--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 17:21:40 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML1025/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -874.97          -877.90
2       -874.99          -879.05
--------------------------------------
TOTAL     -874.98          -878.63
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.902251    0.091180    0.376751    1.481713    0.861733   1346.84   1410.72    1.000
r(A<->C){all}   0.174863    0.021537    0.000050    0.479800    0.138258    182.79    213.59    1.000
r(A<->G){all}   0.158048    0.018790    0.000027    0.433233    0.120056    209.99    235.19    1.000
r(A<->T){all}   0.159581    0.019231    0.000138    0.450537    0.122823    127.02    178.38    1.000
r(C<->G){all}   0.165703    0.018573    0.000182    0.446652    0.132625    268.30    337.22    1.007
r(C<->T){all}   0.170210    0.022190    0.000036    0.482860    0.128421    217.85    245.00    1.001
r(G<->T){all}   0.171595    0.021171    0.000205    0.462596    0.128302    325.49    336.28    1.004
pi(A){all}      0.207163    0.000250    0.176535    0.238078    0.206887   1297.78   1313.79    1.001
pi(C){all}      0.345323    0.000334    0.310034    0.380737    0.345576   1135.70   1188.94    1.000
pi(G){all}      0.282442    0.000306    0.248927    0.316367    0.282315   1307.72   1338.24    1.000
pi(T){all}      0.165072    0.000212    0.138887    0.195177    0.164793   1089.49   1131.24    1.000
alpha{1,2}      0.411553    0.225264    0.000193    1.367900    0.238199   1281.86   1332.01    1.000
alpha{3}        0.465092    0.245424    0.000719    1.441203    0.304913   1012.55   1179.06    1.000
pinvar{all}     0.997655    0.000008    0.992342    0.999999    0.998596   1414.45   1416.35    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-845.352836
Model 2: PositiveSelection	-845.352831
Model 0: one-ratio	-845.352838
Model 7: beta	-845.352832
Model 8: beta&w>1	-845.352834


Model 0 vs 1	3.999999989900971E-6

Model 2 vs 1	9.999999974752427E-6

Model 8 vs 7	3.999999989900971E-6
>C1
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C2
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C3
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C4
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C5
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C6
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=216 

C1              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C2              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C3              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C4              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C5              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C6              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
                **************************************************

C1              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C2              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C3              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C4              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C5              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C6              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
                **************************************************

C1              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C2              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C3              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C4              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C5              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C6              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
                **************************************************

C1              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C2              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C3              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C4              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C5              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C6              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
                **************************************************

C1              EPSDPALLQKIHANSC
C2              EPSDPALLQKIHANSC
C3              EPSDPALLQKIHANSC
C4              EPSDPALLQKIHANSC
C5              EPSDPALLQKIHANSC
C6              EPSDPALLQKIHANSC
                ****************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  216 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  216 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6480]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6480]--->[6480]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.479 Mb, Max= 30.757 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C2              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C3              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C4              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C5              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
C6              VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
                **************************************************

C1              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C2              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C3              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C4              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C5              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
C6              VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
                **************************************************

C1              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C2              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C3              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C4              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C5              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
C6              RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
                **************************************************

C1              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C2              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C3              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C4              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C5              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
C6              AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
                **************************************************

C1              EPSDPALLQKIHANSC
C2              EPSDPALLQKIHANSC
C3              EPSDPALLQKIHANSC
C4              EPSDPALLQKIHANSC
C5              EPSDPALLQKIHANSC
C6              EPSDPALLQKIHANSC
                ****************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C2              GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C3              GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C4              GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C5              GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
C6              GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
                **************************************************

C1              CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C2              CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C3              CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C4              CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C5              CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
C6              CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
                **************************************************

C1              TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C2              TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C3              TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C4              TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C5              TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
C6              TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
                **************************************************

C1              GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C2              GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C3              GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C4              GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C5              GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
C6              GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
                **************************************************

C1              GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C2              GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C3              GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C4              GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C5              GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
C6              GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
                **************************************************

C1              CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C2              CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C3              CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C4              CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C5              CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
C6              CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
                **************************************************

C1              CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C2              CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C3              CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C4              CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C5              CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
C6              CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
                **************************************************

C1              CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C2              CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C3              CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C4              CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C5              CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
C6              CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
                **************************************************

C1              ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C2              ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C3              ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C4              ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C5              ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
C6              ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
                **************************************************

C1              GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C2              GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C3              GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C4              GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C5              GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
C6              GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
                **************************************************

C1              CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C2              CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C3              CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C4              CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C5              CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
C6              CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
                **************************************************

C1              ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C2              ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C3              ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C4              ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C5              ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
C6              ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
                **************************************************

C1              GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C2              GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C3              GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C4              GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C5              GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
C6              GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
                ************************************************



>C1
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C2
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C3
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C4
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C5
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C6
GTGGTCACACAAATCACCGAGGGTACCGCTTTCGACAAGCACGGTCGGCC
CTTTCGGCGACGCAATGCCCGCCCTGCCATTTTCGTGGTAGTGTTCTTGG
TCATAGTGGCGGGCGTGTCATGGACTATTGCACTCACCCGACCAGCGAAG
GTTCGTGAGCCCGAAGTGTGTAACCCGCCTACGCAATCAACCGGGTCGGT
GCCGACCCAGCTAGGCAAACAAGTGCCACGGACGGAGATGACTGACGTCA
CACCCGCCAAACTCAGCGACACCAAGGTCCACGTGCTCAATGCCAGCGGC
CGGGACGGTCAAGCCGCCGATATCGCCGGCGCACTGCGGGATCTAGGATT
CGCCCAGCCAACCGCCGCCAACGACCCGATGTACGCCGACACTCTACTAA
ACTGCCAAGGTCAGCTCCGTTTCGGTACTGCCGGGCAAGCCACCGTAGCC
GCGGTGTGGCTGGTAGCACCGTGTACCGAGTTGCTGCACGACAACCGCAC
CGACGACTCGGTTGACCTTGCGCTGGGCACCGACTTCACCGCGCTGGCGC
ACAACGACGACATCGACGCTGTGCTGGCCAGCCTGCGTCCCGGCGCCACC
GAGCCGTCAGATCCTGCACTGCTGCAAAAGATCCACGCCAACAGCTGC
>C1
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C2
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C3
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C4
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C5
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC
>C6
VVTQITEGTAFDKHGRPFRRRNARPAIFVVVFLVIVAGVSWTIALTRPAK
VREPEVCNPPTQSTGSVPTQLGKQVPRTEMTDVTPAKLSDTKVHVLNASG
RDGQAADIAGALRDLGFAQPTAANDPMYADTLLNCQGQLRFGTAGQATVA
AVWLVAPCTELLHDNRTDDSVDLALGTDFTALAHNDDIDAVLASLRPGAT
EPSDPALLQKIHANSC


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 648 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579800026
      Setting output file names to "/data/5res/ML1025/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1207664176
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0163529363
      Seed = 1411897286
      Swapseed = 1579800026
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1450.255071 -- -24.965149
         Chain 2 -- -1450.255071 -- -24.965149
         Chain 3 -- -1450.254849 -- -24.965149
         Chain 4 -- -1450.255071 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1450.255071 -- -24.965149
         Chain 2 -- -1450.254988 -- -24.965149
         Chain 3 -- -1450.255071 -- -24.965149
         Chain 4 -- -1450.255071 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1450.255] (-1450.255) (-1450.255) (-1450.255) * [-1450.255] (-1450.255) (-1450.255) (-1450.255) 
        500 -- (-899.492) [-891.221] (-901.764) (-889.732) * (-883.835) [-895.949] (-898.006) (-891.281) -- 0:00:00
       1000 -- (-890.891) (-892.841) (-899.626) [-880.530] * (-885.085) (-887.246) [-881.894] (-891.739) -- 0:00:00
       1500 -- (-889.947) (-885.125) (-885.339) [-880.565] * (-886.725) (-884.407) [-886.289] (-882.057) -- 0:00:00
       2000 -- (-878.114) (-883.263) (-879.856) [-886.721] * (-884.572) (-881.719) (-890.240) [-881.379] -- 0:00:00
       2500 -- (-891.084) (-882.040) [-882.985] (-881.187) * (-890.602) (-880.159) (-883.066) [-880.035] -- 0:00:00
       3000 -- [-881.890] (-885.852) (-883.920) (-881.506) * (-882.875) (-886.970) (-885.821) [-886.832] -- 0:00:00
       3500 -- (-876.046) (-881.043) [-887.681] (-892.912) * (-894.175) [-882.898] (-887.714) (-889.377) -- 0:00:00
       4000 -- [-882.305] (-880.845) (-886.529) (-887.623) * (-892.465) (-884.263) [-877.792] (-884.360) -- 0:00:00
       4500 -- (-882.945) (-893.396) (-888.957) [-887.574] * (-881.273) (-882.127) (-892.352) [-879.217] -- 0:00:00
       5000 -- (-886.504) (-888.801) (-883.195) [-881.662] * (-884.768) (-880.492) [-880.263] (-890.505) -- 0:00:00

      Average standard deviation of split frequencies: 0.092852

       5500 -- [-883.125] (-884.002) (-883.322) (-891.997) * [-885.188] (-887.959) (-893.589) (-890.037) -- 0:00:00
       6000 -- (-889.863) (-884.201) (-884.755) [-881.931] * (-886.299) (-889.776) [-882.417] (-881.227) -- 0:00:00
       6500 -- [-883.635] (-885.560) (-884.185) (-884.810) * [-880.106] (-884.768) (-892.982) (-884.735) -- 0:00:00
       7000 -- (-887.930) (-888.388) (-878.825) [-880.680] * [-880.462] (-887.881) (-882.221) (-883.847) -- 0:00:00
       7500 -- (-889.001) (-891.419) (-884.976) [-880.473] * [-882.263] (-892.461) (-886.052) (-888.794) -- 0:02:12
       8000 -- (-885.270) (-894.621) [-884.739] (-889.180) * [-879.231] (-884.608) (-885.126) (-879.233) -- 0:02:04
       8500 -- [-889.440] (-891.187) (-882.065) (-882.006) * (-890.338) [-880.828] (-887.976) (-878.151) -- 0:01:56
       9000 -- (-889.411) (-893.075) [-884.687] (-890.345) * (-887.892) (-880.844) (-884.547) [-873.963] -- 0:01:50
       9500 -- (-886.467) [-884.828] (-883.054) (-881.034) * (-893.568) (-882.317) (-884.247) [-876.057] -- 0:01:44
      10000 -- (-885.356) (-876.231) [-888.540] (-886.917) * (-882.929) (-884.661) [-881.978] (-875.623) -- 0:01:39

      Average standard deviation of split frequencies: 0.070711

      10500 -- [-882.865] (-879.734) (-886.897) (-890.503) * [-883.698] (-888.924) (-888.486) (-875.479) -- 0:01:34
      11000 -- (-887.570) (-882.104) (-883.970) [-889.200] * [-882.615] (-886.327) (-888.892) (-879.076) -- 0:01:29
      11500 -- [-881.814] (-874.577) (-902.077) (-884.914) * (-885.295) (-881.895) [-881.223] (-877.122) -- 0:01:25
      12000 -- (-885.638) (-880.217) [-882.114] (-893.383) * (-890.681) (-885.636) [-877.688] (-877.179) -- 0:01:22
      12500 -- (-882.567) [-876.759] (-882.834) (-887.067) * (-886.959) (-885.434) (-891.059) [-877.425] -- 0:01:19
      13000 -- (-884.795) (-875.313) [-879.942] (-880.637) * [-882.390] (-884.618) (-887.319) (-878.496) -- 0:01:15
      13500 -- (-880.540) (-874.798) [-876.276] (-885.426) * [-882.980] (-879.863) (-886.423) (-878.731) -- 0:01:13
      14000 -- (-891.966) [-875.107] (-881.547) (-883.352) * [-881.966] (-891.550) (-881.578) (-878.182) -- 0:01:10
      14500 -- (-882.219) (-880.608) [-874.809] (-889.635) * [-888.098] (-886.257) (-888.082) (-877.925) -- 0:01:07
      15000 -- [-879.104] (-879.220) (-877.259) (-887.688) * (-893.791) [-884.530] (-890.528) (-876.034) -- 0:01:05

      Average standard deviation of split frequencies: 0.047140

      15500 -- [-876.815] (-877.141) (-878.847) (-885.927) * (-885.025) [-884.557] (-887.713) (-875.122) -- 0:01:03
      16000 -- (-891.585) [-877.880] (-878.327) (-884.288) * [-888.229] (-881.002) (-879.511) (-876.351) -- 0:01:01
      16500 -- [-884.840] (-875.091) (-876.949) (-883.233) * (-885.687) (-885.126) (-877.134) [-874.840] -- 0:00:59
      17000 -- (-882.679) [-875.543] (-875.145) (-889.760) * [-892.508] (-886.077) (-875.658) (-875.783) -- 0:00:57
      17500 -- (-890.800) (-877.353) [-875.649] (-888.091) * [-888.223] (-886.190) (-876.159) (-875.476) -- 0:00:56
      18000 -- (-882.900) (-875.650) (-878.472) [-884.727] * [-881.562] (-881.487) (-874.933) (-876.939) -- 0:00:54
      18500 -- (-892.382) (-875.532) (-874.783) [-884.195] * (-882.314) (-882.697) [-874.005] (-877.994) -- 0:00:53
      19000 -- (-877.999) (-877.523) [-876.410] (-886.642) * (-893.340) [-882.608] (-877.215) (-873.977) -- 0:00:51
      19500 -- (-875.669) [-876.949] (-874.785) (-880.930) * (-883.942) [-881.408] (-876.025) (-874.049) -- 0:00:50
      20000 -- [-874.042] (-875.720) (-879.915) (-884.579) * (-887.815) [-883.001] (-874.897) (-878.370) -- 0:00:49

      Average standard deviation of split frequencies: 0.049645

      20500 -- [-874.020] (-875.726) (-877.809) (-883.724) * (-881.417) [-876.961] (-875.266) (-877.367) -- 0:00:47
      21000 -- [-874.826] (-874.709) (-874.294) (-884.766) * (-888.039) (-881.208) [-876.049] (-874.937) -- 0:00:46
      21500 -- [-874.477] (-874.866) (-878.422) (-886.844) * (-888.230) (-880.395) [-875.941] (-876.953) -- 0:00:45
      22000 -- (-874.349) (-876.397) [-877.512] (-884.733) * [-882.105] (-881.872) (-873.737) (-874.584) -- 0:00:44
      22500 -- (-874.097) (-875.260) [-876.033] (-889.403) * (-882.709) [-885.993] (-873.368) (-875.404) -- 0:00:43
      23000 -- (-873.976) (-874.948) (-875.691) [-888.806] * (-883.369) [-880.071] (-874.205) (-874.402) -- 0:00:42
      23500 -- [-874.367] (-874.877) (-876.635) (-887.162) * (-895.600) (-887.140) [-875.003] (-874.987) -- 0:00:41
      24000 -- (-877.599) (-879.211) [-874.152] (-890.195) * [-888.832] (-891.533) (-878.099) (-874.812) -- 0:01:21
      24500 -- (-874.301) [-874.709] (-874.403) (-885.663) * (-887.994) (-884.895) (-878.254) [-874.126] -- 0:01:19
      25000 -- (-875.765) (-874.808) [-875.268] (-886.046) * (-884.940) (-894.035) (-875.715) [-880.461] -- 0:01:18

      Average standard deviation of split frequencies: 0.046759

      25500 -- (-877.519) [-873.972] (-875.837) (-896.842) * (-887.496) (-885.404) (-874.740) [-877.373] -- 0:01:16
      26000 -- (-877.384) [-874.040] (-876.759) (-899.014) * (-886.150) (-891.131) (-875.338) [-880.223] -- 0:01:14
      26500 -- (-876.117) (-875.765) (-879.008) [-875.250] * (-881.806) (-890.737) (-875.934) [-876.781] -- 0:01:13
      27000 -- (-875.600) [-875.085] (-878.746) (-879.079) * [-883.755] (-888.658) (-877.832) (-876.337) -- 0:01:12
      27500 -- (-876.820) (-875.077) (-876.367) [-874.025] * (-880.944) (-888.949) (-876.448) [-879.082] -- 0:01:10
      28000 -- (-876.407) (-877.243) (-875.829) [-874.120] * [-881.727] (-888.953) (-876.002) (-875.377) -- 0:01:09
      28500 -- (-875.450) [-877.222] (-878.263) (-876.240) * (-894.855) (-902.912) [-877.187] (-874.541) -- 0:01:08
      29000 -- (-874.611) (-878.132) [-875.083] (-877.075) * (-886.243) (-883.383) [-876.444] (-875.970) -- 0:01:06
      29500 -- [-875.003] (-876.430) (-877.766) (-877.746) * [-889.935] (-885.037) (-875.423) (-883.539) -- 0:01:05
      30000 -- (-875.994) [-875.276] (-875.453) (-879.109) * [-888.754] (-886.845) (-873.929) (-873.995) -- 0:01:04

