.747) -- 0:00:06
Average standard deviation of split frequencies: 0.005399
890500 -- (-874.959) [-874.417] (-876.815) (-879.088) * (-876.775) (-875.815) [-873.467] (-875.683) -- 0:00:06
891000 -- (-875.550) [-879.868] (-875.216) (-876.836) * (-877.253) [-877.439] (-874.666) (-875.761) -- 0:00:06
891500 -- (-873.562) (-876.840) [-873.643] (-877.698) * (-877.434) (-879.498) (-874.319) [-873.332] -- 0:00:06
892000 -- [-876.837] (-875.645) (-876.467) (-874.641) * [-875.785] (-875.778) (-876.565) (-875.254) -- 0:00:06
892500 -- [-877.547] (-873.830) (-874.728) (-873.888) * (-873.548) (-876.014) [-875.533] (-875.777) -- 0:00:06
893000 -- (-879.421) [-876.237] (-876.171) (-878.345) * (-873.823) (-877.967) (-874.838) [-874.635] -- 0:00:06
893500 -- [-875.202] (-874.049) (-876.046) (-881.348) * (-874.963) [-874.108] (-875.460) (-875.030) -- 0:00:06
894000 -- [-876.842] (-877.528) (-878.900) (-875.012) * [-874.626] (-877.339) (-875.494) (-874.275) -- 0:00:06
894500 -- [-875.308] (-875.479) (-879.095) (-873.850) * [-875.039] (-875.171) (-874.662) (-875.320) -- 0:00:06
895000 -- (-877.414) [-878.326] (-875.906) (-874.424) * (-876.020) (-875.886) [-875.249] (-878.743) -- 0:00:06
Average standard deviation of split frequencies: 0.005577
895500 -- [-875.050] (-877.793) (-878.730) (-873.921) * (-874.858) (-877.154) (-877.853) [-876.594] -- 0:00:06
896000 -- (-874.663) [-874.209] (-874.673) (-877.250) * (-874.440) (-875.938) [-875.576] (-877.349) -- 0:00:06
896500 -- [-875.037] (-875.251) (-875.895) (-878.385) * (-875.503) (-874.395) (-874.930) [-876.235] -- 0:00:06
897000 -- (-876.778) (-873.820) (-880.482) [-875.468] * (-875.231) [-877.986] (-877.227) (-877.069) -- 0:00:06
897500 -- [-876.878] (-877.939) (-876.610) (-874.128) * [-875.142] (-877.126) (-878.951) (-878.198) -- 0:00:06
898000 -- (-874.833) (-875.906) [-877.114] (-874.380) * (-875.589) (-873.791) [-873.640] (-876.051) -- 0:00:06
898500 -- (-880.307) (-876.495) (-878.337) [-874.118] * [-876.345] (-876.382) (-873.722) (-879.146) -- 0:00:06
899000 -- (-875.872) (-875.531) [-873.696] (-874.226) * (-875.272) (-876.698) (-873.571) [-874.411] -- 0:00:06
899500 -- [-874.744] (-875.092) (-873.428) (-878.860) * (-876.166) (-875.551) [-873.756] (-877.595) -- 0:00:06
900000 -- (-873.451) [-874.521] (-874.747) (-875.185) * (-875.165) (-875.149) [-873.872] (-878.744) -- 0:00:06
Average standard deviation of split frequencies: 0.005408
900500 -- (-876.260) [-875.624] (-879.425) (-876.247) * [-874.999] (-876.197) (-876.815) (-878.220) -- 0:00:06
901000 -- (-874.319) (-875.590) [-875.472] (-877.929) * (-874.487) [-875.847] (-875.739) (-881.409) -- 0:00:06
901500 -- (-875.652) [-875.050] (-875.761) (-878.683) * (-875.564) (-875.625) (-879.625) [-875.304] -- 0:00:06
902000 -- [-877.480] (-875.156) (-876.419) (-878.071) * (-874.183) [-876.225] (-873.458) (-874.237) -- 0:00:05
902500 -- (-876.175) (-874.937) (-878.142) [-877.415] * [-874.403] (-877.552) (-874.622) (-875.967) -- 0:00:05
903000 -- (-875.729) (-878.656) [-875.832] (-876.495) * (-879.033) [-875.442] (-874.455) (-875.382) -- 0:00:05
903500 -- (-876.038) (-873.721) [-875.589] (-875.088) * (-878.285) (-875.603) (-875.198) [-877.547] -- 0:00:05
904000 -- (-875.415) [-874.392] (-877.440) (-874.614) * (-877.452) (-876.197) (-876.790) [-876.425] -- 0:00:05
904500 -- (-878.529) (-878.424) [-874.766] (-874.568) * (-878.498) [-877.356] (-875.175) (-878.532) -- 0:00:05
905000 -- (-876.283) (-875.113) [-874.221] (-881.062) * (-873.491) (-877.038) (-875.487) [-875.142] -- 0:00:05
Average standard deviation of split frequencies: 0.005342
905500 -- (-875.397) [-873.978] (-875.181) (-877.294) * (-874.660) (-874.730) [-875.843] (-874.909) -- 0:00:05
906000 -- (-876.524) (-874.913) [-875.943] (-876.862) * (-873.893) (-877.384) (-877.109) [-875.083] -- 0:00:05
906500 -- (-876.717) [-876.033] (-882.274) (-876.787) * (-874.437) (-876.292) [-878.413] (-873.797) -- 0:00:05
907000 -- (-877.746) (-876.177) (-875.405) [-875.881] * (-875.600) [-874.273] (-876.401) (-877.058) -- 0:00:05
907500 -- (-875.879) (-873.946) [-874.662] (-875.912) * (-877.369) (-874.814) (-875.281) [-876.688] -- 0:00:05
908000 -- (-874.085) [-873.644] (-875.005) (-875.335) * (-876.453) [-877.302] (-875.319) (-875.987) -- 0:00:05
908500 -- (-877.382) (-873.644) [-875.281] (-875.438) * (-876.987) (-882.473) (-875.938) [-875.191] -- 0:00:05
909000 -- (-879.318) [-874.522] (-876.512) (-875.411) * (-873.805) (-876.043) [-874.727] (-873.991) -- 0:00:05
909500 -- (-876.815) (-874.501) [-877.781] (-875.980) * (-875.499) (-874.589) (-874.084) [-873.543] -- 0:00:05
910000 -- (-875.605) [-874.876] (-877.402) (-876.928) * [-879.194] (-881.829) (-874.123) (-875.304) -- 0:00:05
Average standard deviation of split frequencies: 0.005211
910500 -- [-874.546] (-876.432) (-874.361) (-875.247) * (-883.044) [-876.091] (-875.598) (-874.525) -- 0:00:05
911000 -- (-874.487) [-876.593] (-874.400) (-876.000) * (-881.877) [-874.658] (-877.247) (-877.185) -- 0:00:05
911500 -- [-874.654] (-874.290) (-875.630) (-876.766) * (-879.259) (-875.054) [-874.355] (-876.634) -- 0:00:05
912000 -- (-875.634) (-874.761) [-875.137] (-877.761) * (-877.836) [-875.891] (-875.023) (-874.654) -- 0:00:05
912500 -- (-877.437) (-873.861) [-873.625] (-878.927) * (-876.478) (-875.368) [-873.727] (-873.832) -- 0:00:05
913000 -- [-874.690] (-875.316) (-876.873) (-875.417) * [-874.358] (-876.957) (-875.122) (-874.617) -- 0:00:05
913500 -- (-873.678) (-876.086) [-875.688] (-875.535) * (-877.183) (-875.190) [-877.196] (-876.722) -- 0:00:05
914000 -- (-873.795) (-875.534) [-877.191] (-874.110) * [-874.591] (-874.961) (-875.125) (-876.378) -- 0:00:05
914500 -- (-876.456) (-875.604) (-877.284) [-873.774] * (-876.026) [-875.246] (-875.481) (-877.971) -- 0:00:05
915000 -- [-876.381] (-879.910) (-879.255) (-873.704) * (-877.828) [-876.567] (-875.313) (-877.415) -- 0:00:05
Average standard deviation of split frequencies: 0.005284
915500 -- [-874.517] (-875.637) (-879.522) (-876.282) * (-876.264) [-875.570] (-876.449) (-874.853) -- 0:00:05
916000 -- (-876.074) (-877.141) [-874.728] (-879.943) * (-875.893) (-875.064) [-876.752] (-874.839) -- 0:00:05
916500 -- (-877.051) (-875.184) [-874.742] (-874.269) * (-876.201) [-876.815] (-875.512) (-875.322) -- 0:00:05
917000 -- (-877.029) (-876.224) [-874.863] (-874.264) * (-874.629) (-874.162) (-874.468) [-877.109] -- 0:00:05
917500 -- [-878.910] (-877.779) (-875.302) (-875.580) * (-874.183) [-875.742] (-874.076) (-877.817) -- 0:00:05
918000 -- (-876.384) (-874.860) [-874.806] (-873.918) * (-874.911) (-876.363) (-873.993) [-876.508] -- 0:00:05
918500 -- (-874.745) [-875.296] (-879.779) (-876.252) * [-880.464] (-874.926) (-876.040) (-877.352) -- 0:00:04
919000 -- (-874.758) (-873.683) (-874.169) [-874.609] * (-876.729) [-875.804] (-876.125) (-875.812) -- 0:00:04
919500 -- (-874.554) (-877.574) (-876.986) [-874.592] * (-880.025) [-874.217] (-876.025) (-875.160) -- 0:00:04
920000 -- [-876.331] (-875.215) (-876.060) (-876.371) * [-876.703] (-875.916) (-874.427) (-879.505) -- 0:00:04
Average standard deviation of split frequencies: 0.004676
920500 -- (-874.957) (-875.276) [-875.058] (-875.953) * (-874.237) (-874.962) [-873.614] (-884.124) -- 0:00:04
921000 -- (-877.329) (-876.656) (-875.872) [-876.826] * (-874.288) (-878.146) [-873.898] (-877.017) -- 0:00:04
921500 -- (-874.200) (-876.241) [-877.687] (-875.154) * (-875.500) (-875.736) [-876.887] (-879.124) -- 0:00:04
922000 -- (-874.204) [-877.182] (-875.929) (-876.086) * (-874.123) (-875.134) (-877.137) [-873.794] -- 0:00:04
922500 -- [-874.347] (-874.666) (-874.679) (-879.832) * (-875.635) [-874.994] (-874.798) (-873.621) -- 0:00:04
923000 -- (-876.530) (-874.903) [-873.866] (-874.014) * (-880.049) (-877.544) [-875.042] (-876.102) -- 0:00:04
923500 -- (-875.081) (-875.894) [-874.333] (-874.587) * (-879.998) (-874.674) (-875.749) [-875.781] -- 0:00:04
924000 -- (-873.386) [-874.961] (-876.044) (-875.665) * (-877.993) [-875.326] (-874.606) (-875.778) -- 0:00:04
924500 -- [-873.411] (-876.073) (-876.077) (-874.753) * (-875.441) (-876.404) [-874.440] (-876.999) -- 0:00:04
925000 -- (-873.567) [-874.794] (-875.040) (-876.396) * (-874.129) (-876.745) (-875.031) [-874.328] -- 0:00:04
Average standard deviation of split frequencies: 0.004548
925500 -- (-873.879) (-879.135) [-877.155] (-878.098) * (-873.992) [-878.555] (-877.943) (-873.488) -- 0:00:04
926000 -- (-874.277) (-876.647) [-878.693] (-876.026) * (-875.309) (-876.375) [-879.581] (-874.203) -- 0:00:04
926500 -- (-875.699) (-876.458) (-878.133) [-874.486] * (-875.021) [-874.835] (-875.073) (-874.109) -- 0:00:04
927000 -- (-878.080) (-873.730) [-874.760] (-873.858) * (-877.107) (-875.769) [-874.173] (-875.438) -- 0:00:04
927500 -- (-873.807) [-874.522] (-875.858) (-874.814) * (-878.990) (-876.390) (-875.238) [-877.378] -- 0:00:04
928000 -- (-880.418) [-874.890] (-875.077) (-880.502) * [-874.774] (-876.071) (-875.171) (-876.386) -- 0:00:04
928500 -- (-877.427) [-876.018] (-876.229) (-875.303) * (-880.061) (-875.495) [-875.232] (-875.094) -- 0:00:04
929000 -- (-874.882) (-876.706) [-874.015] (-875.187) * [-876.374] (-876.073) (-879.056) (-873.698) -- 0:00:04
929500 -- [-875.958] (-880.371) (-875.325) (-876.190) * [-876.496] (-877.923) (-876.528) (-876.029) -- 0:00:04
930000 -- [-875.194] (-874.692) (-875.658) (-884.491) * (-876.936) [-875.699] (-876.227) (-874.055) -- 0:00:04
Average standard deviation of split frequencies: 0.004525
930500 -- [-876.690] (-879.502) (-876.102) (-875.345) * [-875.616] (-874.904) (-876.906) (-875.127) -- 0:00:04
931000 -- (-873.754) (-875.591) [-874.062] (-873.923) * (-874.454) [-874.859] (-876.532) (-876.192) -- 0:00:04
931500 -- (-874.067) (-877.082) (-875.712) [-874.541] * [-875.806] (-877.077) (-877.523) (-875.566) -- 0:00:04
932000 -- (-875.789) [-876.960] (-874.958) (-874.516) * (-875.061) [-876.362] (-879.562) (-877.385) -- 0:00:04
932500 -- [-876.337] (-878.580) (-875.355) (-876.431) * (-874.252) [-878.507] (-878.050) (-875.006) -- 0:00:04
933000 -- (-874.057) [-879.786] (-874.700) (-874.224) * [-875.415] (-875.433) (-880.132) (-876.870) -- 0:00:04
933500 -- [-874.049] (-881.664) (-876.246) (-880.746) * (-877.056) [-874.976] (-879.332) (-876.778) -- 0:00:04
934000 -- (-874.041) (-878.756) [-876.072] (-875.735) * (-874.737) (-874.502) [-874.750] (-874.240) -- 0:00:04
934500 -- (-874.055) (-876.489) (-877.135) [-875.659] * [-877.248] (-874.150) (-874.560) (-874.449) -- 0:00:03
935000 -- (-877.952) (-880.347) [-874.406] (-876.757) * (-879.402) [-876.623] (-874.293) (-874.487) -- 0:00:03
Average standard deviation of split frequencies: 0.004734
935500 -- (-877.542) (-879.243) (-874.397) [-876.575] * [-875.697] (-875.865) (-877.835) (-874.968) -- 0:00:03
936000 -- [-874.675] (-879.251) (-877.325) (-873.990) * (-875.938) (-874.743) [-874.430] (-875.576) -- 0:00:03
936500 -- (-875.300) [-874.621] (-873.930) (-874.041) * (-878.045) (-876.567) (-874.793) [-881.544] -- 0:00:03
937000 -- (-873.661) (-876.938) (-877.243) [-875.441] * (-876.471) (-875.064) [-882.130] (-878.931) -- 0:00:03
937500 -- [-874.593] (-877.040) (-873.885) (-874.784) * (-878.945) (-875.354) [-875.783] (-880.449) -- 0:00:03
938000 -- (-874.732) (-876.022) [-874.621] (-873.309) * [-879.352] (-883.900) (-879.042) (-878.866) -- 0:00:03
938500 -- (-875.492) (-876.648) (-873.556) [-878.381] * (-874.616) (-879.134) [-876.081] (-875.358) -- 0:00:03
939000 -- (-875.301) (-874.447) (-874.925) [-876.631] * (-875.153) [-878.472] (-877.123) (-876.647) -- 0:00:03
939500 -- [-875.051] (-877.927) (-877.471) (-874.891) * [-875.582] (-875.948) (-876.188) (-880.594) -- 0:00:03
940000 -- (-874.379) (-876.249) [-876.294] (-877.868) * (-877.231) (-876.904) [-875.833] (-875.528) -- 0:00:03
Average standard deviation of split frequencies: 0.004544
940500 -- (-876.042) [-874.614] (-875.118) (-874.402) * (-875.120) (-875.878) (-878.172) [-877.267] -- 0:00:03
941000 -- (-875.977) (-873.893) (-875.885) [-876.227] * (-875.531) [-875.106] (-879.204) (-876.137) -- 0:00:03
941500 -- (-875.083) (-874.696) (-875.591) [-875.538] * (-874.963) (-875.929) [-874.999] (-875.781) -- 0:00:03
942000 -- (-874.702) (-876.693) [-876.051] (-876.466) * (-878.746) (-877.928) (-876.778) [-875.083] -- 0:00:03
942500 -- (-877.867) [-876.649] (-873.769) (-875.051) * [-878.217] (-874.215) (-874.053) (-874.946) -- 0:00:03
943000 -- (-877.222) (-874.443) (-877.156) [-876.117] * [-877.418] (-875.511) (-875.497) (-875.041) -- 0:00:03
943500 -- [-875.651] (-874.496) (-876.625) (-879.336) * (-879.993) [-873.729] (-876.062) (-875.865) -- 0:00:03
944000 -- (-880.148) [-877.136] (-874.086) (-877.888) * [-876.735] (-874.725) (-875.684) (-876.741) -- 0:00:03
944500 -- (-877.093) [-876.004] (-878.930) (-877.996) * (-876.889) (-873.994) (-875.849) [-873.736] -- 0:00:03
945000 -- (-876.186) (-874.552) (-875.995) [-877.277] * [-875.039] (-874.261) (-874.809) (-875.642) -- 0:00:03
Average standard deviation of split frequencies: 0.005016
945500 -- [-878.833] (-876.179) (-878.427) (-876.346) * [-876.773] (-874.057) (-874.873) (-875.026) -- 0:00:03
946000 -- [-876.064] (-882.051) (-876.715) (-874.420) * (-881.413) (-874.161) (-874.650) [-877.601] -- 0:00:03
946500 -- (-875.665) (-876.688) [-876.223] (-876.200) * (-875.826) (-875.397) (-878.087) [-874.990] -- 0:00:03
947000 -- [-874.480] (-879.496) (-875.352) (-874.522) * (-874.752) (-877.016) [-880.643] (-875.615) -- 0:00:03