      Average standard deviation of split frequencies: 0.041261

      30500 -- (-874.395) [-875.664] (-876.636) (-877.806) * [-890.073] (-885.029) (-875.741) (-877.024) -- 0:01:03
      31000 -- (-874.993) [-875.264] (-876.685) (-875.329) * [-887.252] (-886.631) (-873.990) (-876.937) -- 0:01:02
      31500 -- (-877.157) [-874.942] (-876.654) (-879.499) * (-883.960) [-879.522] (-877.194) (-874.533) -- 0:01:01
      32000 -- (-874.050) (-874.725) (-875.923) [-875.680] * (-887.741) [-877.556] (-876.095) (-876.201) -- 0:01:00
      32500 -- (-874.686) (-874.056) [-877.597] (-875.430) * [-883.503] (-876.249) (-882.061) (-873.390) -- 0:00:59
      33000 -- (-879.883) (-873.810) (-875.445) [-875.598] * (-883.092) (-876.658) [-881.399] (-873.851) -- 0:00:58
      33500 -- [-876.803] (-873.862) (-874.298) (-873.759) * [-886.676] (-877.984) (-876.335) (-875.784) -- 0:00:57
      34000 -- (-877.102) [-876.161] (-875.328) (-875.733) * (-887.618) (-874.635) [-875.966] (-874.331) -- 0:00:56
      34500 -- (-876.178) (-879.085) (-880.735) [-876.035] * (-888.381) (-874.173) (-884.738) [-874.122] -- 0:00:55
      35000 -- (-876.155) (-879.121) (-879.309) [-873.354] * (-891.357) (-875.178) [-875.820] (-877.090) -- 0:00:55

      Average standard deviation of split frequencies: 0.034459

      35500 -- (-873.877) [-877.348] (-876.152) (-875.006) * [-881.735] (-876.339) (-876.421) (-875.274) -- 0:00:54
      36000 -- [-874.546] (-876.168) (-877.157) (-877.559) * (-890.277) [-875.150] (-873.622) (-875.209) -- 0:00:53
      36500 -- [-874.387] (-877.521) (-873.716) (-875.914) * (-881.395) [-876.335] (-878.684) (-874.523) -- 0:00:52
      37000 -- (-874.354) (-880.023) (-875.018) [-875.221] * (-883.610) (-875.041) (-875.115) [-875.250] -- 0:00:52
      37500 -- (-875.964) (-876.324) (-876.298) [-873.585] * [-886.274] (-873.896) (-876.350) (-875.567) -- 0:00:51
      38000 -- (-875.191) [-874.887] (-877.205) (-873.938) * (-878.705) [-875.641] (-882.902) (-874.765) -- 0:00:50
      38500 -- (-876.788) [-875.048] (-873.426) (-874.498) * (-887.754) (-876.518) (-881.234) [-874.688] -- 0:00:49
      39000 -- [-874.881] (-875.374) (-873.638) (-875.011) * (-878.333) [-876.340] (-881.461) (-877.049) -- 0:00:49
      39500 -- (-876.605) [-883.983] (-874.265) (-875.036) * [-886.694] (-874.919) (-873.998) (-874.348) -- 0:01:12
      40000 -- (-875.000) [-874.837] (-874.446) (-875.302) * (-893.579) (-877.095) [-877.320] (-874.681) -- 0:01:12

      Average standard deviation of split frequencies: 0.031115

      40500 -- (-875.039) (-874.581) [-875.595] (-873.465) * (-887.081) [-877.311] (-876.638) (-875.343) -- 0:01:11
      41000 -- (-874.633) [-874.094] (-880.656) (-876.738) * [-879.852] (-875.654) (-877.408) (-875.666) -- 0:01:10
      41500 -- [-877.679] (-875.164) (-881.008) (-876.030) * [-880.387] (-874.596) (-873.657) (-874.653) -- 0:01:09
      42000 -- (-878.033) [-873.901] (-875.546) (-873.698) * (-882.255) [-875.408] (-875.822) (-875.513) -- 0:01:08
      42500 -- (-875.095) [-875.032] (-875.207) (-874.359) * (-889.635) (-874.467) [-876.260] (-875.539) -- 0:01:07
      43000 -- (-874.969) [-873.487] (-878.979) (-874.763) * (-888.150) (-875.942) [-873.846] (-874.880) -- 0:01:06
      43500 -- (-874.102) (-874.001) (-879.543) [-876.414] * (-897.200) [-876.094] (-877.152) (-875.367) -- 0:01:05
      44000 -- (-874.526) [-873.996] (-878.472) (-875.528) * (-879.233) (-878.489) (-876.840) [-875.937] -- 0:01:05
      44500 -- (-874.559) (-873.414) (-879.998) [-875.237] * [-883.348] (-874.009) (-877.717) (-876.508) -- 0:01:04
      45000 -- (-877.931) (-875.113) [-875.659] (-874.669) * [-884.997] (-875.441) (-877.743) (-876.511) -- 0:01:03

      Average standard deviation of split frequencies: 0.030744

      45500 -- (-876.390) (-875.114) [-874.783] (-877.125) * (-893.677) [-878.995] (-876.276) (-879.996) -- 0:01:02
      46000 -- (-874.555) (-879.338) (-874.525) [-874.256] * [-884.104] (-873.793) (-876.731) (-875.225) -- 0:01:02
      46500 -- (-873.952) (-876.591) [-873.840] (-873.714) * (-887.358) (-878.035) [-874.929] (-879.212) -- 0:01:01
      47000 -- (-874.047) (-873.646) (-875.278) [-874.220] * [-887.962] (-876.054) (-875.913) (-876.571) -- 0:01:00
      47500 -- (-876.852) (-873.612) [-876.648] (-874.062) * (-886.448) (-874.779) [-874.791] (-875.509) -- 0:01:00
      48000 -- (-875.420) (-876.070) [-874.530] (-874.955) * (-892.065) (-878.293) [-876.008] (-873.724) -- 0:00:59
      48500 -- (-873.718) (-875.182) [-873.822] (-877.306) * (-884.867) (-874.248) (-877.503) [-874.878] -- 0:00:58
      49000 -- (-873.782) [-874.478] (-875.675) (-878.151) * (-882.899) (-876.148) [-876.853] (-875.144) -- 0:00:58
      49500 -- (-875.421) (-876.702) (-874.945) [-874.469] * (-886.225) (-883.123) [-879.384] (-876.628) -- 0:00:57
      50000 -- (-875.326) [-873.782] (-875.830) (-876.714) * (-885.066) [-875.010] (-878.131) (-879.459) -- 0:00:57

      Average standard deviation of split frequencies: 0.026517

      50500 -- (-877.566) (-874.090) (-875.651) [-874.104] * (-890.875) (-878.685) [-876.601] (-873.945) -- 0:00:56
      51000 -- (-877.389) (-874.056) (-876.196) [-875.716] * (-881.324) (-879.464) (-877.216) [-873.769] -- 0:00:55
      51500 -- (-877.246) (-877.511) [-875.288] (-878.687) * (-884.669) (-879.725) (-876.095) [-874.252] -- 0:00:55
      52000 -- (-873.907) (-877.510) (-874.357) [-874.139] * (-886.338) (-882.178) (-875.937) [-875.045] -- 0:00:54
      52500 -- (-874.271) [-875.389] (-877.352) (-879.443) * [-880.160] (-874.315) (-876.465) (-877.390) -- 0:00:54
      53000 -- (-875.839) (-874.068) (-877.852) [-876.253] * [-882.783] (-874.293) (-876.178) (-878.604) -- 0:00:53
      53500 -- (-876.271) (-875.896) [-874.996] (-877.231) * (-884.478) (-877.388) (-877.068) [-878.634] -- 0:00:53
      54000 -- (-875.043) (-878.822) (-875.293) [-874.794] * (-893.649) (-875.340) [-879.829] (-882.127) -- 0:00:52
      54500 -- (-874.978) (-878.648) (-877.152) [-874.573] * [-884.107] (-877.293) (-876.414) (-878.552) -- 0:00:52
      55000 -- (-874.269) (-878.717) (-880.389) [-876.005] * (-885.453) (-877.989) (-874.630) [-874.987] -- 0:00:51

      Average standard deviation of split frequencies: 0.027026

      55500 -- [-874.451] (-880.942) (-874.038) (-874.239) * (-883.190) [-877.067] (-874.845) (-875.438) -- 0:00:51
      56000 -- (-876.945) (-874.951) [-876.243] (-876.665) * (-887.852) (-879.356) [-876.938] (-873.660) -- 0:01:07
      56500 -- [-875.395] (-881.286) (-875.417) (-875.414) * (-904.716) (-877.903) (-877.532) [-875.475] -- 0:01:06
      57000 -- (-879.786) (-882.268) (-874.761) [-877.768] * (-882.673) (-875.287) (-873.914) [-874.707] -- 0:01:06
      57500 -- (-877.327) [-874.574] (-874.689) (-874.732) * (-878.551) (-875.087) [-874.477] (-874.470) -- 0:01:05
      58000 -- (-879.659) (-879.696) (-875.294) [-874.664] * (-877.344) (-875.578) (-877.104) [-875.728] -- 0:01:04
      58500 -- (-876.700) [-879.795] (-874.596) (-874.086) * (-876.897) (-879.987) [-875.006] (-874.972) -- 0:01:04
      59000 -- (-875.215) (-875.696) (-876.530) [-873.953] * (-875.433) [-876.948] (-880.768) (-875.447) -- 0:01:03
      59500 -- (-873.835) (-877.623) (-877.743) [-874.302] * [-876.488] (-874.509) (-877.537) (-875.099) -- 0:01:03
      60000 -- (-875.766) (-876.699) [-876.561] (-876.900) * (-877.377) [-873.738] (-874.921) (-878.471) -- 0:01:02

      Average standard deviation of split frequencies: 0.026808

      60500 -- [-875.046] (-879.189) (-876.062) (-874.952) * (-875.830) (-874.672) (-875.318) [-876.714] -- 0:01:02
      61000 -- (-876.882) (-876.501) [-876.240] (-877.038) * [-874.608] (-876.396) (-876.027) (-879.136) -- 0:01:01
      61500 -- (-876.026) (-875.995) [-875.762] (-877.484) * (-873.993) (-875.540) (-876.939) [-876.484] -- 0:01:01
      62000 -- (-874.866) (-874.321) (-874.636) [-876.805] * (-875.711) [-877.681] (-875.218) (-878.892) -- 0:01:00
      62500 -- (-874.365) [-874.682] (-878.100) (-877.140) * [-877.329] (-875.775) (-875.514) (-878.535) -- 0:01:00
      63000 -- (-874.623) [-875.574] (-879.946) (-874.517) * (-882.863) [-874.584] (-875.016) (-877.000) -- 0:00:59
      63500 -- (-874.105) (-875.930) [-880.391] (-874.457) * [-875.933] (-874.645) (-875.148) (-877.102) -- 0:00:58
      64000 -- (-877.550) [-877.449] (-877.711) (-878.012) * [-877.269] (-874.455) (-875.311) (-877.336) -- 0:00:58
      64500 -- (-877.495) (-877.340) (-876.681) [-878.735] * [-876.619] (-874.100) (-876.624) (-877.762) -- 0:00:58
      65000 -- (-877.648) (-881.662) [-879.357] (-875.891) * (-875.307) (-876.367) [-875.907] (-876.164) -- 0:00:57

      Average standard deviation of split frequencies: 0.022448

      65500 -- (-874.497) (-876.423) (-882.700) [-877.314] * (-874.858) (-880.254) [-876.700] (-875.328) -- 0:00:57
      66000 -- (-874.479) (-876.668) (-882.512) [-874.928] * [-874.199] (-873.906) (-874.386) (-875.734) -- 0:00:56
      66500 -- (-874.197) (-875.931) (-874.827) [-878.184] * (-876.102) [-875.030] (-878.488) (-875.772) -- 0:00:56
      67000 -- [-873.975] (-875.930) (-878.962) (-876.040) * (-878.519) (-876.018) [-877.335] (-875.134) -- 0:00:55
      67500 -- (-875.478) (-874.535) [-875.451] (-874.986) * [-874.549] (-875.838) (-877.783) (-874.819) -- 0:00:55
      68000 -- (-876.671) (-875.622) [-876.053] (-875.091) * (-878.544) (-875.072) [-874.008] (-875.136) -- 0:00:54
      68500 -- (-876.576) (-876.749) [-874.477] (-875.345) * (-877.018) [-877.529] (-875.492) (-875.037) -- 0:00:54
      69000 -- (-877.513) [-877.896] (-875.293) (-875.953) * (-874.795) (-877.521) [-875.429] (-875.999) -- 0:00:53
      69500 -- (-875.791) (-877.809) (-876.098) [-873.885] * (-878.409) (-878.761) [-876.458] (-876.254) -- 0:00:53
      70000 -- [-877.377] (-876.309) (-885.371) (-879.344) * (-877.643) [-875.761] (-875.826) (-879.929) -- 0:00:53

      Average standard deviation of split frequencies: 0.021013

      70500 -- (-874.223) (-879.641) (-880.263) [-875.466] * (-875.689) (-878.940) [-875.139] (-875.963) -- 0:00:52
      71000 -- (-878.098) [-874.774] (-876.286) (-875.320) * (-875.172) [-875.046] (-874.065) (-876.188) -- 0:01:05
      71500 -- (-878.411) (-874.216) (-874.994) [-874.577] * (-877.333) (-874.800) (-878.899) [-878.536] -- 0:01:04
      72000 -- (-874.035) (-874.224) [-877.846] (-875.953) * (-875.123) [-874.267] (-876.951) (-879.051) -- 0:01:04
      72500 -- (-875.371) [-874.346] (-876.943) (-875.292) * [-875.360] (-874.892) (-878.019) (-874.422) -- 0:01:03
      73000 -- (-875.279) (-876.605) [-875.604] (-874.106) * (-876.419) (-877.323) (-878.209) [-874.020] -- 0:01:03
      73500 -- (-875.847) (-875.339) [-878.173] (-875.393) * (-878.145) (-876.986) (-877.392) [-873.342] -- 0:01:03
      74000 -- [-877.574] (-876.203) (-877.566) (-877.321) * [-875.962] (-874.039) (-880.294) (-877.221) -- 0:01:02
      74500 -- (-873.751) (-874.644) (-877.539) [-877.951] * (-876.118) (-874.496) [-878.820] (-878.487) -- 0:01:02
      75000 -- [-874.165] (-874.923) (-877.574) (-876.991) * (-873.982) (-877.126) (-876.328) [-878.509] -- 0:01:01

      Average standard deviation of split frequencies: 0.019261

      75500 -- (-874.356) (-876.148) (-875.113) [-875.649] * (-875.360) [-875.331] (-873.755) (-874.540) -- 0:01:01
      76000 -- (-874.387) (-879.471) (-874.493) [-874.478] * (-876.444) (-877.167) [-874.499] (-874.000) -- 0:01:00
      76500 -- [-875.292] (-877.765) (-874.044) (-873.836) * (-874.595) [-875.080] (-874.672) (-873.721) -- 0:01:00
      77000 -- [-875.945] (-876.326) (-876.564) (-875.102) * [-876.932] (-874.516) (-877.054) (-877.263) -- 0:00:59
      77500 -- (-878.039) (-874.482) (-877.676) [-875.803] * [-879.880] (-874.272) (-877.715) (-879.794) -- 0:00:59
      78000 -- (-876.761) (-877.189) [-874.722] (-877.274) * (-874.680) [-873.750] (-875.549) (-878.057) -- 0:00:59
      78500 -- (-875.004) (-878.649) (-876.296) [-873.414] * (-875.441) (-874.230) (-875.453) [-875.921] -- 0:00:58
      79000 -- (-874.491) [-876.149] (-880.184) (-874.488) * (-880.124) (-874.474) [-876.784] (-879.418) -- 0:00:58
      79500 -- (-874.878) [-874.736] (-877.299) (-874.020) * (-875.870) [-873.894] (-876.993) (-878.663) -- 0:00:57
      80000 -- (-874.766) [-875.721] (-879.185) (-875.169) * (-879.194) (-875.254) (-877.462) [-879.072] -- 0:00:57