947500 -- (-874.398) (-879.398) (-875.991) [-874.271] * (-873.826) (-877.688) [-876.584] (-874.995) -- 0:00:03
948000 -- (-876.013) (-874.536) (-876.165) [-876.694] * [-874.394] (-876.591) (-875.164) (-874.728) -- 0:00:03
948500 -- (-878.743) (-875.249) [-875.494] (-882.329) * (-874.610) (-879.131) (-877.072) [-878.859] -- 0:00:03
949000 -- [-876.654] (-876.677) (-875.097) (-876.007) * (-873.791) (-875.152) (-875.109) [-874.295] -- 0:00:03
949500 -- (-880.956) (-877.456) [-874.688] (-877.338) * (-874.255) [-876.039] (-874.812) (-877.517) -- 0:00:03
950000 -- [-876.674] (-874.355) (-882.293) (-881.807) * (-874.117) (-874.026) [-874.167] (-874.768) -- 0:00:03
Average standard deviation of split frequencies: 0.005058
950500 -- (-873.850) [-876.510] (-879.517) (-876.579) * [-876.578] (-873.959) (-874.312) (-875.732) -- 0:00:03
951000 -- [-874.432] (-880.054) (-878.655) (-875.161) * [-875.209] (-874.411) (-875.969) (-877.004) -- 0:00:02
951500 -- (-873.735) [-876.502] (-876.088) (-877.270) * (-873.993) (-875.300) [-875.392] (-875.666) -- 0:00:02
952000 -- (-877.236) [-873.474] (-875.380) (-874.409) * (-874.914) (-877.658) (-875.823) [-875.926] -- 0:00:02
952500 -- (-874.615) (-873.493) [-875.652] (-874.940) * [-876.552] (-875.383) (-874.614) (-875.036) -- 0:00:02
953000 -- (-875.494) (-877.192) (-874.544) [-874.588] * (-877.130) [-876.537] (-874.171) (-877.562) -- 0:00:02
953500 -- (-876.836) [-876.548] (-875.585) (-875.375) * (-876.910) (-877.405) [-874.874] (-877.569) -- 0:00:02
954000 -- (-876.067) [-873.895] (-874.000) (-875.924) * (-876.794) (-877.847) [-875.813] (-875.441) -- 0:00:02
954500 -- (-875.787) [-876.443] (-874.432) (-877.942) * (-877.902) [-876.779] (-875.271) (-877.826) -- 0:00:02
955000 -- (-874.391) (-874.269) [-874.595] (-879.717) * (-875.841) [-873.663] (-876.833) (-873.745) -- 0:00:02
Average standard deviation of split frequencies: 0.004537
955500 -- (-876.625) (-875.037) (-877.547) [-876.576] * (-874.592) (-876.259) (-874.776) [-875.180] -- 0:00:02
956000 -- (-875.151) (-874.726) (-878.142) [-877.130] * (-874.668) [-874.816] (-876.377) (-875.374) -- 0:00:02
956500 -- (-878.405) (-876.559) (-876.209) [-875.504] * (-875.808) (-873.652) (-876.460) [-876.670] -- 0:00:02
957000 -- (-881.270) (-874.194) [-875.349] (-876.861) * [-875.321] (-878.257) (-873.571) (-878.160) -- 0:00:02
957500 -- (-878.442) [-875.005] (-875.851) (-874.523) * (-874.504) (-876.987) [-873.877] (-875.270) -- 0:00:02
958000 -- (-877.147) [-874.066] (-876.332) (-874.001) * (-875.498) [-876.983] (-876.191) (-875.285) -- 0:00:02
958500 -- (-875.835) (-876.052) [-873.720] (-876.013) * (-875.620) (-875.590) [-875.170] (-874.582) -- 0:00:02
959000 -- (-876.753) (-874.477) [-875.841] (-879.064) * [-876.834] (-875.251) (-875.826) (-875.742) -- 0:00:02
959500 -- (-875.564) [-874.566] (-874.154) (-877.873) * [-875.485] (-874.716) (-876.311) (-877.358) -- 0:00:02
960000 -- (-877.261) (-875.008) (-879.159) [-873.603] * (-874.023) (-874.268) [-876.666] (-878.565) -- 0:00:02
Average standard deviation of split frequencies: 0.004711
960500 -- (-880.149) (-874.656) [-873.603] (-877.594) * (-874.013) [-874.636] (-877.895) (-874.379) -- 0:00:02
961000 -- (-876.052) (-878.501) (-874.066) [-875.767] * (-875.312) [-874.253] (-875.020) (-878.216) -- 0:00:02
961500 -- (-876.465) (-876.518) (-879.839) [-876.632] * [-874.902] (-878.647) (-875.662) (-881.378) -- 0:00:02
962000 -- [-874.490] (-877.609) (-875.397) (-878.484) * [-874.896] (-878.555) (-880.326) (-877.976) -- 0:00:02
962500 -- [-873.876] (-874.442) (-874.978) (-877.937) * (-874.922) [-877.619] (-875.001) (-875.750) -- 0:00:02
963000 -- (-874.635) (-878.023) (-873.906) [-879.106] * (-875.799) (-874.326) [-876.058] (-874.976) -- 0:00:02
963500 -- (-876.031) (-878.545) (-875.283) [-875.690] * [-878.189] (-874.297) (-875.238) (-874.203) -- 0:00:02
964000 -- (-875.514) [-875.459] (-876.385) (-874.490) * [-876.768] (-873.841) (-878.923) (-875.152) -- 0:00:02
964500 -- [-876.210] (-874.857) (-879.336) (-875.800) * (-873.662) [-874.751] (-877.531) (-877.847) -- 0:00:02
965000 -- (-875.840) (-875.249) [-877.408] (-873.450) * (-874.484) [-874.582] (-876.969) (-878.368) -- 0:00:02
Average standard deviation of split frequencies: 0.005043
965500 -- (-875.888) (-876.014) [-876.618] (-876.240) * (-878.313) (-877.326) (-874.897) [-878.518] -- 0:00:02
966000 -- (-877.172) [-875.530] (-876.190) (-876.523) * (-875.875) (-877.960) (-875.116) [-875.675] -- 0:00:02
966500 -- (-873.948) (-877.782) [-877.005] (-876.823) * [-875.838] (-876.931) (-873.437) (-877.060) -- 0:00:02
967000 -- (-877.015) [-875.270] (-883.260) (-875.641) * (-874.437) (-876.555) (-875.722) [-874.689] -- 0:00:02
967500 -- (-874.744) [-874.230] (-881.475) (-882.374) * (-878.762) [-875.408] (-874.480) (-879.196) -- 0:00:01
968000 -- (-873.916) (-878.723) [-874.217] (-874.951) * (-876.445) (-878.035) [-876.816] (-877.975) -- 0:00:01
968500 -- [-874.933] (-876.528) (-880.366) (-874.887) * (-876.678) (-879.830) (-873.805) [-876.145] -- 0:00:01
969000 -- (-874.278) [-878.033] (-878.449) (-875.898) * (-875.722) [-879.281] (-879.263) (-875.285) -- 0:00:01
969500 -- (-874.323) (-874.923) [-873.883] (-875.143) * [-879.744] (-876.292) (-878.637) (-873.407) -- 0:00:01
970000 -- (-877.250) (-874.840) (-876.254) [-874.568] * (-878.322) (-877.909) (-877.428) [-873.481] -- 0:00:01
Average standard deviation of split frequencies: 0.004857
970500 -- (-875.052) [-874.542] (-875.631) (-874.440) * (-876.312) (-878.672) [-875.034] (-875.019) -- 0:00:01
971000 -- [-874.621] (-874.708) (-875.686) (-874.541) * (-876.383) (-877.187) [-874.663] (-874.308) -- 0:00:01
971500 -- (-878.146) (-874.853) [-875.236] (-875.667) * [-874.757] (-876.374) (-875.955) (-874.896) -- 0:00:01
972000 -- [-873.843] (-877.371) (-874.977) (-876.336) * [-876.501] (-878.151) (-879.185) (-877.421) -- 0:00:01
972500 -- (-876.300) (-878.632) [-877.221] (-875.327) * [-874.888] (-873.389) (-880.139) (-875.773) -- 0:00:01
973000 -- (-877.023) (-874.293) (-876.213) [-876.700] * [-875.163] (-875.092) (-875.969) (-874.902) -- 0:00:01
973500 -- (-878.301) (-878.779) (-875.862) [-873.720] * (-876.211) (-874.002) [-875.814] (-875.947) -- 0:00:01
974000 -- (-880.063) (-877.238) (-876.373) [-874.442] * [-875.465] (-876.426) (-878.995) (-876.480) -- 0:00:01
974500 -- (-875.947) [-877.424] (-875.237) (-875.179) * (-875.371) [-876.286] (-879.138) (-874.784) -- 0:00:01
975000 -- [-875.604] (-878.255) (-875.182) (-875.725) * [-875.897] (-876.543) (-879.637) (-875.190) -- 0:00:01
Average standard deviation of split frequencies: 0.004798
975500 -- (-877.410) (-877.072) [-874.366] (-879.603) * (-874.704) (-876.687) [-876.277] (-874.905) -- 0:00:01
976000 -- (-876.081) (-875.855) [-874.525] (-880.643) * (-878.951) [-873.901] (-876.026) (-877.974) -- 0:00:01
976500 -- (-874.059) (-876.201) (-874.765) [-875.283] * [-877.278] (-873.820) (-878.224) (-875.811) -- 0:00:01
977000 -- [-873.859] (-876.988) (-874.497) (-874.522) * [-883.267] (-876.390) (-876.376) (-875.960) -- 0:00:01
977500 -- (-874.561) (-875.783) (-876.019) [-875.608] * [-877.419] (-874.414) (-877.142) (-878.504) -- 0:00:01
978000 -- (-873.753) (-875.446) [-877.161] (-874.556) * (-877.243) (-874.343) (-877.286) [-874.278] -- 0:00:01
978500 -- (-876.682) [-876.186] (-874.636) (-875.629) * [-876.996] (-874.322) (-875.422) (-875.334) -- 0:00:01
979000 -- (-876.599) (-875.750) [-877.799] (-876.317) * (-873.795) [-874.020] (-878.501) (-876.407) -- 0:00:01
979500 -- (-875.963) (-874.595) (-877.087) [-876.944] * (-874.561) [-874.674] (-874.727) (-876.892) -- 0:00:01
980000 -- (-875.503) (-873.534) [-876.504] (-876.052) * (-877.315) (-877.391) [-877.451] (-874.979) -- 0:00:01
Average standard deviation of split frequencies: 0.004999
980500 -- (-879.992) [-873.924] (-874.521) (-875.204) * (-876.938) (-875.070) [-875.447] (-876.662) -- 0:00:01
981000 -- (-875.895) [-877.419] (-874.098) (-875.141) * (-879.279) [-874.072] (-874.762) (-875.866) -- 0:00:01
981500 -- (-877.259) (-877.346) (-876.307) [-875.114] * (-877.526) (-875.390) [-873.939] (-875.751) -- 0:00:01
982000 -- (-874.586) [-876.748] (-876.184) (-874.298) * (-873.704) (-877.279) [-874.636] (-875.084) -- 0:00:01
982500 -- [-874.642] (-874.006) (-875.782) (-880.808) * (-873.394) (-877.066) [-876.138] (-875.546) -- 0:00:01
983000 -- [-875.402] (-875.525) (-875.410) (-880.172) * [-875.645] (-881.398) (-876.800) (-875.983) -- 0:00:01
983500 -- (-877.376) (-877.029) (-875.166) [-877.691] * (-877.360) (-876.406) [-877.289] (-877.348) -- 0:00:01
984000 -- (-877.840) (-876.155) (-877.009) [-878.247] * (-881.682) (-875.086) [-875.342] (-874.531) -- 0:00:00
984500 -- (-879.525) (-876.074) [-875.590] (-877.524) * (-875.570) (-875.085) [-877.016] (-874.390) -- 0:00:00
985000 -- [-874.628] (-875.185) (-874.800) (-877.606) * [-875.188] (-877.047) (-875.311) (-874.899) -- 0:00:00
Average standard deviation of split frequencies: 0.004749
985500 -- (-873.807) [-876.722] (-874.495) (-878.597) * (-873.638) (-875.388) [-874.851] (-875.597) -- 0:00:00
986000 -- (-882.839) (-874.790) [-875.167] (-873.805) * (-873.546) [-874.776] (-873.801) (-875.408) -- 0:00:00
986500 -- (-875.318) (-874.202) [-876.826] (-875.302) * (-875.401) [-875.358] (-874.296) (-874.867) -- 0:00:00
987000 -- (-876.992) (-876.339) [-874.569] (-875.967) * (-875.851) (-875.292) [-874.289] (-874.996) -- 0:00:00
987500 -- (-875.922) (-874.667) (-876.300) [-876.425] * (-873.851) [-877.220] (-877.921) (-874.484) -- 0:00:00
988000 -- (-875.538) (-876.469) [-875.008] (-875.067) * (-874.789) [-875.180] (-876.215) (-876.514) -- 0:00:00
988500 -- (-874.277) (-873.631) [-876.021] (-873.936) * (-875.930) (-878.279) (-875.467) [-875.788] -- 0:00:00
989000 -- [-874.885] (-876.379) (-879.346) (-874.919) * (-876.459) (-875.419) (-876.482) [-873.290] -- 0:00:00
989500 -- (-874.299) (-875.559) [-874.045] (-874.390) * (-878.587) [-876.411] (-876.155) (-875.784) -- 0:00:00
990000 -- (-874.445) [-877.166] (-877.418) (-874.475) * (-878.044) (-875.282) (-874.033) [-876.461] -- 0:00:00
Average standard deviation of split frequencies: 0.004568
990500 -- (-875.893) (-875.910) (-881.224) [-874.092] * (-873.997) [-874.147] (-876.016) (-875.464) -- 0:00:00
991000 -- (-876.144) (-876.880) [-876.951] (-874.665) * (-875.808) [-876.140] (-876.611) (-879.628) -- 0:00:00
991500 -- [-874.068] (-876.767) (-878.789) (-875.073) * (-875.901) [-873.709] (-876.558) (-877.954) -- 0:00:00
992000 -- (-873.380) (-876.063) (-879.346) [-874.568] * (-876.364) (-873.742) (-875.049) [-873.365] -- 0:00:00
992500 -- (-875.275) [-880.233] (-876.701) (-875.511) * (-874.646) (-877.815) (-874.208) [-874.180] -- 0:00:00
993000 -- [-874.564] (-876.661) (-875.614) (-877.626) * (-878.085) [-874.250] (-873.523) (-874.337) -- 0:00:00
993500 -- (-876.766) (-875.641) (-875.571) [-876.041] * (-876.481) (-878.580) [-876.604] (-876.601) -- 0:00:00
994000 -- (-873.908) [-877.182] (-879.778) (-874.118) * [-874.353] (-873.703) (-877.216) (-874.697) -- 0:00:00
994500 -- (-877.526) (-876.510) (-878.096) [-875.026] * (-874.593) [-876.004] (-876.782) (-875.324) -- 0:00:00
995000 -- [-876.044] (-875.686) (-878.848) (-877.396) * (-874.655) [-881.401] (-876.366) (-881.526) -- 0:00:00
Average standard deviation of split frequencies: 0.004985
995500 -- (-876.070) (-874.487) (-874.815) [-875.564] * (-875.242) (-873.838) (-875.757) [-877.740] -- 0:00:00
996000 -- (-877.352) [-883.026] (-875.140) (-874.731) * (-876.257) (-876.382) [-874.058] (-874.400) -- 0:00:00
996500 -- (-874.376) (-880.386) [-874.930] (-880.549) * (-874.777) (-879.636) (-874.743) [-874.839] -- 0:00:00
997000 -- (-874.544) (-875.838) (-875.696) [-875.710] * (-876.079) [-874.459] (-877.401) (-876.357) -- 0:00:00
997500 -- [-875.814] (-876.605) (-874.954) (-876.359) * (-875.281) (-874.378) [-874.699] (-874.816) -- 0:00:00
998000 -- [-877.630] (-878.567) (-876.973) (-876.647) * (-875.276) (-877.431) (-874.409) [-875.904] -- 0:00:00
998500 -- (-876.450) [-874.075] (-874.531) (-877.633) * (-877.373) (-875.939) (-875.125) [-873.903] -- 0:00:00
999000 -- (-873.507) [-875.220] (-875.386) (-874.159) * (-875.647) (-874.952) [-875.590] (-877.384) -- 0:00:00
999500 -- [-877.324] (-873.894) (-878.016) (-875.798) * (-881.095) (-875.481) (-875.078) [-874.137] -- 0:00:00
1000000 -- [-875.507] (-879.542) (-878.513) (-876.428) * (-875.902) (-879.297) [-876.341] (-874.985) -- 0:00:00
Average standard deviation of split frequencies: 0.005025
Analysis completed in 1 mins 1 seconds
Analysis used 59.58 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -873.29
Likelihood of best state for "cold" chain of run 2 was -873.29
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.2 % ( 27 %) Dirichlet(Pi{all})
30.6 % ( 31 %) Slider(Pi{all})
78.7 % ( 47 %) Multiplier(Alpha{1,2})
78.1 % ( 52 %) Multiplier(Alpha{3})
21.3 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.3 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.6 % ( 22 %) Dirichlet(Pi{all})
29.7 % ( 26 %) Slider(Pi{all})
78.4 % ( 45 %) Multiplier(Alpha{1,2})
77.5 % ( 49 %) Multiplier(Alpha{3})
21.2 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.4 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.3 % ( 97 %) Nodeslider(V{all})
30.7 % ( 32 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166065 0.82 0.67
3 | 167189 166922 0.84
4 | 166721 166404 166699
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166580 0.82 0.67
3 | 166361 167095 0.84