      Average standard deviation of split frequencies: 0.020746

      80500 -- (-874.907) (-875.042) [-875.147] (-875.158) * (-873.807) (-874.288) [-875.152] (-877.639) -- 0:00:57
      81000 -- (-874.234) (-875.054) [-879.137] (-873.960) * (-880.906) [-873.916] (-876.452) (-879.220) -- 0:00:56
      81500 -- [-875.571] (-875.340) (-875.446) (-876.358) * (-877.142) (-874.247) (-877.806) [-877.886] -- 0:00:56
      82000 -- (-876.440) (-875.229) (-874.065) [-876.425] * (-876.001) [-875.868] (-878.704) (-876.915) -- 0:00:55
      82500 -- (-875.150) (-878.969) [-874.176] (-873.924) * [-873.849] (-876.469) (-874.146) (-876.628) -- 0:00:55
      83000 -- [-874.517] (-876.632) (-876.936) (-876.229) * (-875.564) [-875.033] (-875.053) (-880.791) -- 0:00:55
      83500 -- [-874.766] (-877.188) (-874.032) (-874.489) * (-876.737) (-875.931) [-875.099] (-875.765) -- 0:00:54
      84000 -- [-873.875] (-875.676) (-875.787) (-878.517) * (-878.639) [-874.279] (-876.367) (-874.065) -- 0:00:54
      84500 -- [-874.584] (-876.715) (-874.448) (-874.675) * (-878.056) (-875.153) [-875.592] (-874.545) -- 0:00:54
      85000 -- (-875.310) (-876.635) (-874.581) [-873.892] * (-878.465) (-874.690) (-876.561) [-873.893] -- 0:00:53

      Average standard deviation of split frequencies: 0.021926

      85500 -- (-875.206) (-875.536) (-876.309) [-876.451] * (-875.600) (-874.001) [-876.621] (-875.317) -- 0:00:53
      86000 -- (-876.632) (-876.329) (-876.958) [-877.124] * (-875.280) (-875.916) [-875.522] (-874.774) -- 0:00:53
      86500 -- (-877.247) [-876.502] (-875.396) (-874.428) * (-878.242) (-876.792) [-876.236] (-875.365) -- 0:00:52
      87000 -- (-880.902) (-877.732) [-876.398] (-876.605) * (-878.498) [-877.490] (-874.982) (-876.142) -- 0:01:02
      87500 -- [-874.897] (-875.237) (-874.650) (-874.961) * (-875.797) (-875.027) (-874.532) [-878.360] -- 0:01:02
      88000 -- (-875.933) (-875.874) (-874.649) [-875.805] * [-877.152] (-875.513) (-876.564) (-876.814) -- 0:01:02
      88500 -- [-876.551] (-875.595) (-877.102) (-875.114) * (-876.164) [-874.771] (-876.224) (-875.171) -- 0:01:01
      89000 -- (-875.303) (-876.064) [-875.480] (-875.821) * (-876.026) [-876.327] (-878.128) (-876.037) -- 0:01:01
      89500 -- (-875.943) (-875.771) (-875.125) [-876.960] * (-874.877) (-877.150) [-874.817] (-875.558) -- 0:01:01
      90000 -- (-874.119) (-874.603) (-875.769) [-876.355] * (-879.207) [-877.624] (-875.284) (-873.947) -- 0:01:00

      Average standard deviation of split frequencies: 0.021292

      90500 -- (-874.647) (-875.322) (-875.365) [-875.095] * (-874.427) (-874.247) [-876.058] (-874.217) -- 0:01:00
      91000 -- (-875.754) (-875.301) [-875.398] (-876.427) * (-876.765) (-875.499) (-877.231) [-875.172] -- 0:00:59
      91500 -- (-875.155) (-873.950) [-878.955] (-876.394) * (-876.245) (-874.380) [-878.488] (-876.068) -- 0:00:59
      92000 -- (-878.598) (-874.044) (-876.608) [-875.843] * (-875.745) (-875.265) (-877.419) [-874.342] -- 0:00:59
      92500 -- (-876.643) (-874.393) (-875.364) [-876.915] * (-877.058) (-876.027) (-876.906) [-875.325] -- 0:00:58
      93000 -- (-874.724) [-875.358] (-874.578) (-881.805) * (-874.226) [-876.607] (-876.549) (-876.452) -- 0:00:58
      93500 -- (-876.853) [-875.025] (-875.357) (-878.045) * [-874.957] (-874.956) (-876.240) (-877.524) -- 0:00:58
      94000 -- (-874.863) (-876.625) (-876.174) [-876.506] * (-877.635) (-877.089) [-874.203] (-875.098) -- 0:00:57
      94500 -- (-876.845) [-874.638] (-877.168) (-882.014) * [-874.175] (-876.717) (-873.924) (-874.579) -- 0:00:57
      95000 -- (-879.266) [-874.959] (-875.601) (-878.254) * (-874.797) [-875.445] (-874.287) (-879.821) -- 0:00:57

      Average standard deviation of split frequencies: 0.019887

      95500 -- (-877.225) [-874.419] (-876.829) (-879.480) * (-876.334) (-875.098) [-874.879] (-879.460) -- 0:00:56
      96000 -- (-874.598) (-874.451) (-875.986) [-878.198] * [-875.521] (-875.526) (-874.702) (-875.986) -- 0:00:56
      96500 -- (-882.128) (-874.389) [-875.897] (-874.291) * (-874.186) (-875.760) [-875.092] (-875.916) -- 0:00:56
      97000 -- (-876.179) (-877.361) [-878.658] (-873.688) * (-877.458) [-878.208] (-879.234) (-878.314) -- 0:00:55
      97500 -- (-875.638) (-875.311) [-876.400] (-874.194) * (-873.593) (-875.665) (-878.912) [-874.153] -- 0:00:55
      98000 -- (-875.866) (-875.633) (-874.545) [-874.665] * (-875.103) (-877.200) [-875.414] (-874.698) -- 0:00:55
      98500 -- (-878.323) [-874.367] (-873.877) (-875.870) * [-878.768] (-881.170) (-874.553) (-877.360) -- 0:00:54
      99000 -- (-875.638) (-875.104) (-873.623) [-875.587] * (-875.907) [-879.757] (-877.919) (-874.105) -- 0:00:54
      99500 -- [-875.276] (-881.051) (-874.501) (-877.511) * (-877.640) [-873.337] (-874.956) (-875.508) -- 0:00:54
      100000 -- (-875.153) (-876.642) [-875.334] (-877.530) * (-875.505) (-874.855) (-875.185) [-874.785] -- 0:00:54

      Average standard deviation of split frequencies: 0.019902

      100500 -- (-875.779) [-878.573] (-874.245) (-873.593) * (-876.273) (-879.066) (-876.283) [-873.787] -- 0:00:53
      101000 -- [-875.560] (-876.310) (-875.224) (-874.977) * (-875.355) [-882.315] (-876.646) (-875.557) -- 0:00:53
      101500 -- (-875.049) (-883.950) [-876.087] (-881.952) * [-876.936] (-873.877) (-875.014) (-875.369) -- 0:00:53
      102000 -- [-878.103] (-882.028) (-878.277) (-877.147) * (-880.099) (-878.240) [-876.488] (-879.171) -- 0:00:52
      102500 -- (-875.181) (-879.098) (-879.080) [-876.834] * (-875.341) [-878.881] (-874.688) (-874.745) -- 0:00:52
      103000 -- (-877.019) [-874.950] (-873.753) (-877.402) * [-876.335] (-874.914) (-874.912) (-875.390) -- 0:00:52
      103500 -- [-875.451] (-876.724) (-876.909) (-876.844) * (-876.770) (-874.638) [-875.021] (-879.550) -- 0:01:00
      104000 -- (-874.669) (-877.580) [-877.142] (-874.810) * (-877.553) (-877.019) [-875.515] (-875.415) -- 0:01:00
      104500 -- [-875.366] (-874.889) (-877.453) (-874.767) * (-875.438) (-877.750) [-874.517] (-876.547) -- 0:00:59
      105000 -- (-877.152) [-878.142] (-874.614) (-876.885) * (-877.017) (-876.204) [-875.820] (-877.291) -- 0:00:59

      Average standard deviation of split frequencies: 0.018424

      105500 -- (-875.796) (-878.960) (-876.797) [-876.596] * (-877.440) (-879.223) [-875.435] (-874.896) -- 0:00:59
      106000 -- (-876.281) (-876.004) (-876.516) [-876.870] * [-876.564] (-879.123) (-874.523) (-874.698) -- 0:00:59
      106500 -- (-876.744) (-875.465) [-878.802] (-875.463) * [-879.130] (-875.637) (-875.016) (-880.896) -- 0:00:58
      107000 -- [-873.888] (-875.120) (-877.688) (-876.444) * (-885.784) (-878.165) (-876.216) [-875.197] -- 0:00:58
      107500 -- [-874.008] (-874.575) (-878.338) (-876.557) * (-876.728) [-877.683] (-878.425) (-876.052) -- 0:00:58
      108000 -- (-875.229) [-875.391] (-877.241) (-879.830) * (-875.256) (-874.502) [-876.213] (-876.377) -- 0:00:57
      108500 -- (-880.479) [-877.383] (-877.762) (-877.942) * (-876.218) (-876.482) (-875.361) [-879.833] -- 0:00:57
      109000 -- [-876.786] (-877.142) (-877.280) (-879.169) * [-874.013] (-876.862) (-875.409) (-874.338) -- 0:00:57
      109500 -- (-878.071) [-876.860] (-879.066) (-876.530) * (-878.799) [-877.175] (-875.231) (-875.716) -- 0:00:56
      110000 -- (-878.561) (-875.101) [-876.733] (-874.832) * (-877.178) (-877.434) (-874.881) [-874.697] -- 0:00:56

      Average standard deviation of split frequencies: 0.020177

      110500 -- (-875.210) (-875.559) [-875.929] (-875.081) * [-874.437] (-874.704) (-874.895) (-875.749) -- 0:00:56
      111000 -- (-878.421) (-874.813) [-874.872] (-875.454) * (-875.596) (-875.850) [-876.733] (-874.235) -- 0:00:56
      111500 -- (-877.420) (-876.298) (-873.748) [-875.265] * (-878.086) (-875.347) [-876.255] (-874.109) -- 0:00:55
      112000 -- (-877.099) [-876.177] (-874.338) (-875.568) * (-880.086) (-878.394) (-874.787) [-875.394] -- 0:00:55
      112500 -- (-876.194) (-878.128) (-874.333) [-878.867] * (-876.702) [-876.633] (-876.050) (-875.825) -- 0:00:55
      113000 -- (-875.631) (-878.975) (-877.486) [-877.327] * (-876.253) (-877.017) (-875.877) [-875.438] -- 0:00:54
      113500 -- (-876.301) (-876.920) [-874.456] (-877.024) * (-876.483) [-874.778] (-877.228) (-877.018) -- 0:00:54
      114000 -- (-877.550) (-874.307) [-874.042] (-873.713) * (-874.557) (-875.791) (-874.102) [-877.290] -- 0:00:54
      114500 -- [-874.939] (-874.379) (-874.899) (-875.445) * (-874.847) [-877.133] (-874.236) (-876.368) -- 0:00:54
      115000 -- (-874.668) (-874.429) (-873.742) [-874.771] * (-875.811) (-878.020) (-874.896) [-877.714] -- 0:00:53

      Average standard deviation of split frequencies: 0.021175

      115500 -- (-878.125) (-875.406) [-874.701] (-874.038) * [-874.909] (-875.142) (-877.031) (-877.332) -- 0:00:53
      116000 -- (-876.936) (-878.599) (-874.043) [-873.821] * [-876.544] (-875.421) (-876.146) (-876.762) -- 0:00:53
      116500 -- (-875.449) [-876.393] (-873.776) (-876.014) * (-876.535) (-876.098) (-876.071) [-880.207] -- 0:00:53
      117000 -- [-874.559] (-875.638) (-874.536) (-874.120) * (-875.482) [-875.472] (-876.403) (-878.573) -- 0:00:52
      117500 -- (-875.079) (-876.705) [-874.744] (-873.726) * (-878.506) (-875.415) [-879.750] (-877.844) -- 0:00:52
      118000 -- (-875.009) [-876.680] (-874.148) (-876.001) * (-878.998) [-874.087] (-874.922) (-875.167) -- 0:00:52
      118500 -- [-878.486] (-876.500) (-878.913) (-876.767) * (-876.498) [-874.508] (-875.641) (-875.208) -- 0:00:52
      119000 -- (-877.430) [-874.300] (-876.854) (-875.461) * (-874.385) [-875.710] (-874.832) (-877.390) -- 0:00:51
      119500 -- (-876.691) (-876.287) (-876.042) [-874.027] * (-878.579) (-873.766) (-874.465) [-874.533] -- 0:00:51
      120000 -- (-875.032) [-874.940] (-878.790) (-874.942) * (-879.047) (-873.740) [-875.095] (-875.102) -- 0:00:51

      Average standard deviation of split frequencies: 0.017775

      120500 -- (-878.115) (-876.601) (-879.553) [-874.156] * (-878.218) (-880.785) (-875.676) [-875.443] -- 0:00:58
      121000 -- [-873.436] (-876.952) (-876.351) (-875.522) * (-874.195) (-874.325) (-874.886) [-873.673] -- 0:00:58
      121500 -- (-874.312) [-879.710] (-876.690) (-875.759) * (-875.497) (-877.201) [-874.096] (-873.532) -- 0:00:57
      122000 -- (-874.639) [-877.094] (-875.835) (-875.897) * [-876.417] (-875.715) (-874.325) (-878.915) -- 0:00:57
      122500 -- [-877.898] (-874.764) (-877.017) (-875.211) * [-875.057] (-875.809) (-874.207) (-875.603) -- 0:00:57
      123000 -- (-875.925) [-875.037] (-876.038) (-879.251) * (-875.685) [-878.784] (-875.658) (-874.227) -- 0:00:57
      123500 -- (-874.272) [-875.296] (-874.487) (-878.994) * (-874.682) [-876.721] (-875.210) (-873.843) -- 0:00:56
      124000 -- (-874.544) (-874.913) (-874.446) [-875.247] * (-875.070) [-873.923] (-875.139) (-873.758) -- 0:00:56
      124500 -- (-874.519) [-874.368] (-875.039) (-876.049) * (-874.969) (-876.689) (-874.691) [-875.739] -- 0:00:56
      125000 -- (-874.573) (-875.682) [-879.773] (-875.614) * (-876.134) (-875.960) (-874.642) [-876.127] -- 0:00:56

      Average standard deviation of split frequencies: 0.017281

      125500 -- (-874.561) (-879.366) (-874.650) [-874.809] * (-876.341) (-877.394) (-875.794) [-876.207] -- 0:00:55
      126000 -- [-875.417] (-877.532) (-880.823) (-875.455) * (-875.031) (-876.224) (-875.593) [-874.598] -- 0:00:55
      126500 -- [-873.934] (-875.842) (-874.864) (-876.632) * (-876.351) (-874.798) (-875.622) [-874.328] -- 0:00:55
      127000 -- (-873.547) (-876.090) [-873.910] (-877.003) * (-876.760) (-875.981) (-875.913) [-879.938] -- 0:00:54
      127500 -- [-873.654] (-878.784) (-874.273) (-878.199) * (-874.262) (-883.261) (-874.982) [-875.949] -- 0:00:54
      128000 -- [-876.737] (-880.473) (-873.613) (-878.788) * (-876.877) (-878.615) (-876.044) [-877.048] -- 0:00:54
      128500 -- (-875.087) (-880.813) [-875.888] (-877.688) * [-875.342] (-875.241) (-877.376) (-878.389) -- 0:00:54
      129000 -- (-879.842) (-876.661) [-879.073] (-879.030) * (-877.183) (-876.076) (-879.263) [-878.785] -- 0:00:54
      129500 -- (-878.506) [-878.656] (-874.981) (-877.766) * (-879.479) (-874.547) (-875.432) [-878.420] -- 0:00:53
      130000 -- (-881.463) [-876.425] (-882.134) (-881.423) * [-876.279] (-880.816) (-874.324) (-878.268) -- 0:00:53