4 | 166445 166971 166548
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -875.15
| 2 1 |
|* 1 1 1 |
| 1 2 2 1 1 11 1 12 21 2|
| 1 1 2 * 2 11 1 1 2 2 |
| 12 2 2 1 12 1 1 1 |
| 2* * 221 1 2 2 2 1 1112 2 |
| * 1 2 2 11 2 2 2 2 1 112 |
| 2 2 1 2 1 2 2 * |
| 1 12 1 1 1 2 2 2 1 2 2 |
| 2221 2 1 2 1 2 1 2 1|
| 2 1 2 1 |
| 2 2 1 |
| 2 2 |
| 1 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -876.56
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -874.97 -877.90
2 -874.99 -879.05
--------------------------------------
TOTAL -874.98 -878.63
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902251 0.091180 0.376751 1.481713 0.861733 1346.84 1410.72 1.000
r(A<->C){all} 0.174863 0.021537 0.000050 0.479800 0.138258 182.79 213.59 1.000
r(A<->G){all} 0.158048 0.018790 0.000027 0.433233 0.120056 209.99 235.19 1.000
r(A<->T){all} 0.159581 0.019231 0.000138 0.450537 0.122823 127.02 178.38 1.000
r(C<->G){all} 0.165703 0.018573 0.000182 0.446652 0.132625 268.30 337.22 1.007
r(C<->T){all} 0.170210 0.022190 0.000036 0.482860 0.128421 217.85 245.00 1.001
r(G<->T){all} 0.171595 0.021171 0.000205 0.462596 0.128302 325.49 336.28 1.004
pi(A){all} 0.207163 0.000250 0.176535 0.238078 0.206887 1297.78 1313.79 1.001
pi(C){all} 0.345323 0.000334 0.310034 0.380737 0.345576 1135.70 1188.94 1.000
pi(G){all} 0.282442 0.000306 0.248927 0.316367 0.282315 1307.72 1338.24 1.000
pi(T){all} 0.165072 0.000212 0.138887 0.195177 0.164793 1089.49 1131.24 1.000
alpha{1,2} 0.411553 0.225264 0.000193 1.367900 0.238199 1281.86 1332.01 1.000
alpha{3} 0.465092 0.245424 0.000719 1.441203 0.304913 1012.55 1179.06 1.000
pinvar{all} 0.997655 0.000008 0.992342 0.999999 0.998596 1414.45 1416.35 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- .*.***
9 -- ..**..
10 -- .**.**
11 -- .***.*
12 -- ...*.*
13 -- .**...
14 -- .*...*
15 -- ..****
16 -- .****.
17 -- ..*..*
18 -- .*.*..
19 -- .*..*.
20 -- ....**
21 -- ..*.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 456 0.151899 0.010364 0.144570 0.159227 2
8 447 0.148901 0.006124 0.144570 0.153231 2
9 446 0.148568 0.000000 0.148568 0.148568 2
10 444 0.147901 0.002827 0.145903 0.149900 2
11 440 0.146569 0.004711 0.143238 0.149900 2
12 437 0.145570 0.009893 0.138574 0.152565 2
13 436 0.145237 0.002827 0.143238 0.147235 2
14 432 0.143904 0.003769 0.141239 0.146569 2
15 432 0.143904 0.004711 0.140573 0.147235 2
16 427 0.142239 0.000471 0.141905 0.142572 2
17 425 0.141572 0.002355 0.139907 0.143238 2
18 414 0.137908 0.012248 0.129247 0.146569 2
19 412 0.137242 0.000000 0.137242 0.137242 2
20 401 0.133578 0.013662 0.123917 0.143238 2
21 387 0.128914 0.001413 0.127915 0.129913 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099782 0.009652 0.000041 0.293064 0.070099 1.000 2
length{all}[2] 0.101044 0.010282 0.000011 0.308425 0.068517 1.000 2
length{all}[3] 0.101336 0.010466 0.000061 0.308605 0.068964 1.000 2
length{all}[4] 0.099536 0.010091 0.000015 0.304579 0.067429 1.000 2
length{all}[5] 0.101773 0.010372 0.000047 0.305647 0.072124 1.000 2
length{all}[6] 0.099378 0.009428 0.000082 0.291514 0.069060 1.000 2
length{all}[7] 0.099318 0.009430 0.000661 0.278375 0.071080 0.998 2
length{all}[8] 0.102670 0.011113 0.000415 0.310337 0.069443 1.000 2
length{all}[9] 0.097945 0.009876 0.000158 0.290125 0.067102 0.998 2
length{all}[10] 0.099048 0.008621 0.000612 0.273692 0.074503 0.998 2
length{all}[11] 0.101533 0.011195 0.000137 0.283039 0.068085 1.003 2
length{all}[12] 0.102066 0.011163 0.000020 0.290946 0.066174 0.998 2
length{all}[13] 0.098546 0.009631 0.000083 0.273626 0.066871 1.005 2
length{all}[14] 0.103465 0.010465 0.000064 0.281782 0.075900 0.998 2
length{all}[15] 0.100627 0.009909 0.000296 0.315349 0.070450 1.000 2
length{all}[16] 0.102406 0.010011 0.000129 0.310124 0.071732 1.003 2
length{all}[17] 0.095141 0.008095 0.000657 0.271566 0.069005 0.999 2
length{all}[18] 0.098909 0.009872 0.000306 0.283151 0.070747 1.000 2
length{all}[19] 0.102812 0.011471 0.000043 0.324581 0.068662 0.998 2
length{all}[20] 0.100826 0.009914 0.001097 0.302811 0.068690 1.001 2
length{all}[21] 0.095709 0.007599 0.000334 0.269947 0.074290 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005025
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 648
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 216 / 216 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 216 / 216 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.010528 0.099271 0.092236 0.068938 0.074278 0.057376 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -930.904765
Iterating by ming2
Initial: fx= 930.904765
x= 0.01053 0.09927 0.09224 0.06894 0.07428 0.05738 0.30000 1.30000
1 h-m-p 0.0000 0.0000 517.7324 ++ 917.690979 m 0.0000 13 | 1/8
2 h-m-p 0.0004 0.0053 57.2949 ----------.. | 1/8
3 h-m-p 0.0000 0.0002 472.5368 +++ 868.068162 m 0.0002 44 | 2/8
4 h-m-p 0.0016 0.0079 38.8123 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 426.0903 ++ 858.121607 m 0.0001 75 | 3/8
6 h-m-p 0.0010 0.0152 21.2112 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 369.4827 ++ 854.665192 m 0.0000 106 | 4/8
8 h-m-p 0.0005 0.0222 15.0871 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 301.5726 ++ 846.885884 m 0.0001 137 | 5/8
10 h-m-p 0.0019 0.0376 9.3496 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 213.8469 ++ 845.352838 m 0.0000 169 | 6/8
12 h-m-p 0.3078 8.0000 0.0000 +C 845.352838 0 1.2311 181 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 Y 845.352838 0 1.6000 194 | 6/8
14 h-m-p 0.0233 8.0000 0.0000 N 845.352838 0 0.0233 207 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 --------C 845.352838 0 0.0000 228
Out..
lnL = -845.352838
229 lfun, 229 eigenQcodon, 1374 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092397 0.100359 0.039214 0.022655 0.102362 0.033411 0.299867 0.510439 0.345467
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.652355
np = 9
lnL0 = -926.097984
Iterating by ming2
Initial: fx= 926.097984
x= 0.09240 0.10036 0.03921 0.02266 0.10236 0.03341 0.29987 0.51044 0.34547
1 h-m-p 0.0000 0.0001 491.4094 ++ 898.780340 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 271.1539 ++ 887.464068 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0000 676.3538 ++ 883.198140 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0001 1985.5890 ++ 849.720692 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0000 1299.8429 ++ 845.837918 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0002 229.0080 ++ 845.419595 m 0.0002 74 | 6/9
7 h-m-p 0.0014 0.0519 11.9858 -----------.. | 6/9
8 h-m-p 0.0000 0.0000 213.9956 ++ 845.352836 m 0.0000 107 | 7/9
9 h-m-p 0.0160 8.0000 0.0000 Y 845.352836 0 0.0040 119 | 7/9
10 h-m-p 0.1605 8.0000 0.0000 C 845.352836 0 0.1605 133
Out..
lnL = -845.352836
134 lfun, 402 eigenQcodon, 1608 P(t)
Time used: 0:00
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046619 0.044768 0.094842 0.042711 0.057750 0.072858 0.282403 1.116664 0.431060 0.491175 1.361954
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.655332
np = 11
lnL0 = -920.258955
Iterating by ming2
Initial: fx= 920.258955
x= 0.04662 0.04477 0.09484 0.04271 0.05775 0.07286 0.28240 1.11666 0.43106 0.49118 1.36195
1 h-m-p 0.0000 0.0002 497.5242 +++ 867.441829 m 0.0002 17 | 1/11
2 h-m-p 0.0000 0.0001 166.1549 ++ 865.205237 m 0.0001 31 | 2/11
3 h-m-p 0.0000 0.0000 3497.3816 ++ 863.459048 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 3941.6458 ++ 855.940316 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 4598.7223 ++ 849.487707 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 33196.7695 ++ 845.352836 m 0.0000 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0000 ++ 845.352836 m 8.0000 101 | 6/11
8 h-m-p 0.0613 8.0000 0.0018 ++++ 845.352836 m 8.0000 122 | 6/11
9 h-m-p 0.0110 1.5874 1.3188 -----------Y 845.352836 0 0.0000 152 | 6/11
10 h-m-p 0.0160 8.0000 0.0005 +++++ 845.352836 m 8.0000 169 | 6/11
11 h-m-p 0.0039 1.9501 1.2100 --------C 845.352836 0 0.0000 196 | 6/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 845.352836 m 8.0000 213 | 6/11
13 h-m-p 0.0003 0.0517 1.9953 ++++ 845.352835 m 0.0517 234 | 7/11
14 h-m-p 0.0266 0.7262 2.2828 -----------C 845.352835 0 0.0000 259 | 7/11
15 h-m-p 0.0160 8.0000 0.0007 +++++ 845.352835 m 8.0000 276 | 7/11
16 h-m-p 0.0240 8.0000 0.2457 --------C 845.352835 0 0.0000 302 | 7/11
17 h-m-p 0.0160 8.0000 0.0001 +++++ 845.352835 m 8.0000 323 | 7/11
18 h-m-p 0.0025 1.2537 1.7957 ---------C 845.352835 0 0.0000 350 | 7/11
19 h-m-p 0.0160 8.0000 0.0000 +Y 845.352835 0 0.0640 365 | 7/11
20 h-m-p 0.0964 8.0000 0.0000 --------------.. | 7/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 845.352835 m 8.0000 416 | 7/11
22 h-m-p 0.0000 0.0189 8.8126 +++++ 845.352833 m 0.0189 437 | 8/11
23 h-m-p 0.0329 2.6100 0.4267 ++++ 845.352831 m 2.6100 453 | 9/11
24 h-m-p 0.4568 8.0000 2.1590 -----------C 845.352831 0 0.0000 481 | 9/11
25 h-m-p 0.0631 8.0000 0.0000 Y 845.352831 0 0.0631 495 | 9/11
26 h-m-p 0.1255 8.0000 0.0000 Y 845.352831 0 0.1255 511 | 9/11
27 h-m-p 0.0160 8.0000 0.0000 --N 845.352831 0 0.0003 529
Out..
lnL = -845.352831
530 lfun, 2120 eigenQcodon, 9540 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -845.375680 S = -845.351238 -0.009384
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:03
did 20 / 53 patterns 0:03
did 30 / 53 patterns 0:03
did 40 / 53 patterns 0:03
did 50 / 53 patterns 0:03
did 53 / 53 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053348 0.083992 0.090686 0.082708 0.107830 0.010966 0.000100 0.704607 1.707600
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.082018
np = 9
lnL0 = -932.144373
Iterating by ming2
Initial: fx= 932.144373
x= 0.05335 0.08399 0.09069 0.08271 0.10783 0.01097 0.00011 0.70461 1.70760
1 h-m-p 0.0000 0.0000 470.6142 ++ 931.665265 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0098 49.1521 +++++ 916.533624 m 0.0098 29 | 2/9
3 h-m-p 0.0002 0.0010 79.7802 ++ 884.447770 m 0.0010 41 | 3/9
4 h-m-p 0.0009 0.0045 23.2952 ++ 883.567137 m 0.0045 53 | 4/9
5 h-m-p 0.0001 0.0003 180.3597 ++ 874.142118 m 0.0003 65 | 5/9
6 h-m-p 0.0002 0.0027 196.9494 ++ 865.364290 m 0.0027 77 | 6/9
7 h-m-p 0.0074 0.0372 18.1249 -------------.. | 6/9
8 h-m-p 0.0000 0.0005 200.2107 +++ 845.352832 m 0.0005 113 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 845.352832 m 8.0000 125 | 7/9
10 h-m-p 0.3418 8.0000 0.0000 ---C 845.352832 0 0.0013 142 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 --C 845.352832 0 0.0003 158
Out..
lnL = -845.352832
159 lfun, 1749 eigenQcodon, 9540 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030141 0.023633 0.104905 0.104873 0.065214 0.086826 0.000100 0.900000 1.193427 1.000201 1.300006
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.620218
np = 11
lnL0 = -930.237418
Iterating by ming2
Initial: fx= 930.237418
x= 0.03014 0.02363 0.10491 0.10487 0.06521 0.08683 0.00011 0.90000 1.19343 1.00020 1.30001
1 h-m-p 0.0000 0.0000 479.9694 ++ 929.519853 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0019 136.9680 ++++ 899.059481 m 0.0019 32 | 2/11
3 h-m-p 0.0000 0.0001 345.0892 ++ 892.336947 m 0.0001 46 | 3/11
4 h-m-p 0.0002 0.0024 185.7051 ++ 864.106259 m 0.0024 60 | 4/11
5 h-m-p 0.0000 0.0000 93864.9861 ++ 851.973158 m 0.0000 74 | 5/11
6 h-m-p 0.0004 0.0018 403.7326 ++ 845.357646 m 0.0018 88 | 6/11
7 h-m-p 0.0000 0.0000 3782.6517 ++ 845.352834 m 0.0000 102 | 7/11
8 h-m-p 0.3685 8.0000 0.0084 ---------C 845.352834 0 0.0000 125 | 7/11
9 h-m-p 0.0160 8.0000 0.0000 --------C 845.352834 0 0.0000 151
Out..
lnL = -845.352834
152 lfun, 1824 eigenQcodon, 10032 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -845.358947 S = -845.348818 -0.004443
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:08
did 20 / 53 patterns 0:08
did 30 / 53 patterns 0:09
did 40 / 53 patterns 0:09
did 50 / 53 patterns 0:09
did 53 / 53 patterns 0:09
Time used: 0:09
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=216
NC_011896_1_WP_010908082_1_1060_MLBR_RS04990 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
NC_002677_1_NP_301758_1_630_ML1025 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
**************************************************
NC_011896_1_WP_010908082_1_1060_MLBR_RS04990 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
NC_002677_1_NP_301758_1_630_ML1025 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585 VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
**************************************************
NC_011896_1_WP_010908082_1_1060_MLBR_RS04990 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
NC_002677_1_NP_301758_1_630_ML1025 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585 RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
**************************************************
NC_011896_1_WP_010908082_1_1060_MLBR_RS04990 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
NC_002677_1_NP_301758_1_630_ML1025 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585 AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
**************************************************
NC_011896_1_WP_010908082_1_1060_MLBR_RS04990 EPSDPALLQKIHANSC
NC_002677_1_NP_301758_1_630_ML1025 EPSDPALLQKIHANSC
NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745 EPSDPALLQKIHANSC
NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250 EPSDPALLQKIHANSC
NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480 EPSDPALLQKIHANSC
NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585 EPSDPALLQKIHANSC
****************
>NC_011896_1_WP_010908082_1_1060_MLBR_RS04990 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC >NC_002677_1_NP_301758_1_630_ML1025 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC >NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC >NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC >NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC >NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585 GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>NC_011896_1_WP_010908082_1_1060_MLBR_RS04990 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT EPSDPALLQKIHANSC >NC_002677_1_NP_301758_1_630_ML1025 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT EPSDPALLQKIHANSC >NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT EPSDPALLQKIHANSC >NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT EPSDPALLQKIHANSC >NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT EPSDPALLQKIHANSC >NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585 VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT EPSDPALLQKIHANSC