      Average standard deviation of split frequencies: 0.016727

      130500 -- [-876.741] (-875.730) (-877.173) (-874.399) * (-875.446) (-879.051) (-875.559) [-877.554] -- 0:00:53
      131000 -- (-879.386) (-879.257) [-876.285] (-877.935) * (-878.288) (-880.041) [-877.313] (-874.091) -- 0:00:53
      131500 -- (-874.825) (-874.152) (-877.056) [-874.520] * [-875.069] (-874.812) (-877.802) (-876.742) -- 0:00:52
      132000 -- (-875.995) (-877.470) (-874.865) [-876.067] * (-874.392) [-876.619] (-877.061) (-876.145) -- 0:00:52
      132500 -- [-878.002] (-877.746) (-879.582) (-875.388) * (-874.969) [-878.231] (-875.908) (-877.636) -- 0:00:52
      133000 -- (-881.534) (-875.662) (-881.999) [-877.021] * (-880.001) (-880.529) (-875.478) [-876.042] -- 0:00:52
      133500 -- (-875.124) (-874.231) [-874.569] (-877.181) * (-879.540) [-876.022] (-876.072) (-874.421) -- 0:00:51
      134000 -- (-873.872) [-876.217] (-874.715) (-877.406) * [-875.919] (-874.799) (-878.071) (-876.254) -- 0:00:51
      134500 -- (-873.980) (-876.258) (-876.529) [-875.764] * [-876.430] (-874.798) (-875.353) (-876.719) -- 0:00:51
      135000 -- (-873.764) [-875.601] (-877.853) (-874.754) * (-878.965) (-875.522) (-878.236) [-873.865] -- 0:00:51

      Average standard deviation of split frequencies: 0.014777

      135500 -- (-876.933) (-875.543) [-874.539] (-874.581) * (-879.927) (-874.340) [-874.749] (-874.009) -- 0:00:51
      136000 -- (-881.097) (-877.819) [-877.917] (-877.245) * (-876.451) [-875.447] (-875.678) (-874.338) -- 0:00:50
      136500 -- (-877.782) (-876.508) [-874.773] (-875.561) * [-875.004] (-877.053) (-875.628) (-876.942) -- 0:00:50
      137000 -- (-875.567) [-874.341] (-874.215) (-874.126) * (-877.035) (-875.058) [-875.721] (-873.600) -- 0:00:50
      137500 -- (-873.829) (-878.366) (-876.534) [-875.293] * (-875.436) [-873.678] (-877.558) (-874.009) -- 0:00:56
      138000 -- (-874.944) (-875.621) (-878.338) [-874.234] * [-875.196] (-873.678) (-874.309) (-873.829) -- 0:00:56
      138500 -- (-874.770) (-877.972) (-877.310) [-875.593] * (-874.650) (-879.880) [-875.149] (-875.009) -- 0:00:55
      139000 -- (-874.331) (-876.965) [-876.117] (-874.106) * [-874.782] (-875.934) (-874.896) (-877.013) -- 0:00:55
      139500 -- (-874.278) (-877.610) [-876.411] (-873.559) * (-874.302) [-874.157] (-875.585) (-874.934) -- 0:00:55
      140000 -- (-873.581) [-876.328] (-874.269) (-880.581) * (-874.183) (-875.781) [-873.957] (-875.081) -- 0:00:55

      Average standard deviation of split frequencies: 0.015874

      140500 -- [-873.661] (-877.200) (-877.379) (-876.433) * (-874.255) [-875.691] (-876.015) (-876.752) -- 0:00:55
      141000 -- (-881.070) [-874.582] (-874.473) (-875.309) * [-874.358] (-877.260) (-876.058) (-877.130) -- 0:00:54
      141500 -- (-876.008) (-875.275) (-876.040) [-874.237] * (-876.422) (-877.407) (-876.218) [-876.346] -- 0:00:54
      142000 -- (-877.567) (-877.612) (-877.214) [-874.970] * (-878.449) [-875.517] (-875.304) (-877.705) -- 0:00:54
      142500 -- (-875.489) (-878.677) (-877.338) [-876.342] * (-876.379) [-875.083] (-874.698) (-877.132) -- 0:00:54
      143000 -- (-875.196) (-874.105) (-879.206) [-874.588] * [-874.782] (-874.895) (-875.255) (-876.213) -- 0:00:53
      143500 -- [-875.872] (-874.394) (-874.065) (-879.180) * (-875.208) [-875.767] (-876.315) (-876.440) -- 0:00:53
      144000 -- (-877.463) (-873.580) (-875.444) [-875.821] * (-875.865) [-878.119] (-876.116) (-882.457) -- 0:00:53
      144500 -- [-877.284] (-878.823) (-875.657) (-873.499) * [-874.149] (-877.779) (-878.092) (-874.430) -- 0:00:53
      145000 -- (-876.789) (-875.348) [-876.048] (-876.861) * (-874.979) (-876.512) (-874.418) [-873.968] -- 0:00:53

      Average standard deviation of split frequencies: 0.014954

      145500 -- (-878.673) (-874.598) (-875.779) [-877.440] * (-875.713) [-873.944] (-875.992) (-874.066) -- 0:00:52
      146000 -- (-876.482) [-874.531] (-876.283) (-876.050) * (-874.892) (-874.498) (-875.949) [-874.384] -- 0:00:52
      146500 -- [-878.096] (-874.324) (-876.372) (-876.718) * [-875.414] (-874.825) (-876.411) (-877.047) -- 0:00:52
      147000 -- (-881.797) (-874.935) [-878.881] (-876.086) * [-875.759] (-878.139) (-874.518) (-876.124) -- 0:00:52
      147500 -- (-873.795) (-875.277) [-876.394] (-875.176) * (-877.936) (-875.873) [-875.671] (-879.602) -- 0:00:52
      148000 -- (-876.510) [-874.803] (-876.451) (-876.159) * (-876.514) (-874.563) [-875.931] (-880.445) -- 0:00:51
      148500 -- [-874.902] (-874.456) (-876.558) (-875.937) * (-873.918) (-875.022) (-874.870) [-881.719] -- 0:00:51
      149000 -- (-878.444) (-877.168) [-879.185] (-875.887) * (-875.456) (-877.075) [-875.081] (-875.340) -- 0:00:51
      149500 -- (-877.307) [-879.753] (-874.913) (-875.061) * (-874.017) (-884.102) (-875.081) [-875.459] -- 0:00:51
      150000 -- (-876.165) (-877.083) [-876.796] (-874.428) * (-876.344) (-876.924) (-876.020) [-875.386] -- 0:00:51

      Average standard deviation of split frequencies: 0.014862

      150500 -- (-877.181) (-877.150) [-875.705] (-876.435) * (-873.777) (-878.543) [-880.130] (-875.487) -- 0:00:50
      151000 -- (-876.290) (-874.485) [-876.656] (-874.373) * [-874.162] (-878.040) (-875.766) (-875.167) -- 0:00:50
      151500 -- (-877.543) [-876.581] (-876.665) (-876.003) * (-876.657) (-876.000) [-875.898] (-876.168) -- 0:00:50
      152000 -- (-876.108) (-876.391) [-879.641] (-874.519) * (-874.696) (-874.200) [-876.806] (-877.629) -- 0:00:50
      152500 -- (-875.856) (-877.324) (-884.563) [-874.350] * [-875.787] (-874.924) (-873.714) (-874.472) -- 0:00:50
      153000 -- (-876.640) (-873.798) [-875.219] (-876.520) * (-875.876) (-878.442) [-874.111] (-874.179) -- 0:00:49
      153500 -- (-875.730) [-875.433] (-875.557) (-873.988) * [-876.048] (-878.003) (-875.853) (-875.158) -- 0:00:49
      154000 -- (-876.982) [-874.714] (-882.899) (-875.860) * (-874.662) (-877.181) [-875.858] (-876.309) -- 0:00:54
      154500 -- [-874.480] (-874.799) (-878.948) (-874.393) * [-874.057] (-875.875) (-875.714) (-877.037) -- 0:00:54
      155000 -- (-875.475) (-873.787) [-876.810] (-873.653) * (-874.103) (-877.982) (-875.617) [-877.276] -- 0:00:54

      Average standard deviation of split frequencies: 0.014773

      155500 -- (-877.632) [-874.806] (-878.223) (-878.238) * [-879.171] (-875.099) (-879.562) (-874.245) -- 0:00:54
      156000 -- (-875.425) (-874.612) (-874.741) [-877.737] * (-877.698) (-877.851) [-875.293] (-874.510) -- 0:00:54
      156500 -- [-880.472] (-874.950) (-876.358) (-874.241) * (-878.502) (-879.900) (-877.026) [-875.147] -- 0:00:53
      157000 -- (-877.749) [-877.134] (-875.920) (-882.885) * [-880.113] (-878.633) (-876.215) (-878.466) -- 0:00:53
      157500 -- (-876.388) (-876.081) [-878.565] (-876.459) * (-879.058) (-876.979) [-874.771] (-878.842) -- 0:00:53
      158000 -- (-875.704) (-874.690) (-874.474) [-874.630] * (-875.828) (-877.587) [-877.668] (-875.206) -- 0:00:53
      158500 -- (-877.088) (-875.372) [-875.225] (-876.489) * (-878.761) (-878.452) (-877.831) [-879.930] -- 0:00:53
      159000 -- (-875.580) (-876.901) [-875.586] (-874.382) * (-876.413) (-883.849) [-880.717] (-874.072) -- 0:00:52
      159500 -- (-875.102) [-881.073] (-877.696) (-873.977) * [-876.257] (-879.548) (-875.539) (-875.317) -- 0:00:52
      160000 -- (-877.544) (-875.925) [-877.100] (-874.557) * (-879.182) (-877.025) [-874.371] (-875.361) -- 0:00:52

      Average standard deviation of split frequencies: 0.013744

      160500 -- (-875.082) (-876.564) [-877.494] (-875.363) * [-877.238] (-875.273) (-874.020) (-875.110) -- 0:00:52
      161000 -- (-876.233) [-877.403] (-873.815) (-876.860) * (-874.541) (-874.904) [-873.818] (-873.653) -- 0:00:52
      161500 -- (-874.364) (-873.811) [-876.322] (-875.829) * (-874.612) (-878.242) (-873.998) [-876.469] -- 0:00:51
      162000 -- (-874.848) (-875.887) (-876.746) [-874.179] * (-874.211) [-877.714] (-874.074) (-874.839) -- 0:00:51
      162500 -- (-874.457) (-877.026) (-876.312) [-874.667] * (-875.901) (-876.289) [-874.859] (-876.124) -- 0:00:51
      163000 -- (-873.843) (-876.177) (-876.764) [-873.520] * [-874.747] (-876.456) (-876.158) (-873.867) -- 0:00:51
      163500 -- (-873.843) [-873.904] (-876.333) (-873.959) * [-874.436] (-876.580) (-875.884) (-874.862) -- 0:00:51
      164000 -- (-875.715) (-873.760) [-879.227] (-873.766) * [-875.969] (-876.143) (-874.269) (-874.108) -- 0:00:50
      164500 -- (-875.694) (-875.488) [-879.081] (-877.342) * (-878.770) (-881.263) [-873.632] (-873.539) -- 0:00:50
      165000 -- (-877.083) [-874.192] (-877.884) (-875.930) * (-875.896) (-882.564) [-873.710] (-875.400) -- 0:00:50

      Average standard deviation of split frequencies: 0.013410

      165500 -- [-875.937] (-874.622) (-874.385) (-877.900) * (-876.111) [-877.409] (-876.349) (-883.697) -- 0:00:50
      166000 -- (-874.626) (-879.504) (-874.636) [-876.809] * (-878.101) [-874.824] (-874.508) (-877.682) -- 0:00:50
      166500 -- (-873.873) (-882.876) [-874.363] (-875.883) * (-875.773) (-882.202) (-875.835) [-875.940] -- 0:00:50
      167000 -- (-876.663) (-875.199) (-874.324) [-876.120] * (-875.824) [-876.620] (-875.791) (-874.851) -- 0:00:49
      167500 -- (-874.597) (-878.638) (-875.116) [-875.357] * (-874.014) [-875.464] (-874.426) (-876.312) -- 0:00:49
      168000 -- (-877.778) (-875.357) [-876.480] (-875.263) * (-881.056) [-879.419] (-874.809) (-874.887) -- 0:00:49
      168500 -- [-876.867] (-874.638) (-876.735) (-873.887) * (-878.635) (-874.325) [-875.058] (-876.601) -- 0:00:49
      169000 -- (-878.939) [-875.448] (-876.093) (-873.893) * (-874.628) (-880.552) [-875.315] (-875.740) -- 0:00:49
      169500 -- (-876.534) (-877.889) (-876.407) [-874.428] * (-879.187) (-879.902) [-875.074] (-877.070) -- 0:00:48
      170000 -- (-877.247) (-875.501) (-878.373) [-877.125] * (-877.006) (-877.828) [-875.187] (-874.899) -- 0:00:48

      Average standard deviation of split frequencies: 0.012502

      170500 -- [-874.551] (-881.825) (-874.651) (-877.498) * (-876.930) [-877.742] (-873.477) (-876.608) -- 0:00:53
      171000 -- (-876.293) (-875.129) (-874.864) [-875.396] * (-876.310) (-875.688) (-874.412) [-874.741] -- 0:00:53
      171500 -- (-874.929) (-875.251) (-874.238) [-876.127] * (-874.572) (-874.612) (-875.920) [-875.090] -- 0:00:53
      172000 -- (-875.730) [-877.133] (-876.689) (-875.815) * (-877.461) (-875.413) (-877.971) [-875.939] -- 0:00:52
      172500 -- [-876.258] (-875.616) (-876.594) (-877.570) * [-881.413] (-875.049) (-879.783) (-875.706) -- 0:00:52
      173000 -- (-878.458) [-875.290] (-877.686) (-875.840) * (-880.309) (-876.018) [-876.211] (-876.462) -- 0:00:52
      173500 -- (-875.812) (-876.097) (-876.809) [-874.769] * (-882.650) [-874.155] (-875.253) (-879.129) -- 0:00:52
      174000 -- (-875.735) (-874.989) [-877.065] (-880.064) * (-876.771) (-874.313) (-878.175) [-876.914] -- 0:00:52
      174500 -- (-873.948) (-875.019) [-874.498] (-875.063) * (-876.356) [-875.834] (-877.220) (-876.783) -- 0:00:52
      175000 -- [-874.166] (-874.930) (-875.571) (-875.727) * (-878.171) [-875.863] (-878.292) (-874.590) -- 0:00:51

      Average standard deviation of split frequencies: 0.011278

      175500 -- (-873.990) (-874.885) (-874.376) [-875.125] * (-878.499) (-874.329) [-876.566] (-882.207) -- 0:00:51
      176000 -- (-874.225) (-874.366) [-874.161] (-875.572) * [-875.463] (-874.390) (-874.895) (-879.826) -- 0:00:51
      176500 -- (-874.566) (-878.271) [-875.232] (-876.123) * (-876.429) (-875.359) [-876.068] (-876.715) -- 0:00:51
      177000 -- (-874.217) (-877.901) (-878.994) [-876.004] * [-874.931] (-875.432) (-877.322) (-876.554) -- 0:00:51
      177500 -- (-876.291) (-876.467) [-874.880] (-877.319) * (-876.736) [-874.280] (-873.385) (-874.353) -- 0:00:50
      178000 -- (-873.963) [-874.787] (-874.563) (-876.593) * (-874.356) (-874.400) [-874.073] (-875.752) -- 0:00:50
      178500 -- (-877.704) [-874.375] (-877.383) (-877.001) * (-874.388) (-875.671) [-876.550] (-876.613) -- 0:00:50
      179000 -- [-874.868] (-876.476) (-874.690) (-877.321) * (-876.236) (-875.214) [-875.296] (-877.303) -- 0:00:50
      179500 -- [-874.690] (-877.598) (-873.794) (-875.037) * (-875.343) (-876.125) [-874.067] (-879.165) -- 0:00:50
      180000 -- [-876.129] (-876.811) (-876.141) (-875.683) * (-875.563) (-877.816) (-874.575) [-877.917] -- 0:00:50

      Average standard deviation of split frequencies: 0.011887

      180500 -- (-873.800) [-875.091] (-878.511) (-875.237) * (-876.374) [-876.563] (-875.580) (-873.842) -- 0:00:49
      181000 -- (-874.966) (-877.036) (-875.070) [-876.987] * [-877.786] (-874.690) (-875.245) (-875.379) -- 0:00:49
      181500 -- [-876.239] (-874.754) (-874.247) (-878.223) * [-875.459] (-874.954) (-873.688) (-874.043) -- 0:00:49
      182000 -- [-876.294] (-875.417) (-874.776) (-874.254) * (-874.581) (-877.907) [-874.630] (-874.101) -- 0:00:49
      182500 -- [-875.089] (-878.508) (-875.131) (-874.552) * [-875.358] (-874.517) (-875.413) (-874.857) -- 0:00:49
      183000 -- (-876.729) (-875.025) [-874.712] (-873.810) * (-873.572) (-876.448) [-873.933] (-874.416) -- 0:00:49
      183500 -- [-875.932] (-875.736) (-875.280) (-874.784) * (-874.735) (-875.239) (-875.926) [-876.058] -- 0:00:48
      184000 -- [-874.448] (-873.702) (-879.913) (-876.498) * (-875.996) (-875.678) [-875.181] (-875.356) -- 0:00:48
      184500 -- [-874.576] (-876.585) (-876.457) (-874.147) * (-875.083) [-875.218] (-875.808) (-875.616) -- 0:00:48
      185000 -- (-875.071) (-874.263) (-878.637) [-876.353] * (-877.139) (-873.476) (-876.089) [-874.873] -- 0:00:48

      Average standard deviation of split frequencies: 0.011968

      185500 -- (-874.805) (-874.578) [-874.817] (-880.017) * (-878.399) (-874.238) (-875.487) [-874.921] -- 0:00:48
      186000 -- (-876.234) [-875.482] (-877.218) (-875.607) * [-880.222] (-874.238) (-878.668) (-875.876) -- 0:00:48
      186500 -- (-879.755) [-876.956] (-880.915) (-874.515) * (-881.868) [-873.949] (-876.814) (-874.476) -- 0:00:47
      187000 -- [-876.730] (-876.167) (-879.668) (-874.562) * (-876.641) [-873.620] (-876.193) (-874.617) -- 0:00:52
      187500 -- (-878.453) [-874.592] (-878.151) (-878.454) * (-877.912) (-874.806) [-876.741] (-873.941) -- 0:00:52
      188000 -- [-876.706] (-875.012) (-878.939) (-878.054) * (-874.700) (-877.033) (-876.362) [-873.638] -- 0:00:51
      188500 -- [-876.147] (-873.966) (-875.845) (-877.859) * (-874.712) (-876.434) (-875.534) [-873.824] -- 0:00:51
      189000 -- [-875.043] (-873.543) (-880.161) (-877.207) * (-877.504) (-877.521) (-875.614) [-876.545] -- 0:00:51
      189500 -- (-875.264) (-873.817) [-875.411] (-879.301) * [-877.258] (-877.563) (-874.373) (-876.336) -- 0:00:51
      190000 -- (-874.663) (-876.027) [-875.499] (-880.911) * (-876.228) [-876.668] (-874.254) (-875.195) -- 0:00:51

      Average standard deviation of split frequencies: 0.010800

      190500 -- (-875.482) (-874.946) [-877.068] (-879.166) * (-879.229) (-878.905) [-873.857] (-875.908) -- 0:00:50
      191000 -- (-876.388) (-875.192) [-874.518] (-874.084) * (-877.410) (-882.265) [-873.429] (-875.439) -- 0:00:50
      191500 -- (-876.693) (-875.773) [-874.399] (-874.084) * [-879.818] (-877.964) (-876.845) (-876.041) -- 0:00:50
      192000 -- (-874.902) [-873.732] (-875.223) (-874.689) * (-875.636) (-875.741) [-875.202] (-875.383) -- 0:00:50
      192500 -- (-874.334) (-874.337) (-876.928) [-875.253] * (-875.394) (-874.056) (-874.526) [-875.319] -- 0:00:50
      193000 -- (-875.946) (-875.146) (-877.350) [-875.937] * [-875.725] (-874.699) (-876.233) (-875.137) -- 0:00:50
      193500 -- (-878.096) [-874.583] (-877.059) (-878.567) * (-878.308) [-876.854] (-877.004) (-876.363) -- 0:00:50
      194000 -- (-875.442) (-873.426) (-877.090) [-877.054] * (-874.689) (-877.199) [-874.479] (-876.966) -- 0:00:49
      194500 -- [-875.563] (-874.499) (-877.182) (-878.750) * (-874.939) (-873.808) [-877.178] (-874.586) -- 0:00:49
      195000 -- [-875.390] (-880.497) (-876.908) (-877.216) * (-874.882) (-873.606) (-876.551) [-877.553] -- 0:00:49

      Average standard deviation of split frequencies: 0.010253

      195500 -- (-874.444) (-877.123) (-877.796) [-874.327] * (-874.176) (-873.843) [-874.466] (-874.096) -- 0:00:49
      196000 -- (-876.954) (-879.656) [-874.052] (-875.287) * (-877.803) (-873.570) [-876.370] (-876.178) -- 0:00:49
      196500 -- [-876.148] (-875.332) (-876.462) (-876.065) * [-875.114] (-874.030) (-873.951) (-875.245) -- 0:00:49
      197000 -- (-873.821) (-876.277) (-882.528) [-876.794] * (-875.559) [-874.835] (-874.969) (-879.586) -- 0:00:48
      197500 -- (-874.839) (-874.951) (-881.592) [-875.235] * [-877.164] (-879.060) (-878.227) (-879.360) -- 0:00:48
      198000 -- (-877.956) [-875.505] (-881.239) (-876.612) * [-877.628] (-874.573) (-875.489) (-873.788) -- 0:00:48
      198500 -- [-873.845] (-877.162) (-877.199) (-879.622) * (-881.101) (-873.997) [-879.141] (-874.511) -- 0:00:48
      199000 -- (-875.423) (-874.975) (-877.355) [-882.664] * (-877.961) [-874.527] (-876.952) (-877.703) -- 0:00:48
      199500 -- [-876.272] (-874.488) (-875.369) (-874.380) * [-876.789] (-875.206) (-874.155) (-877.181) -- 0:00:48
      200000 -- (-878.185) (-879.628) (-877.710) [-876.658] * (-876.332) (-874.494) [-874.915] (-876.179) -- 0:00:48

      Average standard deviation of split frequencies: 0.011128

      200500 -- (-878.734) (-877.349) (-879.258) [-877.315] * (-874.136) [-875.470] (-879.438) (-873.999) -- 0:00:47
      201000 -- [-877.519] (-875.723) (-885.783) (-874.307) * (-875.434) (-875.594) (-876.477) [-875.522] -- 0:00:47
      201500 -- [-878.310] (-877.357) (-876.472) (-876.326) * [-874.072] (-877.463) (-877.329) (-873.690) -- 0:00:47
      202000 -- (-875.033) (-873.889) [-876.145] (-875.556) * (-875.277) [-875.789] (-874.999) (-873.916) -- 0:00:47
      202500 -- [-876.823] (-873.755) (-878.384) (-877.483) * (-877.161) (-878.260) [-874.365] (-874.176) -- 0:00:47
      203000 -- (-876.361) (-879.734) [-876.767] (-875.750) * [-876.609] (-880.704) (-875.586) (-879.012) -- 0:00:47
      203500 -- (-875.710) [-874.595] (-875.737) (-878.082) * [-877.448] (-880.533) (-880.050) (-883.455) -- 0:00:50
      204000 -- [-873.930] (-876.389) (-873.923) (-875.558) * (-875.736) (-878.662) (-879.168) [-879.477] -- 0:00:50
      204500 -- (-877.226) (-875.171) (-875.816) [-876.415] * [-874.299] (-875.838) (-875.091) (-875.927) -- 0:00:50
      205000 -- (-876.961) (-876.496) [-877.294] (-875.164) * [-879.008] (-875.070) (-875.728) (-876.518) -- 0:00:50

      Average standard deviation of split frequencies: 0.011803

      205500 -- [-875.187] (-874.431) (-879.159) (-876.555) * (-879.387) (-877.395) [-878.780] (-880.185) -- 0:00:50
      206000 -- (-875.104) (-876.119) (-876.582) [-875.526] * (-877.445) (-876.200) [-875.385] (-875.018) -- 0:00:50
      206500 -- (-881.143) (-878.338) [-877.120] (-875.147) * (-876.976) (-877.106) [-873.655] (-877.056) -- 0:00:49
      207000 -- [-875.661] (-879.969) (-877.669) (-876.172) * (-875.637) (-878.138) (-876.287) [-874.447] -- 0:00:49
      207500 -- (-874.162) (-876.528) (-876.936) [-874.512] * (-874.756) (-875.502) (-876.293) [-873.990] -- 0:00:49
      208000 -- (-876.792) (-876.660) [-875.152] (-875.703) * (-874.407) [-873.730] (-874.229) (-874.862) -- 0:00:49
      208500 -- (-876.326) [-877.917] (-875.406) (-879.484) * (-877.876) [-874.877] (-874.482) (-877.316) -- 0:00:49
      209000 -- [-875.309] (-875.631) (-878.958) (-877.076) * (-875.324) (-875.265) [-875.367] (-874.576) -- 0:00:49
      209500 -- [-875.741] (-874.991) (-879.600) (-875.794) * (-874.550) [-873.765] (-877.382) (-875.917) -- 0:00:49
      210000 -- [-875.997] (-874.308) (-874.801) (-880.414) * [-875.117] (-877.564) (-874.387) (-874.405) -- 0:00:48

      Average standard deviation of split frequencies: 0.012131

      210500 -- (-875.928) (-874.217) [-875.037] (-874.064) * (-875.770) (-875.247) (-875.451) [-874.168] -- 0:00:48
      211000 -- (-874.463) (-874.287) (-877.014) [-874.026] * (-875.637) (-875.113) (-877.131) [-874.099] -- 0:00:48
      211500 -- [-880.555] (-875.074) (-875.191) (-874.101) * [-875.087] (-880.575) (-876.778) (-874.120) -- 0:00:48
      212000 -- (-877.287) (-873.745) [-876.201] (-874.461) * (-876.582) [-875.387] (-875.868) (-874.709) -- 0:00:48
      212500 -- (-874.739) [-874.551] (-875.898) (-874.103) * (-874.845) [-875.539] (-874.432) (-875.192) -- 0:00:48
      213000 -- (-875.170) [-875.593] (-876.665) (-873.676) * (-875.973) (-875.435) (-876.105) [-879.137] -- 0:00:48
      213500 -- (-873.626) (-877.779) [-875.983] (-874.871) * (-876.917) (-879.240) (-875.838) [-877.317] -- 0:00:47
      214000 -- (-877.778) (-877.145) [-874.313] (-874.899) * (-875.774) [-875.297] (-875.989) (-875.018) -- 0:00:47
      214500 -- [-877.141] (-877.786) (-878.237) (-873.934) * [-876.059] (-876.562) (-876.852) (-876.695) -- 0:00:47
      215000 -- (-875.453) (-874.402) [-879.652] (-873.902) * (-876.671) (-875.489) [-875.566] (-875.202) -- 0:00:47

      Average standard deviation of split frequencies: 0.011761

      215500 -- (-873.966) (-874.825) (-880.740) [-873.935] * (-874.885) [-875.315] (-875.810) (-879.876) -- 0:00:47
      216000 -- (-874.297) (-876.021) (-880.578) [-873.859] * (-874.903) [-878.105] (-876.269) (-874.370) -- 0:00:47
      216500 -- (-875.827) [-874.670] (-873.586) (-875.197) * [-874.420] (-877.392) (-876.977) (-876.088) -- 0:00:47
      217000 -- (-875.752) [-873.701] (-874.242) (-875.084) * (-881.082) [-876.760] (-873.956) (-874.360) -- 0:00:46
      217500 -- (-874.085) (-873.403) [-877.239] (-874.172) * (-881.389) (-880.583) [-878.777] (-878.488) -- 0:00:46
      218000 -- [-876.217] (-875.421) (-877.892) (-873.996) * [-874.891] (-876.643) (-877.696) (-880.518) -- 0:00:46
      218500 -- (-875.595) (-875.931) (-875.015) [-875.443] * [-874.218] (-877.807) (-876.174) (-874.908) -- 0:00:46
      219000 -- [-874.379] (-875.040) (-876.288) (-875.843) * (-874.561) (-875.190) [-877.255] (-875.021) -- 0:00:46
      219500 -- [-874.070] (-876.354) (-875.212) (-876.019) * (-879.315) (-876.349) [-875.203] (-874.075) -- 0:00:46
      220000 -- (-874.392) [-877.454] (-874.335) (-878.548) * [-876.721] (-875.631) (-879.786) (-874.693) -- 0:00:46

      Average standard deviation of split frequencies: 0.011868

      220500 -- (-873.716) (-879.454) [-875.137] (-878.115) * (-876.713) (-878.819) [-881.633] (-874.085) -- 0:00:49
      221000 -- (-873.732) (-878.039) (-875.792) [-875.496] * (-875.599) (-875.960) (-882.061) [-874.252] -- 0:00:49
      221500 -- (-874.770) (-876.353) [-875.021] (-876.795) * (-875.939) (-875.372) (-879.001) [-874.544] -- 0:00:49
      222000 -- (-877.004) (-877.309) (-875.999) [-877.167] * (-875.755) [-875.595] (-880.894) (-875.112) -- 0:00:49
      222500 -- [-875.428] (-876.522) (-877.524) (-875.359) * (-877.334) (-874.497) [-879.830] (-874.810) -- 0:00:48
      223000 -- (-875.119) (-878.966) (-875.362) [-875.329] * (-875.876) [-878.775] (-878.102) (-874.600) -- 0:00:48
      223500 -- (-874.957) [-877.124] (-874.889) (-877.276) * [-874.516] (-880.331) (-878.176) (-880.974) -- 0:00:48
      224000 -- (-876.395) (-878.814) (-874.808) [-875.925] * [-874.157] (-876.741) (-876.273) (-875.508) -- 0:00:48
      224500 -- (-879.989) (-874.914) (-875.105) [-875.906] * [-875.674] (-877.384) (-874.671) (-877.223) -- 0:00:48
      225000 -- (-875.460) (-874.859) [-874.277] (-874.484) * (-875.779) (-875.405) (-876.032) [-877.518] -- 0:00:48

      Average standard deviation of split frequencies: 0.013833

      225500 -- [-874.646] (-878.902) (-874.324) (-876.805) * (-876.605) (-878.187) [-877.365] (-879.406) -- 0:00:48
      226000 -- (-874.993) (-882.889) [-874.922] (-877.306) * [-875.482] (-879.086) (-875.944) (-875.210) -- 0:00:47
      226500 -- (-875.680) [-877.213] (-877.559) (-873.961) * (-876.896) (-876.775) (-877.443) [-874.368] -- 0:00:47
      227000 -- (-873.833) (-874.480) [-874.979] (-874.220) * [-874.947] (-877.546) (-879.806) (-876.963) -- 0:00:47
      227500 -- (-875.903) [-874.307] (-874.519) (-874.418) * (-875.774) (-874.154) (-880.658) [-876.319] -- 0:00:47
      228000 -- (-877.759) (-875.736) [-875.380] (-874.665) * [-877.686] (-875.149) (-874.553) (-878.143) -- 0:00:47
      228500 -- (-877.325) (-875.799) (-876.292) [-874.830] * (-877.603) (-874.727) [-874.227] (-877.019) -- 0:00:47
      229000 -- (-878.056) (-873.967) (-874.630) [-874.725] * (-873.972) [-873.354] (-875.067) (-874.929) -- 0:00:47
      229500 -- (-876.012) [-874.936] (-874.749) (-875.678) * (-876.952) (-874.341) [-875.329] (-874.566) -- 0:00:47
      230000 -- (-877.932) [-875.995] (-875.325) (-875.549) * (-877.924) (-880.034) [-873.470] (-874.309) -- 0:00:46