#NEXUS
[ID: 0163529363]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908082_1_1060_MLBR_RS04990
NC_002677_1_NP_301758_1_630_ML1025
NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745
NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250
NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480
NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908082_1_1060_MLBR_RS04990,
2 NC_002677_1_NP_301758_1_630_ML1025,
3 NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745,
4 NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250,
5 NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480,
6 NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07009909,2:0.06851717,3:0.06896405,4:0.06742948,5:0.07212427,6:0.06906029);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07009909,2:0.06851717,3:0.06896405,4:0.06742948,5:0.07212427,6:0.06906029);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -874.97 -877.90
2 -874.99 -879.05
--------------------------------------
TOTAL -874.98 -878.63
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.902251 0.091180 0.376751 1.481713 0.861733 1346.84 1410.72 1.000
r(A<->C){all} 0.174863 0.021537 0.000050 0.479800 0.138258 182.79 213.59 1.000
r(A<->G){all} 0.158048 0.018790 0.000027 0.433233 0.120056 209.99 235.19 1.000
r(A<->T){all} 0.159581 0.019231 0.000138 0.450537 0.122823 127.02 178.38 1.000
r(C<->G){all} 0.165703 0.018573 0.000182 0.446652 0.132625 268.30 337.22 1.007
r(C<->T){all} 0.170210 0.022190 0.000036 0.482860 0.128421 217.85 245.00 1.001
r(G<->T){all} 0.171595 0.021171 0.000205 0.462596 0.128302 325.49 336.28 1.004
pi(A){all} 0.207163 0.000250 0.176535 0.238078 0.206887 1297.78 1313.79 1.001
pi(C){all} 0.345323 0.000334 0.310034 0.380737 0.345576 1135.70 1188.94 1.000
pi(G){all} 0.282442 0.000306 0.248927 0.316367 0.282315 1307.72 1338.24 1.000
pi(T){all} 0.165072 0.000212 0.138887 0.195177 0.164793 1089.49 1131.24 1.000
alpha{1,2} 0.411553 0.225264 0.000193 1.367900 0.238199 1281.86 1332.01 1.000
alpha{3} 0.465092 0.245424 0.000719 1.441203 0.304913 1012.55 1179.06 1.000
pinvar{all} 0.997655 0.000008 0.992342 0.999999 0.998596 1414.45 1416.35 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML1025/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 216
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 2 2 2 2 2 2
TTC 6 6 6 6 6 6 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 2 2 2 2 2 2
Leu TTA 0 0 0 0 0 0 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 3 3 3 3 3 3 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 3 3 3
CTC 4 4 4 4 4 4 | CCC 4 4 4 4 4 4 | CAC 5 5 5 5 5 5 | CGC 3 3 3 3 3 3
CTA 4 4 4 4 4 4 | CCA 3 3 3 3 3 3 | Gln CAA 7 7 7 7 7 7 | CGA 2 2 2 2 2 2
CTG 9 9 9 9 9 9 | CCG 5 5 5 5 5 5 | CAG 3 3 3 3 3 3 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 4 4 4 4 4 4 | Asn AAT 2 2 2 2 2 2 | Ser AGT 0 0 0 0 0 0
ATC 4 4 4 4 4 4 | ACC 13 13 13 13 13 13 | AAC 6 6 6 6 6 6 | AGC 4 4 4 4 4 4
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 2 2 2 2 2 2 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 3 3 3 3 3 3 | Gly GGT 5 5 5 5 5 5
GTC 4 4 4 4 4 4 | GCC 17 17 17 17 17 17 | GAC 14 14 14 14 14 14 | GGC 6 6 6 6 6 6
GTA 3 3 3 3 3 3 | GCA 4 4 4 4 4 4 | Glu GAA 1 1 1 1 1 1 | GGA 1 1 1 1 1 1
GTG 11 11 11 11 11 11 | GCG 6 6 6 6 6 6 | GAG 5 5 5 5 5 5 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908082_1_1060_MLBR_RS04990
position 1: T:0.09722 C:0.28241 A:0.22222 G:0.39815
position 2: T:0.25926 C:0.32407 A:0.24537 G:0.17130
position 3: T:0.13889 C:0.43056 A:0.15278 G:0.27778
Average T:0.16512 C:0.34568 A:0.20679 G:0.28241
#2: NC_002677_1_NP_301758_1_630_ML1025
position 1: T:0.09722 C:0.28241 A:0.22222 G:0.39815
position 2: T:0.25926 C:0.32407 A:0.24537 G:0.17130
position 3: T:0.13889 C:0.43056 A:0.15278 G:0.27778
Average T:0.16512 C:0.34568 A:0.20679 G:0.28241
#3: NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745
position 1: T:0.09722 C:0.28241 A:0.22222 G:0.39815
position 2: T:0.25926 C:0.32407 A:0.24537 G:0.17130
position 3: T:0.13889 C:0.43056 A:0.15278 G:0.27778
Average T:0.16512 C:0.34568 A:0.20679 G:0.28241
#4: NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250
position 1: T:0.09722 C:0.28241 A:0.22222 G:0.39815
position 2: T:0.25926 C:0.32407 A:0.24537 G:0.17130
position 3: T:0.13889 C:0.43056 A:0.15278 G:0.27778
Average T:0.16512 C:0.34568 A:0.20679 G:0.28241
#5: NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480
position 1: T:0.09722 C:0.28241 A:0.22222 G:0.39815
position 2: T:0.25926 C:0.32407 A:0.24537 G:0.17130
position 3: T:0.13889 C:0.43056 A:0.15278 G:0.27778
Average T:0.16512 C:0.34568 A:0.20679 G:0.28241
#6: NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585
position 1: T:0.09722 C:0.28241 A:0.22222 G:0.39815
position 2: T:0.25926 C:0.32407 A:0.24537 G:0.17130
position 3: T:0.13889 C:0.43056 A:0.15278 G:0.27778
Average T:0.16512 C:0.34568 A:0.20679 G:0.28241
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 12
TTC 36 | TCC 0 | TAC 6 | TGC 12
Leu L TTA 0 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 12 | TCG 12 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 18 | His H CAT 0 | Arg R CGT 18
CTC 24 | CCC 24 | CAC 30 | CGC 18
CTA 24 | CCA 18 | Gln Q CAA 42 | CGA 12
CTG 54 | CCG 30 | CAG 18 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 24 | Asn N AAT 12 | Ser S AGT 0
ATC 24 | ACC 78 | AAC 36 | AGC 24
ATA 6 | ACA 12 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 12 | ACG 12 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 12 | Asp D GAT 18 | Gly G GGT 30
GTC 24 | GCC 102 | GAC 84 | GGC 36
GTA 18 | GCA 24 | Glu E GAA 6 | GGA 6
GTG 66 | GCG 36 | GAG 30 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.09722 C:0.28241 A:0.22222 G:0.39815
position 2: T:0.25926 C:0.32407 A:0.24537 G:0.17130
position 3: T:0.13889 C:0.43056 A:0.15278 G:0.27778
Average T:0.16512 C:0.34568 A:0.20679 G:0.28241
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -845.352838 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299867 1.300006
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908082_1_1060_MLBR_RS04990: 0.000004, NC_002677_1_NP_301758_1_630_ML1025: 0.000004, NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745: 0.000004, NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250: 0.000004, NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480: 0.000004, NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29987
omega (dN/dS) = 1.30001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 493.4 154.6 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 493.4 154.6 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 493.4 154.6 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 493.4 154.6 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 493.4 154.6 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 493.4 154.6 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -845.352836 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.282403 0.614569 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908082_1_1060_MLBR_RS04990: 0.000004, NC_002677_1_NP_301758_1_630_ML1025: 0.000004, NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745: 0.000004, NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250: 0.000004, NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480: 0.000004, NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.28240
MLEs of dN/dS (w) for site classes (K=2)
p: 0.61457 0.38543
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 493.6 154.4 0.3854 0.0000 0.0000 0.0 0.0
7..2 0.000 493.6 154.4 0.3854 0.0000 0.0000 0.0 0.0
7..3 0.000 493.6 154.4 0.3854 0.0000 0.0000 0.0 0.0
7..4 0.000 493.6 154.4 0.3854 0.0000 0.0000 0.0 0.0