      Average standard deviation of split frequencies: 0.015919

      230500 -- (-877.275) (-876.062) [-875.150] (-878.196) * (-879.582) (-875.514) (-874.787) [-874.812] -- 0:00:46
      231000 -- (-874.128) (-876.424) [-874.125] (-875.469) * [-873.942] (-874.575) (-873.824) (-876.209) -- 0:00:46
      231500 -- (-875.165) [-874.700] (-880.336) (-876.685) * (-874.878) (-876.545) (-877.124) [-876.782] -- 0:00:46
      232000 -- (-876.341) (-875.606) (-876.155) [-873.993] * (-874.992) (-879.663) [-875.550] (-873.922) -- 0:00:46
      232500 -- [-877.492] (-874.376) (-878.432) (-873.492) * (-874.788) (-879.294) [-878.157] (-874.267) -- 0:00:46
      233000 -- [-877.078] (-878.492) (-875.717) (-873.657) * [-874.840] (-876.953) (-883.935) (-878.495) -- 0:00:46
      233500 -- (-879.273) (-877.292) [-875.384] (-875.405) * (-875.826) (-878.172) (-878.244) [-874.334] -- 0:00:45
      234000 -- (-877.521) (-881.224) [-876.751] (-875.810) * (-875.200) (-879.623) (-878.476) [-875.745] -- 0:00:45
      234500 -- (-876.892) [-880.371] (-876.079) (-879.395) * [-874.852] (-876.810) (-879.782) (-874.951) -- 0:00:45
      235000 -- (-875.554) [-875.762] (-877.222) (-877.125) * (-876.377) (-882.325) (-874.349) [-876.815] -- 0:00:45

      Average standard deviation of split frequencies: 0.014870

      235500 -- (-877.224) (-875.607) [-874.679] (-876.187) * [-878.338] (-882.497) (-877.048) (-877.421) -- 0:00:45
      236000 -- (-875.471) (-875.920) (-876.469) [-875.093] * (-878.663) (-878.802) (-875.589) [-876.558] -- 0:00:45
      236500 -- (-876.258) [-877.001] (-876.255) (-878.769) * (-875.624) (-876.132) (-877.992) [-875.740] -- 0:00:45
      237000 -- (-879.013) [-878.056] (-876.531) (-875.783) * (-875.876) [-874.784] (-878.275) (-874.843) -- 0:00:48
      237500 -- [-877.369] (-876.428) (-875.062) (-877.658) * (-880.316) [-874.781] (-876.565) (-874.967) -- 0:00:48
      238000 -- (-878.906) (-875.696) [-873.755] (-878.246) * (-881.276) (-874.875) [-875.889] (-874.196) -- 0:00:48
      238500 -- (-875.899) [-875.839] (-875.623) (-876.073) * (-878.051) (-875.172) (-874.577) [-874.959] -- 0:00:47
      239000 -- [-877.154] (-874.463) (-875.346) (-874.904) * (-876.661) [-877.548] (-878.252) (-878.610) -- 0:00:47
      239500 -- (-876.507) (-873.762) [-876.915] (-878.752) * (-875.695) [-875.644] (-880.151) (-876.818) -- 0:00:47
      240000 -- (-875.615) [-873.823] (-873.922) (-874.914) * (-881.895) (-875.495) [-875.998] (-876.087) -- 0:00:47

      Average standard deviation of split frequencies: 0.015017

      240500 -- (-875.824) [-875.016] (-877.067) (-876.172) * (-880.150) (-875.748) (-876.819) [-875.172] -- 0:00:47
      241000 -- (-877.216) (-875.046) (-873.905) [-874.961] * (-881.134) [-877.525] (-876.294) (-875.996) -- 0:00:47
      241500 -- [-875.802] (-875.696) (-876.765) (-874.544) * (-875.199) (-877.609) [-875.104] (-877.822) -- 0:00:47
      242000 -- (-879.078) (-877.655) (-875.963) [-878.019] * [-876.080] (-876.114) (-876.925) (-875.872) -- 0:00:46
      242500 -- [-877.274] (-875.905) (-877.100) (-876.423) * (-874.695) (-875.140) (-880.544) [-874.350] -- 0:00:46
      243000 -- [-875.391] (-878.993) (-877.322) (-877.082) * (-874.892) (-875.447) [-880.064] (-874.431) -- 0:00:46
      243500 -- (-878.612) (-877.148) [-876.119] (-874.926) * (-876.095) [-876.935] (-874.610) (-876.424) -- 0:00:46
      244000 -- [-876.714] (-875.498) (-878.054) (-875.956) * (-875.122) [-878.215] (-876.371) (-875.374) -- 0:00:46
      244500 -- (-875.538) [-873.915] (-882.056) (-874.399) * (-876.671) [-876.317] (-876.889) (-873.951) -- 0:00:46
      245000 -- (-878.579) (-874.171) [-877.761] (-876.758) * (-878.362) [-874.833] (-874.100) (-875.758) -- 0:00:46

      Average standard deviation of split frequencies: 0.015330

      245500 -- (-878.355) [-879.773] (-875.657) (-873.922) * (-878.386) (-875.237) [-876.040] (-874.989) -- 0:00:46
      246000 -- (-873.997) (-876.992) (-875.291) [-873.774] * (-880.196) (-879.416) (-879.114) [-875.950] -- 0:00:45
      246500 -- [-874.711] (-875.064) (-879.036) (-874.980) * [-879.142] (-878.976) (-877.018) (-876.278) -- 0:00:45
      247000 -- (-874.630) [-875.729] (-878.346) (-878.540) * (-882.583) (-874.991) (-877.973) [-874.662] -- 0:00:45
      247500 -- (-874.751) (-875.261) [-877.291] (-874.707) * (-876.433) (-876.123) [-874.725] (-874.584) -- 0:00:45
      248000 -- (-877.140) [-875.892] (-877.230) (-878.377) * (-879.581) (-875.997) (-874.665) [-874.710] -- 0:00:45
      248500 -- (-878.135) (-874.918) (-881.329) [-873.890] * [-874.544] (-876.894) (-876.789) (-876.508) -- 0:00:45
      249000 -- (-875.008) (-875.312) [-875.994] (-878.649) * (-876.952) [-877.587] (-876.385) (-881.160) -- 0:00:45
      249500 -- (-876.899) [-874.385] (-875.355) (-878.126) * (-875.802) (-875.542) (-877.519) [-875.479] -- 0:00:45
      250000 -- [-875.053] (-874.764) (-877.482) (-876.093) * (-874.022) [-875.574] (-874.833) (-875.419) -- 0:00:45

      Average standard deviation of split frequencies: 0.015377

      250500 -- (-874.903) (-875.086) [-875.739] (-873.723) * (-877.354) (-875.911) [-874.735] (-876.959) -- 0:00:44
      251000 -- (-873.884) (-875.104) (-878.859) [-874.196] * [-873.913] (-873.917) (-874.535) (-875.650) -- 0:00:44
      251500 -- (-874.481) (-874.690) (-876.965) [-875.794] * (-874.538) [-876.178] (-877.041) (-877.184) -- 0:00:44
      252000 -- (-873.846) [-877.693] (-875.426) (-874.321) * (-873.736) (-874.574) [-875.405] (-875.181) -- 0:00:44
      252500 -- [-873.750] (-876.693) (-875.823) (-877.043) * [-875.818] (-875.379) (-880.514) (-873.972) -- 0:00:44
      253000 -- (-875.786) (-875.560) [-874.764] (-874.922) * (-875.492) [-876.225] (-880.521) (-873.936) -- 0:00:44
      253500 -- (-875.390) (-880.856) (-876.302) [-873.862] * (-874.211) (-877.772) (-876.245) [-877.684] -- 0:00:44
      254000 -- (-875.105) [-875.493] (-881.873) (-873.658) * (-875.277) (-877.140) [-875.185] (-873.571) -- 0:00:46
      254500 -- (-873.646) [-875.364] (-880.797) (-874.805) * (-875.247) (-874.276) [-874.488] (-874.940) -- 0:00:46
      255000 -- (-878.067) (-878.367) (-878.965) [-874.593] * (-879.872) (-876.063) (-879.761) [-874.283] -- 0:00:46

      Average standard deviation of split frequencies: 0.015056

      255500 -- (-876.592) (-879.946) [-874.607] (-879.481) * (-879.069) (-874.141) (-877.514) [-874.326] -- 0:00:46
      256000 -- (-874.792) (-879.412) [-876.142] (-876.111) * (-876.119) (-874.625) (-880.614) [-877.056] -- 0:00:46
      256500 -- [-875.276] (-875.940) (-876.568) (-878.432) * [-877.948] (-873.708) (-874.566) (-875.651) -- 0:00:46
      257000 -- (-877.277) (-875.325) (-879.027) [-875.106] * [-878.078] (-878.568) (-874.976) (-877.466) -- 0:00:46
      257500 -- (-875.581) (-878.815) [-875.645] (-878.158) * (-875.198) [-874.478] (-873.925) (-874.912) -- 0:00:46
      258000 -- (-877.753) (-878.388) [-877.506] (-875.327) * (-876.118) (-874.360) (-875.099) [-874.803] -- 0:00:46
      258500 -- (-875.697) [-875.551] (-878.192) (-873.905) * (-879.339) (-877.875) [-876.305] (-876.207) -- 0:00:45
      259000 -- (-874.365) (-879.606) [-876.070] (-875.084) * [-874.999] (-875.775) (-880.269) (-874.022) -- 0:00:45
      259500 -- (-876.855) (-876.204) [-874.633] (-873.564) * (-874.527) (-875.261) (-876.625) [-873.697] -- 0:00:45
      260000 -- (-876.833) (-876.563) (-874.989) [-875.495] * (-874.667) (-876.216) (-876.407) [-874.542] -- 0:00:45

      Average standard deviation of split frequencies: 0.014468

      260500 -- (-875.192) (-877.666) [-874.708] (-874.269) * (-877.345) (-876.826) (-874.202) [-873.394] -- 0:00:45
      261000 -- (-875.348) [-874.245] (-877.405) (-874.027) * (-874.571) [-874.287] (-873.853) (-876.196) -- 0:00:45
      261500 -- (-874.671) (-874.520) [-875.023] (-875.144) * (-873.780) [-874.354] (-874.301) (-877.349) -- 0:00:45
      262000 -- (-875.961) (-874.598) (-874.085) [-874.880] * (-873.738) (-876.802) [-875.002] (-876.862) -- 0:00:45
      262500 -- (-874.664) [-874.931] (-874.776) (-875.014) * (-875.912) (-876.212) [-878.886] (-876.895) -- 0:00:44
      263000 -- (-875.286) (-877.459) [-875.155] (-875.682) * [-874.696] (-878.596) (-878.256) (-874.667) -- 0:00:44
      263500 -- (-874.228) (-876.128) [-876.122] (-876.133) * [-874.937] (-876.586) (-874.398) (-875.240) -- 0:00:44
      264000 -- (-873.735) (-879.748) (-878.046) [-876.023] * (-880.556) (-874.532) (-875.034) [-874.552] -- 0:00:44
      264500 -- [-873.770] (-880.637) (-874.223) (-877.665) * (-875.491) (-874.644) [-873.990] (-876.365) -- 0:00:44
      265000 -- (-875.211) (-876.627) (-875.347) [-873.784] * (-876.638) (-880.713) (-879.189) [-874.295] -- 0:00:44

      Average standard deviation of split frequencies: 0.013656

      265500 -- (-877.361) [-875.495] (-874.724) (-874.855) * (-877.408) (-874.498) [-874.344] (-873.850) -- 0:00:44
      266000 -- [-877.473] (-875.063) (-874.307) (-875.868) * (-875.784) (-874.860) (-874.834) [-875.389] -- 0:00:44
      266500 -- (-878.094) (-874.909) (-874.935) [-875.065] * (-877.228) (-875.831) [-877.315] (-876.848) -- 0:00:44
      267000 -- (-878.515) (-873.771) (-874.666) [-879.760] * [-878.903] (-877.002) (-874.007) (-875.673) -- 0:00:43
      267500 -- (-879.579) (-873.985) [-874.172] (-875.396) * [-880.814] (-875.319) (-876.671) (-880.535) -- 0:00:43
      268000 -- (-876.002) [-875.166] (-876.484) (-875.301) * (-876.809) (-877.962) (-877.929) [-875.901] -- 0:00:43
      268500 -- [-877.438] (-874.567) (-876.034) (-874.628) * [-877.945] (-877.006) (-878.098) (-874.075) -- 0:00:43
      269000 -- (-875.876) [-874.741] (-875.605) (-875.724) * (-877.939) (-879.209) (-876.527) [-875.983] -- 0:00:43
      269500 -- (-875.704) (-874.741) (-876.647) [-873.977] * (-874.011) [-875.951] (-875.882) (-878.937) -- 0:00:43
      270000 -- (-875.478) (-873.957) (-875.486) [-874.131] * (-874.735) [-875.263] (-877.944) (-875.991) -- 0:00:43

      Average standard deviation of split frequencies: 0.014650

      270500 -- [-874.707] (-874.184) (-876.589) (-874.438) * (-874.899) (-874.841) [-875.989] (-874.955) -- 0:00:45
      271000 -- [-877.266] (-874.453) (-876.762) (-874.477) * (-876.468) (-873.727) [-876.826] (-875.252) -- 0:00:45
      271500 -- (-876.289) [-875.281] (-876.413) (-874.277) * (-877.589) [-874.353] (-876.677) (-874.054) -- 0:00:45
      272000 -- (-878.432) (-875.640) [-874.597] (-874.173) * (-876.728) (-874.213) [-876.550] (-876.069) -- 0:00:45
      272500 -- [-878.141] (-875.539) (-878.233) (-875.970) * (-877.429) (-875.365) (-877.794) [-877.371] -- 0:00:45
      273000 -- (-877.709) (-876.387) (-875.079) [-875.153] * (-876.232) (-874.133) [-875.579] (-875.726) -- 0:00:45
      273500 -- (-883.434) (-876.112) [-874.120] (-876.846) * (-875.637) (-875.729) (-874.843) [-874.278] -- 0:00:45
      274000 -- (-876.207) (-880.309) [-873.996] (-875.221) * (-880.695) [-874.081] (-876.445) (-877.036) -- 0:00:45
      274500 -- (-875.485) (-875.038) [-875.959] (-875.933) * (-875.657) (-873.711) [-877.693] (-876.294) -- 0:00:44
      275000 -- [-876.331] (-875.630) (-880.108) (-877.977) * (-877.241) (-873.959) [-877.699] (-876.007) -- 0:00:44

      Average standard deviation of split frequencies: 0.013262

      275500 -- (-879.382) (-874.277) [-875.132] (-880.883) * (-876.646) [-874.155] (-876.721) (-875.845) -- 0:00:44
      276000 -- [-877.222] (-876.956) (-878.036) (-875.523) * (-875.573) [-877.365] (-874.909) (-875.323) -- 0:00:44
      276500 -- (-877.745) (-876.170) (-875.771) [-874.776] * (-874.373) (-879.874) (-876.176) [-886.021] -- 0:00:44
      277000 -- (-877.297) (-881.876) [-876.165] (-874.779) * (-876.681) [-873.679] (-875.994) (-877.030) -- 0:00:44
      277500 -- [-874.939] (-876.818) (-875.213) (-877.786) * [-876.386] (-873.716) (-875.147) (-877.720) -- 0:00:44
      278000 -- (-876.102) (-877.764) [-873.829] (-876.772) * (-874.347) [-875.978] (-874.773) (-874.623) -- 0:00:44
      278500 -- (-875.488) (-879.797) [-874.303] (-874.826) * (-875.355) (-873.649) [-875.469] (-881.945) -- 0:00:44
      279000 -- (-875.599) (-879.238) [-875.037] (-875.221) * (-875.216) [-875.538] (-873.812) (-878.489) -- 0:00:43
      279500 -- (-874.273) [-874.458] (-874.162) (-878.024) * [-878.687] (-874.575) (-874.526) (-876.909) -- 0:00:43
      280000 -- (-874.385) [-875.402] (-873.713) (-878.643) * (-876.922) (-876.840) [-877.824] (-877.792) -- 0:00:43