7..5 0.000 493.6 154.4 0.3854 0.0000 0.0000 0.0 0.0
7..6 0.000 493.6 154.4 0.3854 0.0000 0.0000 0.0 0.0
Time used: 0:00
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -845.352831 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.791209 0.105160 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908082_1_1060_MLBR_RS04990: 0.000004, NC_002677_1_NP_301758_1_630_ML1025: 0.000004, NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745: 0.000004, NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250: 0.000004, NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480: 0.000004, NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.79121 0.10516 0.10363
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.3 150.7 0.2088 0.0000 0.0000 0.0 0.0
7..2 0.000 497.3 150.7 0.2088 0.0000 0.0000 0.0 0.0
7..3 0.000 497.3 150.7 0.2088 0.0000 0.0000 0.0 0.0
7..4 0.000 497.3 150.7 0.2088 0.0000 0.0000 0.0 0.0
7..5 0.000 497.3 150.7 0.2088 0.0000 0.0000 0.0 0.0
7..6 0.000 497.3 150.7 0.2088 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908082_1_1060_MLBR_RS04990)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.101 0.101 0.100 0.100 0.100 0.099 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -845.352832 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.436011 1.074823
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908082_1_1060_MLBR_RS04990: 0.000004, NC_002677_1_NP_301758_1_630_ML1025: 0.000004, NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745: 0.000004, NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250: 0.000004, NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480: 0.000004, NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.43601 q = 1.07482
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00095 0.01178 0.03807 0.08257 0.14747 0.23486 0.34695 0.48645 0.65728 0.86768
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.3 150.7 0.2874 0.0000 0.0000 0.0 0.0
7..2 0.000 497.3 150.7 0.2874 0.0000 0.0000 0.0 0.0
7..3 0.000 497.3 150.7 0.2874 0.0000 0.0000 0.0 0.0
7..4 0.000 497.3 150.7 0.2874 0.0000 0.0000 0.0 0.0
7..5 0.000 497.3 150.7 0.2874 0.0000 0.0000 0.0 0.0
7..6 0.000 497.3 150.7 0.2874 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -845.352834 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.463334 0.255982 1.662010 2.339325
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908082_1_1060_MLBR_RS04990: 0.000004, NC_002677_1_NP_301758_1_630_ML1025: 0.000004, NZ_LVXE01000017_1_WP_010908082_1_654_A3216_RS06745: 0.000004, NZ_LYPH01000015_1_WP_010908082_1_478_A8144_RS02250: 0.000004, NZ_CP029543_1_WP_010908082_1_1081_DIJ64_RS05480: 0.000004, NZ_AP014567_1_WP_010908082_1_1102_JK2ML_RS05585: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.46333 p = 0.25598 q = 1.66201
(p1 = 0.53667) w = 2.33932
MLEs of dN/dS (w) for site classes (K=11)
p: 0.04633 0.04633 0.04633 0.04633 0.04633 0.04633 0.04633 0.04633 0.04633 0.04633 0.53667
w: 0.00000 0.00031 0.00229 0.00855 0.02299 0.05112 0.10085 0.18477 0.32705 0.59953 2.33932
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 497.3 150.7 1.3156 0.0000 0.0000 0.0 0.0
7..2 0.000 497.3 150.7 1.3156 0.0000 0.0000 0.0 0.0
7..3 0.000 497.3 150.7 1.3156 0.0000 0.0000 0.0 0.0
7..4 0.000 497.3 150.7 1.3156 0.0000 0.0000 0.0 0.0
7..5 0.000 497.3 150.7 1.3156 0.0000 0.0000 0.0 0.0
7..6 0.000 497.3 150.7 1.3156 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908082_1_1060_MLBR_RS04990)
Pr(w>1) post mean +- SE for w
1 V 0.537 1.316
2 V 0.537 1.316
3 T 0.537 1.316
4 Q 0.537 1.316
5 I 0.537 1.316
6 T 0.537 1.316
7 E 0.537 1.316
8 G 0.537 1.316
9 T 0.537 1.316
10 A 0.537 1.316
11 F 0.537 1.316
12 D 0.537 1.316
13 K 0.537 1.316
14 H 0.537 1.316
15 G 0.537 1.316
16 R 0.537 1.316
17 P 0.537 1.316
18 F 0.537 1.316
19 R 0.537 1.316
20 R 0.537 1.316
21 R 0.537 1.316
22 N 0.537 1.316
23 A 0.537 1.316
24 R 0.537 1.316
25 P 0.537 1.316
26 A 0.537 1.316
27 I 0.537 1.316
28 F 0.537 1.316
29 V 0.537 1.316
30 V 0.537 1.316
31 V 0.537 1.316
32 F 0.537 1.316
33 L 0.537 1.316
34 V 0.537 1.316
35 I 0.537 1.316
36 V 0.537 1.316
37 A 0.537 1.316
38 G 0.537 1.316
39 V 0.537 1.316
40 S 0.537 1.316
41 W 0.537 1.316
42 T 0.537 1.316
43 I 0.537 1.316
44 A 0.537 1.316
45 L 0.537 1.316
46 T 0.537 1.316
47 R 0.537 1.316
48 P 0.537 1.316
49 A 0.537 1.316
50 K 0.537 1.316
51 V 0.537 1.316
52 R 0.537 1.316
53 E 0.537 1.316
54 P 0.537 1.316
55 E 0.537 1.316
56 V 0.537 1.316
57 C 0.537 1.316
58 N 0.537 1.316
59 P 0.537 1.316
60 P 0.537 1.316
61 T 0.537 1.316
62 Q 0.537 1.316
63 S 0.537 1.316
64 T 0.537 1.316
65 G 0.537 1.316
66 S 0.537 1.316
67 V 0.537 1.316
68 P 0.537 1.316
69 T 0.537 1.316
70 Q 0.537 1.316
71 L 0.537 1.316
72 G 0.537 1.316
73 K 0.537 1.316
74 Q 0.537 1.316
75 V 0.537 1.316
76 P 0.537 1.316
77 R 0.537 1.316
78 T 0.537 1.316
79 E 0.537 1.316
80 M 0.537 1.316
81 T 0.537 1.316
82 D 0.537 1.316
83 V 0.537 1.316
84 T 0.537 1.316
85 P 0.537 1.316
86 A 0.537 1.316
87 K 0.537 1.316
88 L 0.537 1.316
89 S 0.537 1.316
90 D 0.537 1.316
91 T 0.537 1.316
92 K 0.537 1.316
93 V 0.537 1.316
94 H 0.537 1.316
95 V 0.537 1.316
96 L 0.537 1.316
97 N 0.537 1.316
98 A 0.537 1.316
99 S 0.537 1.316
100 G 0.537 1.316
101 R 0.537 1.316
102 D 0.537 1.316
103 G 0.537 1.316
104 Q 0.537 1.316
105 A 0.537 1.316
106 A 0.537 1.316
107 D 0.537 1.316
108 I 0.537 1.316
109 A 0.537 1.316
110 G 0.537 1.316
111 A 0.537 1.316
112 L 0.537 1.316
113 R 0.537 1.316
114 D 0.537 1.316
115 L 0.537 1.316
116 G 0.537 1.316
117 F 0.537 1.316
118 A 0.537 1.316
119 Q 0.537 1.316
120 P 0.537 1.316
121 T 0.537 1.316
122 A 0.537 1.316
123 A 0.537 1.316
124 N 0.537 1.316
125 D 0.537 1.316
126 P 0.537 1.316
127 M 0.537 1.316
128 Y 0.537 1.316
129 A 0.537 1.316
130 D 0.537 1.316
131 T 0.537 1.316
132 L 0.537 1.316
133 L 0.537 1.316
134 N 0.537 1.316
135 C 0.537 1.316
136 Q 0.537 1.316
137 G 0.537 1.316
138 Q 0.537 1.316
139 L 0.537 1.316
140 R 0.537 1.316
141 F 0.537 1.316
142 G 0.537 1.316
143 T 0.537 1.316
144 A 0.537 1.316
145 G 0.537 1.316
146 Q 0.537 1.316
147 A 0.537 1.316
148 T 0.537 1.316
149 V 0.537 1.316
150 A 0.537 1.316
151 A 0.537 1.316
152 V 0.537 1.316
153 W 0.537 1.316
154 L 0.537 1.316
155 V 0.537 1.316
156 A 0.537 1.316
157 P 0.537 1.316
158 C 0.537 1.316
159 T 0.537 1.316
160 E 0.537 1.316
161 L 0.537 1.316
162 L 0.537 1.316
163 H 0.537 1.316
164 D 0.537 1.316
165 N 0.537 1.316
166 R 0.537 1.316
167 T 0.537 1.316
168 D 0.537 1.316
169 D 0.537 1.316
170 S 0.537 1.316
171 V 0.537 1.316
172 D 0.537 1.316
173 L 0.537 1.316
174 A 0.537 1.316
175 L 0.537 1.316
176 G 0.537 1.316
177 T 0.537 1.316
178 D 0.537 1.316
179 F 0.537 1.316
180 T 0.537 1.316
181 A 0.537 1.316
182 L 0.537 1.316
183 A 0.537 1.316
184 H 0.537 1.316
185 N 0.537 1.316
186 D 0.537 1.316
187 D 0.537 1.316
188 I 0.537 1.316
189 D 0.537 1.316
190 A 0.537 1.316
191 V 0.537 1.316
192 L 0.537 1.316
193 A 0.537 1.316
194 S 0.537 1.316
195 L 0.537 1.316
196 R 0.537 1.316
197 P 0.537 1.316
198 G 0.537 1.316
199 A 0.537 1.316
200 T 0.537 1.316
201 E 0.537 1.316
202 P 0.537 1.316
203 S 0.537 1.316
204 D 0.537 1.316
205 P 0.537 1.316
206 A 0.537 1.316
207 L 0.537 1.316
208 L 0.537 1.316
209 Q 0.537 1.316
210 K 0.537 1.316
211 I 0.537 1.316
212 H 0.537 1.316
213 A 0.537 1.316
214 N 0.537 1.316
215 S 0.537 1.316
216 C 0.537 1.316
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908082_1_1060_MLBR_RS04990)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:09
Model 1: NearlyNeutral -845.352836 Model 2: PositiveSelection -845.352831 Model 0: one-ratio -845.352838 Model 7: beta -845.352832 Model 8: beta&w>1 -845.352834 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 9.999999974752427E-6 Model 8 vs 7 3.999999989900971E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