      Average standard deviation of split frequencies: 0.012350

      280500 -- [-876.371] (-875.156) (-874.881) (-885.271) * [-874.780] (-876.994) (-875.819) (-876.272) -- 0:00:43
      281000 -- [-875.300] (-875.143) (-874.612) (-879.455) * (-874.711) [-876.012] (-879.990) (-876.900) -- 0:00:43
      281500 -- (-874.144) [-879.157] (-876.972) (-875.804) * [-874.619] (-878.033) (-879.996) (-875.985) -- 0:00:43
      282000 -- (-876.631) [-877.463] (-878.527) (-877.263) * [-876.660] (-874.525) (-873.962) (-876.763) -- 0:00:43
      282500 -- (-878.012) (-875.583) (-877.236) [-877.522] * (-877.818) (-875.396) (-876.989) [-875.692] -- 0:00:43
      283000 -- (-874.284) (-876.597) [-879.750] (-878.261) * (-876.391) (-876.126) (-874.718) [-873.335] -- 0:00:43
      283500 -- [-877.467] (-877.887) (-873.573) (-876.758) * [-874.707] (-875.416) (-876.403) (-874.119) -- 0:00:42
      284000 -- (-874.936) (-877.765) (-873.807) [-875.384] * (-876.228) (-874.342) [-876.950] (-874.931) -- 0:00:42
      284500 -- (-874.126) (-876.875) [-873.864] (-874.153) * (-876.621) [-875.561] (-880.272) (-874.993) -- 0:00:42
      285000 -- (-875.251) (-873.633) [-875.737] (-877.883) * (-878.068) [-874.949] (-875.273) (-876.767) -- 0:00:42

      Average standard deviation of split frequencies: 0.011926

      285500 -- (-874.649) (-874.807) [-876.295] (-874.253) * (-875.833) [-876.334] (-877.421) (-877.759) -- 0:00:42
      286000 -- [-875.127] (-877.555) (-878.138) (-874.679) * (-877.695) [-874.351] (-876.115) (-875.626) -- 0:00:42
      286500 -- (-876.090) (-877.324) [-875.687] (-875.893) * (-876.216) (-873.997) (-876.310) [-874.222] -- 0:00:42
      287000 -- (-880.076) (-876.193) (-878.105) [-875.306] * (-875.632) (-880.692) (-875.306) [-874.840] -- 0:00:42
      287500 -- [-877.363] (-876.215) (-875.937) (-876.962) * (-876.664) (-877.580) (-873.440) [-875.418] -- 0:00:44
      288000 -- [-876.847] (-875.165) (-875.227) (-877.745) * (-877.378) (-874.695) (-875.145) [-876.399] -- 0:00:44
      288500 -- (-873.840) (-874.627) [-874.807] (-874.578) * (-878.113) [-878.065] (-875.553) (-878.088) -- 0:00:44
      289000 -- [-874.837] (-876.698) (-878.089) (-874.623) * [-874.631] (-876.830) (-875.628) (-874.414) -- 0:00:44
      289500 -- (-874.195) (-874.267) (-883.028) [-875.689] * (-875.563) (-875.640) [-876.579] (-874.266) -- 0:00:44
      290000 -- (-874.914) (-877.952) (-878.402) [-874.347] * [-875.408] (-876.471) (-876.884) (-876.198) -- 0:00:44

      Average standard deviation of split frequencies: 0.012307

      290500 -- (-877.588) (-875.379) [-874.400] (-873.734) * (-877.500) (-874.973) (-878.223) [-873.943] -- 0:00:43
      291000 -- (-876.085) (-874.806) (-877.107) [-875.996] * [-876.703] (-876.887) (-875.870) (-877.491) -- 0:00:43
      291500 -- [-874.513] (-875.176) (-874.184) (-875.065) * [-875.710] (-874.738) (-876.426) (-874.140) -- 0:00:43
      292000 -- (-876.200) (-876.627) (-874.356) [-876.167] * (-874.480) (-875.477) [-874.433] (-874.935) -- 0:00:43
      292500 -- [-873.910] (-875.644) (-875.781) (-874.686) * [-874.571] (-877.489) (-874.828) (-876.270) -- 0:00:43
      293000 -- [-874.034] (-887.268) (-876.418) (-874.618) * [-874.788] (-877.214) (-878.620) (-879.685) -- 0:00:43
      293500 -- (-876.123) [-874.124] (-876.070) (-873.547) * [-875.205] (-877.460) (-877.995) (-874.574) -- 0:00:43
      294000 -- (-875.862) [-877.622] (-874.151) (-875.842) * (-874.883) [-875.794] (-875.991) (-874.049) -- 0:00:43
      294500 -- (-876.533) (-876.051) [-877.321] (-875.673) * (-874.104) (-874.082) [-879.208] (-873.909) -- 0:00:43
      295000 -- (-875.185) [-874.737] (-877.339) (-874.397) * (-876.288) (-877.369) [-879.535] (-874.165) -- 0:00:43

      Average standard deviation of split frequencies: 0.011898

      295500 -- (-876.693) (-873.916) (-877.242) [-875.947] * [-876.834] (-877.171) (-874.784) (-874.112) -- 0:00:42
      296000 -- (-879.836) [-875.708] (-875.802) (-875.151) * (-877.521) (-877.377) [-875.673] (-877.342) -- 0:00:42
      296500 -- (-876.393) (-874.012) [-876.373] (-881.753) * (-875.821) (-877.734) [-875.400] (-876.123) -- 0:00:42
      297000 -- [-874.719] (-875.448) (-874.397) (-879.558) * (-875.670) (-875.475) (-875.556) [-875.250] -- 0:00:42
      297500 -- (-875.349) (-875.468) [-874.837] (-874.051) * (-874.405) [-875.950] (-877.444) (-875.996) -- 0:00:42
      298000 -- (-876.405) (-875.085) (-879.548) [-876.970] * [-874.680] (-877.235) (-876.040) (-874.716) -- 0:00:42
      298500 -- (-874.868) [-874.981] (-874.176) (-879.645) * [-874.716] (-874.762) (-876.861) (-874.548) -- 0:00:42
      299000 -- (-877.276) (-873.687) [-874.749] (-878.869) * (-874.854) (-875.362) [-874.836] (-875.159) -- 0:00:42
      299500 -- [-876.389] (-875.910) (-875.575) (-873.790) * (-874.129) (-876.734) (-875.437) [-881.744] -- 0:00:42
      300000 -- (-878.524) (-877.064) [-875.575] (-879.040) * (-874.456) (-874.144) (-875.173) [-874.318] -- 0:00:42

      Average standard deviation of split frequencies: 0.012451

      300500 -- (-876.768) [-875.764] (-874.856) (-875.598) * [-874.634] (-878.482) (-874.157) (-876.318) -- 0:00:41
      301000 -- [-875.985] (-879.480) (-873.783) (-874.706) * [-878.229] (-874.541) (-875.643) (-878.547) -- 0:00:41
      301500 -- [-876.607] (-881.140) (-876.608) (-875.596) * (-874.925) (-874.681) [-875.023] (-877.997) -- 0:00:41
      302000 -- (-879.412) [-874.264] (-877.378) (-878.362) * (-874.735) (-874.767) [-877.012] (-874.439) -- 0:00:41
      302500 -- (-874.030) (-877.681) [-876.322] (-877.383) * [-873.452] (-876.764) (-874.997) (-875.413) -- 0:00:41
      303000 -- (-878.225) [-879.620] (-875.363) (-876.040) * (-881.028) (-875.596) (-878.277) [-875.514] -- 0:00:41
      303500 -- (-874.675) (-877.673) (-876.209) [-874.366] * (-875.991) (-874.722) (-879.369) [-876.717] -- 0:00:41
      304000 -- (-873.896) [-877.449] (-882.782) (-877.153) * (-873.560) [-875.439] (-875.215) (-873.995) -- 0:00:41
      304500 -- (-873.528) [-877.889] (-879.161) (-876.070) * [-874.376] (-874.311) (-875.390) (-873.988) -- 0:00:43
      305000 -- [-875.686] (-875.271) (-874.890) (-874.797) * [-875.677] (-877.175) (-876.986) (-873.664) -- 0:00:43

      Average standard deviation of split frequencies: 0.012506

      305500 -- (-878.930) (-876.935) (-875.193) [-874.602] * (-875.930) (-874.404) [-878.049] (-873.614) -- 0:00:43
      306000 -- (-879.481) (-876.635) (-874.861) [-874.623] * (-876.640) [-875.333] (-876.748) (-874.481) -- 0:00:43
      306500 -- [-874.625] (-877.777) (-874.015) (-874.963) * (-878.413) (-875.366) [-873.728] (-876.497) -- 0:00:42
      307000 -- (-875.694) [-878.333] (-874.514) (-876.792) * [-875.352] (-879.852) (-873.728) (-878.490) -- 0:00:42
      307500 -- [-875.321] (-875.994) (-878.717) (-875.550) * (-875.903) (-879.973) (-873.861) [-878.271] -- 0:00:42
      308000 -- (-875.246) (-877.904) (-876.621) [-877.924] * (-881.419) (-878.720) (-875.763) [-875.886] -- 0:00:42
      308500 -- (-873.458) (-876.685) (-876.293) [-877.791] * [-874.764] (-878.265) (-876.521) (-879.976) -- 0:00:42
      309000 -- (-873.661) (-880.425) (-875.692) [-876.259] * (-875.779) [-873.877] (-879.114) (-875.457) -- 0:00:42
      309500 -- (-874.056) (-875.445) [-873.624] (-875.771) * [-874.561] (-873.681) (-879.745) (-875.865) -- 0:00:42
      310000 -- (-874.061) [-874.902] (-876.549) (-875.414) * (-874.109) (-874.609) [-876.432] (-875.532) -- 0:00:42

      Average standard deviation of split frequencies: 0.012585

      310500 -- (-875.300) (-879.620) (-875.706) [-875.236] * (-873.988) (-875.553) [-876.127] (-873.863) -- 0:00:42
      311000 -- [-875.320] (-879.659) (-879.211) (-874.645) * (-875.801) (-874.273) [-877.792] (-873.816) -- 0:00:42
      311500 -- (-877.944) (-881.853) [-875.579] (-873.641) * [-874.241] (-877.157) (-875.389) (-876.976) -- 0:00:41
      312000 -- [-877.306] (-880.989) (-873.460) (-874.724) * (-875.067) [-876.091] (-876.050) (-876.659) -- 0:00:41
      312500 -- (-878.415) [-876.610] (-873.576) (-873.532) * [-873.596] (-876.856) (-885.139) (-876.861) -- 0:00:41
      313000 -- (-880.679) (-882.465) (-874.567) [-874.324] * [-874.411] (-881.601) (-882.499) (-876.499) -- 0:00:41
      313500 -- (-878.438) [-874.488] (-874.567) (-876.827) * (-874.472) (-874.956) (-876.059) [-876.777] -- 0:00:41
      314000 -- [-877.341] (-874.449) (-874.953) (-875.484) * (-874.144) (-873.998) [-875.101] (-876.044) -- 0:00:41
      314500 -- (-876.727) [-874.605] (-874.799) (-877.712) * (-878.080) (-874.219) [-880.432] (-877.639) -- 0:00:41
      315000 -- (-874.315) (-874.726) [-874.782] (-875.269) * (-878.352) (-875.965) (-881.613) [-874.048] -- 0:00:41

      Average standard deviation of split frequencies: 0.012100

      315500 -- (-875.486) (-875.324) (-879.785) [-877.779] * (-874.640) (-879.178) (-879.883) [-873.657] -- 0:00:41
      316000 -- (-875.568) (-877.521) (-875.921) [-875.108] * (-876.138) (-875.093) (-876.021) [-873.737] -- 0:00:41
      316500 -- (-874.573) (-873.664) (-879.378) [-875.143] * (-875.073) (-874.003) (-876.468) [-874.429] -- 0:00:41
      317000 -- (-874.660) (-878.241) (-874.974) [-874.354] * (-879.485) (-876.262) (-876.264) [-878.254] -- 0:00:40
      317500 -- (-874.254) (-876.651) (-877.296) [-873.966] * (-875.478) [-876.698] (-874.892) (-876.317) -- 0:00:40
      318000 -- (-875.948) (-875.681) (-877.523) [-873.585] * [-874.989] (-875.668) (-874.071) (-876.362) -- 0:00:40
      318500 -- (-876.534) (-874.494) (-874.827) [-874.735] * (-874.909) (-874.649) (-874.443) [-879.848] -- 0:00:40
      319000 -- (-880.079) (-876.627) (-877.153) [-879.992] * (-875.592) [-875.160] (-876.553) (-880.017) -- 0:00:40
      319500 -- [-880.953] (-875.983) (-876.666) (-874.860) * (-873.947) (-878.467) [-875.700] (-876.294) -- 0:00:40
      320000 -- (-876.935) (-874.680) [-873.455] (-876.683) * (-875.684) (-876.232) (-876.565) [-878.174] -- 0:00:40

      Average standard deviation of split frequencies: 0.012366

      320500 -- (-876.269) (-874.397) (-876.854) [-875.085] * [-877.800] (-877.846) (-874.434) (-874.948) -- 0:00:40
      321000 -- (-877.840) (-876.711) (-875.060) [-874.681] * (-879.816) (-876.313) [-875.169] (-877.035) -- 0:00:40
      321500 -- (-878.682) (-879.409) [-874.054] (-874.260) * [-874.337] (-875.098) (-873.963) (-874.078) -- 0:00:42
      322000 -- (-874.629) [-877.338] (-874.679) (-878.850) * (-879.630) [-875.023] (-875.856) (-874.001) -- 0:00:42
      322500 -- (-874.715) [-876.947] (-874.753) (-879.199) * [-874.337] (-876.855) (-879.095) (-876.681) -- 0:00:42
      323000 -- (-879.304) [-874.959] (-877.491) (-877.915) * (-874.818) [-875.608] (-879.918) (-878.465) -- 0:00:41
      323500 -- [-877.321] (-877.511) (-873.569) (-874.890) * (-876.036) [-874.160] (-876.734) (-874.458) -- 0:00:41
      324000 -- (-876.408) (-877.995) [-873.945] (-877.741) * (-874.065) (-874.281) (-877.072) [-875.783] -- 0:00:41
      324500 -- [-876.584] (-874.230) (-877.389) (-876.563) * [-874.220] (-880.638) (-876.513) (-876.333) -- 0:00:41
      325000 -- (-874.632) (-873.340) [-876.986] (-876.195) * (-879.708) (-875.816) (-875.432) [-874.510] -- 0:00:41

      Average standard deviation of split frequencies: 0.011823

      325500 -- (-875.124) [-875.299] (-875.038) (-875.035) * (-877.863) [-875.350] (-873.534) (-879.588) -- 0:00:41
      326000 -- [-875.538] (-874.540) (-874.368) (-877.802) * (-877.293) (-876.977) [-873.534] (-877.844) -- 0:00:41
      326500 -- (-876.048) (-876.371) (-874.587) [-874.448] * (-875.682) [-873.790] (-875.063) (-875.465) -- 0:00:41
      327000 -- (-877.672) (-877.650) (-874.107) [-873.682] * [-874.690] (-875.151) (-874.660) (-875.546) -- 0:00:41
      327500 -- (-875.267) [-879.854] (-874.492) (-877.289) * (-874.981) [-876.378] (-874.360) (-878.384) -- 0:00:41
      328000 -- (-877.144) (-879.217) (-876.376) [-881.386] * (-876.667) (-875.641) (-876.681) [-874.807] -- 0:00:40
      328500 -- (-876.664) (-875.468) [-874.244] (-879.388) * (-874.819) (-877.350) [-875.545] (-875.559) -- 0:00:40
      329000 -- (-882.323) [-876.999] (-876.500) (-874.167) * (-874.158) (-879.592) [-874.750] (-876.255) -- 0:00:40
      329500 -- [-878.785] (-876.649) (-879.469) (-874.211) * (-876.671) [-876.218] (-874.745) (-880.315) -- 0:00:40
      330000 -- (-875.225) (-874.455) (-876.253) [-875.469] * [-874.068] (-874.416) (-874.909) (-878.074) -- 0:00:40

      Average standard deviation of split frequencies: 0.011824

      330500 -- [-874.366] (-879.458) (-873.570) (-875.816) * (-880.070) (-876.020) [-875.475] (-877.846) -- 0:00:40
      331000 -- (-875.139) (-877.591) [-876.791] (-876.351) * (-875.356) [-876.070] (-874.668) (-878.064) -- 0:00:40
      331500 -- (-876.054) (-876.093) [-876.379] (-876.267) * [-877.455] (-875.808) (-875.319) (-877.949) -- 0:00:40
      332000 -- (-880.516) (-876.314) [-875.175] (-875.641) * (-879.884) [-876.514] (-874.625) (-875.826) -- 0:00:40
      332500 -- (-875.011) (-876.588) (-876.689) [-877.000] * (-875.937) [-876.329] (-875.505) (-875.688) -- 0:00:40
      333000 -- (-874.669) [-876.590] (-874.751) (-877.500) * (-876.879) [-874.740] (-875.979) (-874.299) -- 0:00:40
      333500 -- (-874.971) (-882.844) [-874.340] (-876.132) * [-873.794] (-878.814) (-877.372) (-873.625) -- 0:00:39
      334000 -- (-874.530) [-880.916] (-881.231) (-875.744) * (-877.514) (-877.515) (-874.758) [-874.264] -- 0:00:39
      334500 -- [-874.606] (-878.403) (-879.413) (-879.877) * (-876.809) (-875.123) [-873.750] (-876.064) -- 0:00:39
      335000 -- (-875.899) [-876.631] (-876.076) (-884.885) * [-874.367] (-875.926) (-874.931) (-874.345) -- 0:00:39

      Average standard deviation of split frequencies: 0.012297

      335500 -- [-876.796] (-874.333) (-878.344) (-875.063) * (-880.024) [-875.438] (-879.068) (-873.917) -- 0:00:39
      336000 -- (-877.976) (-874.229) [-878.871] (-875.332) * (-877.670) (-876.032) (-874.816) [-874.759] -- 0:00:39
      336500 -- (-877.239) (-875.612) (-876.365) [-877.380] * (-875.810) [-876.998] (-874.931) (-875.291) -- 0:00:39
      337000 -- [-875.582] (-879.661) (-876.356) (-875.619) * [-875.078] (-877.534) (-875.423) (-875.603) -- 0:00:39
      337500 -- [-875.234] (-881.180) (-877.558) (-877.008) * (-876.691) [-875.492] (-876.056) (-873.785) -- 0:00:39
      338000 -- [-877.667] (-875.922) (-877.457) (-877.886) * (-877.662) (-875.251) [-874.085] (-876.970) -- 0:00:39
      338500 -- (-878.797) [-874.790] (-876.386) (-876.448) * (-875.936) (-874.755) (-877.716) [-874.166] -- 0:00:41
      339000 -- (-873.809) (-875.176) (-875.116) [-875.405] * (-874.807) (-876.777) (-877.074) [-877.744] -- 0:00:40
      339500 -- (-873.684) [-878.154] (-876.348) (-876.907) * (-876.416) (-876.072) (-875.445) [-877.846] -- 0:00:40
      340000 -- (-876.085) [-876.483] (-875.187) (-876.319) * (-874.327) (-874.921) [-874.724] (-877.250) -- 0:00:40

      Average standard deviation of split frequencies: 0.012210

      340500 -- (-878.906) [-875.883] (-874.642) (-877.082) * (-874.676) [-875.522] (-878.830) (-876.873) -- 0:00:40
      341000 -- (-875.823) [-876.247] (-874.893) (-878.254) * (-874.522) (-874.672) [-875.681] (-881.756) -- 0:00:40
      341500 -- (-879.024) [-875.230] (-876.051) (-877.015) * (-873.723) (-879.319) (-873.691) [-874.534] -- 0:00:40
      342000 -- [-874.041] (-876.832) (-877.281) (-877.047) * (-874.636) [-875.023] (-875.318) (-875.173) -- 0:00:40
      342500 -- [-875.247] (-875.896) (-877.545) (-875.536) * [-878.438] (-877.208) (-874.357) (-875.111) -- 0:00:40
      343000 -- (-876.090) (-878.979) (-874.999) [-875.225] * (-875.557) (-874.463) (-879.700) [-875.666] -- 0:00:40
      343500 -- (-879.362) (-877.293) [-875.185] (-877.792) * (-874.236) [-874.709] (-876.430) (-875.924) -- 0:00:40
      344000 -- (-875.686) (-876.871) (-875.388) [-876.707] * (-881.415) (-874.493) [-876.779] (-876.665) -- 0:00:40
      344500 -- [-875.304] (-879.848) (-874.249) (-876.617) * (-876.970) (-875.057) [-874.780] (-877.234) -- 0:00:39
      345000 -- (-877.149) [-876.670] (-874.933) (-880.601) * [-875.364] (-877.395) (-875.092) (-876.982) -- 0:00:39

      Average standard deviation of split frequencies: 0.012422

      345500 -- (-876.075) (-881.272) (-874.292) [-879.452] * [-875.851] (-876.606) (-873.424) (-874.997) -- 0:00:39
      346000 -- [-874.726] (-879.708) (-874.357) (-875.182) * (-879.051) [-878.342] (-873.743) (-873.803) -- 0:00:39
      346500 -- (-878.175) (-874.881) [-874.367] (-876.767) * (-876.544) [-874.699] (-875.496) (-875.736) -- 0:00:39
      347000 -- (-874.070) [-873.893] (-874.794) (-878.867) * [-875.939] (-878.908) (-874.300) (-876.708) -- 0:00:39
      347500 -- (-875.033) (-875.989) (-874.724) [-875.566] * [-874.690] (-878.020) (-874.715) (-874.579) -- 0:00:39
      348000 -- (-873.686) (-876.472) [-874.878] (-875.546) * (-873.857) (-878.050) [-876.020] (-875.605) -- 0:00:39
      348500 -- (-877.816) (-879.461) (-880.473) [-875.905] * [-874.835] (-878.034) (-878.750) (-873.914) -- 0:00:39
      349000 -- (-875.789) (-877.875) [-874.359] (-874.175) * (-877.587) (-879.493) [-874.721] (-874.845) -- 0:00:39
      349500 -- (-876.079) (-875.439) [-873.922] (-874.812) * (-874.183) (-878.054) [-876.123] (-874.414) -- 0:00:39
      350000 -- (-877.526) (-875.129) [-874.022] (-879.432) * (-875.722) [-878.153] (-879.222) (-877.198) -- 0:00:39

      Average standard deviation of split frequencies: 0.012336

      350500 -- (-876.757) [-874.967] (-880.794) (-876.966) * (-877.776) (-875.197) [-877.248] (-878.154) -- 0:00:38
      351000 -- (-875.210) (-880.323) (-876.332) [-874.788] * [-875.668] (-875.129) (-877.761) (-879.369) -- 0:00:38
      351500 -- (-878.387) [-874.601] (-873.918) (-878.397) * (-875.788) (-878.103) (-873.881) [-876.648] -- 0:00:38
      352000 -- (-876.828) [-875.031] (-873.809) (-878.403) * (-878.325) (-876.209) [-876.874] (-876.082) -- 0:00:38
      352500 -- (-876.804) (-875.576) (-875.473) [-876.294] * (-873.746) [-875.978] (-876.165) (-876.617) -- 0:00:38
      353000 -- (-875.977) (-877.988) [-874.162] (-876.419) * (-875.567) (-875.585) [-876.407] (-875.405) -- 0:00:38
      353500 -- (-874.155) (-876.235) [-876.235] (-877.132) * (-876.144) (-874.789) [-878.472] (-876.657) -- 0:00:38
      354000 -- (-877.478) [-879.635] (-876.906) (-877.091) * [-874.379] (-876.670) (-876.188) (-877.298) -- 0:00:38
      354500 -- (-875.229) [-875.335] (-875.252) (-875.507) * [-875.663] (-877.990) (-874.797) (-874.348) -- 0:00:38
      355000 -- (-875.420) (-875.178) (-874.818) [-875.780] * (-874.634) (-875.408) (-877.115) [-874.558] -- 0:00:38

      Average standard deviation of split frequencies: 0.011762

      355500 -- [-875.401] (-876.921) (-874.099) (-874.323) * (-876.295) (-874.365) [-876.072] (-873.711) -- 0:00:39
      356000 -- [-876.519] (-877.945) (-873.713) (-874.974) * [-874.704] (-876.487) (-876.395) (-875.953) -- 0:00:39
      356500 -- [-875.706] (-874.875) (-873.936) (-875.416) * (-876.188) (-878.063) [-877.868] (-876.323) -- 0:00:39
      357000 -- (-875.370) (-875.677) [-875.338] (-875.531) * [-877.497] (-879.154) (-877.590) (-877.317) -- 0:00:39
      357500 -- (-876.153) (-876.025) (-874.593) [-874.278] * (-875.170) (-879.028) (-876.098) [-876.747] -- 0:00:39
      358000 -- (-877.768) [-874.065] (-879.389) (-875.689) * [-874.565] (-880.413) (-874.815) (-876.002) -- 0:00:39
      358500 -- (-874.676) (-873.948) (-875.859) [-875.428] * (-878.750) (-878.010) [-873.448] (-877.571) -- 0:00:39
      359000 -- (-874.616) (-876.004) [-875.199] (-876.086) * (-879.841) (-874.226) [-874.180] (-877.554) -- 0:00:39
      359500 -- (-873.959) (-877.186) (-874.384) [-875.104] * (-876.402) [-873.600] (-876.576) (-874.485) -- 0:00:39
      360000 -- (-874.064) (-878.410) [-874.382] (-877.977) * (-877.097) [-876.305] (-874.965) (-877.096) -- 0:00:39

      Average standard deviation of split frequencies: 0.010918

      360500 -- (-875.715) (-880.778) [-874.182] (-876.895) * (-878.551) (-875.815) [-875.688] (-877.330) -- 0:00:39
      361000 -- (-876.169) [-874.639] (-875.335) (-877.312) * (-877.751) (-876.276) (-877.382) [-880.853] -- 0:00:38
      361500 -- [-875.969] (-876.485) (-874.011) (-875.725) * (-878.589) (-877.092) [-874.943] (-874.350) -- 0:00:38
      362000 -- (-878.143) [-877.218] (-873.788) (-874.868) * (-876.660) (-877.676) [-875.481] (-876.729) -- 0:00:38
      362500 -- (-876.586) [-876.915] (-873.766) (-875.745) * [-875.610] (-876.544) (-874.982) (-875.673) -- 0:00:38
      363000 -- (-875.040) (-876.520) (-875.741) [-877.292] * [-874.033] (-875.968) (-874.307) (-875.073) -- 0:00:38
      363500 -- (-875.211) (-875.918) (-874.837) [-877.183] * [-874.073] (-875.247) (-874.928) (-873.919) -- 0:00:38
      364000 -- (-876.710) (-874.652) (-879.066) [-875.919] * (-873.911) (-873.847) [-874.896] (-874.630) -- 0:00:38
      364500 -- (-874.766) [-875.345] (-875.223) (-876.412) * (-880.002) [-874.216] (-874.017) (-874.824) -- 0:00:38
      365000 -- (-876.125) (-875.684) (-874.562) [-877.024] * (-876.150) (-875.605) [-875.774] (-875.929) -- 0:00:38

      Average standard deviation of split frequencies: 0.010455

      365500 -- [-875.451] (-879.178) (-875.579) (-874.553) * (-877.995) (-874.291) [-877.311] (-877.825) -- 0:00:38
      366000 -- (-874.936) [-875.866] (-878.388) (-875.437) * (-877.435) (-876.492) (-876.360) [-877.381] -- 0:00:38
      366500 -- (-874.406) (-875.826) [-874.712] (-874.577) * (-875.672) [-875.285] (-878.794) (-876.831) -- 0:00:38
      367000 -- (-874.942) (-878.860) (-878.608) [-874.324] * (-875.561) (-874.389) [-875.430] (-875.321) -- 0:00:37
      367500 -- (-880.005) (-875.920) [-875.433] (-874.160) * (-878.043) (-874.423) (-874.004) [-873.814] -- 0:00:37
      368000 -- (-878.231) (-874.439) (-880.619) [-873.766] * (-876.316) [-874.611] (-874.614) (-874.186) -- 0:00:37
      368500 -- (-874.565) (-875.968) [-874.632] (-875.940) * (-876.367) (-873.680) (-874.402) [-874.645] -- 0:00:37
      369000 -- (-879.104) (-874.930) (-875.223) [-876.171] * (-876.771) (-875.867) [-876.783] (-874.201) -- 0:00:37
      369500 -- (-876.129) [-876.524] (-874.947) (-876.187) * [-878.781] (-874.398) (-875.029) (-876.911) -- 0:00:37
      370000 -- (-877.919) (-875.836) [-876.801] (-879.976) * (-877.111) (-875.660) [-878.538] (-876.283) -- 0:00:37

      Average standard deviation of split frequencies: 0.010249

      370500 -- (-877.920) (-874.716) [-873.587] (-873.793) * (-876.747) (-877.221) (-878.991) [-875.664] -- 0:00:37
      371000 -- (-874.085) (-877.886) (-877.117) [-875.283] * [-875.024] (-874.445) (-876.964) (-876.595) -- 0:00:37
      371500 -- (-875.771) (-875.614) (-877.554) [-876.561] * (-874.069) (-877.929) (-876.794) [-876.729] -- 0:00:37
      372000 -- (-874.481) (-876.444) (-877.019) [-877.570] * (-874.175) (-876.262) [-874.030] (-874.051) -- 0:00:38
      372500 -- (-880.003) [-874.351] (-875.415) (-876.900) * (-876.733) (-874.208) (-875.747) [-875.833] -- 0:00:38
      373000 -- (-876.669) (-875.101) (-875.775) [-879.485] * (-875.648) [-874.838] (-875.795) (-874.724) -- 0:00:38
      373500 -- [-874.941] (-873.647) (-877.153) (-874.372) * (-878.799) (-875.073) [-877.239] (-877.252) -- 0:00:38
      374000 -- (-874.616) [-873.525] (-875.697) (-874.707) * (-876.862) (-877.881) [-877.901] (-878.873) -- 0:00:38
      374500 -- (-875.045) [-876.478] (-875.605) (-875.604) * (-878.302) (-875.642) [-876.141] (-873.567) -- 0:00:38
      375000 -- (-874.394) (-874.063) (-874.952) [-874.785] * (-874.399) (-875.654) (-876.218) [-874.671] -- 0:00:38

      Average standard deviation of split frequencies: 0.009882

      375500 -- [-875.189] (-875.575) (-874.310) (-875.837) * (-875.217) (-874.533) (-876.220) [-873.851] -- 0:00:38
      376000 -- [-874.466] (-874.894) (-876.761) (-875.065) * (-873.573) (-873.818) (-880.712) [-873.905] -- 0:00:38
      376500 -- (-877.396) (-877.093) (-875.343) [-874.243] * (-873.645) (-874.124) [-874.590] (-874.720) -- 0:00:38
      377000 -- (-875.495) (-876.086) (-874.005) [-874.254] * (-874.667) (-874.777) [-873.729] (-875.945) -- 0:00:38
      377500 -- (-874.576) (-879.028) [-873.769] (-875.364) * (-873.404) (-876.601) (-876.039) [-875.831] -- 0:00:37
      378000 -- (-875.624) [-877.664] (-875.955) (-877.469) * (-873.857) (-877.980) (-875.342) [-877.359] -- 0:00:37
      378500 -- (-875.523) (-881.916) (-875.939) [-877.550] * (-875.058) (-878.100) [-873.574] (-880.251) -- 0:00:37
      379000 -- (-879.191) (-877.109) [-876.297] (-877.711) * (-874.649) [-878.167] (-877.238) (-875.422) -- 0:00:37
      379500 -- (-877.467) (-875.778) [-873.825] (-875.463) * [-873.597] (-875.171) (-873.646) (-875.799) -- 0:00:37
      380000 -- (-874.462) (-876.582) (-876.003) [-874.666] * (-874.475) [-875.409] (-878.889) (-873.736) -- 0:00:37

      Average standard deviation of split frequencies: 0.011072

      380500 -- (-877.869) [-874.272] (-874.663) (-875.496) * [-876.511] (-875.131) (-875.829) (-874.503) -- 0:00:37
      381000 -- [-874.511] (-875.455) (-875.236) (-879.742) * (-876.572) [-876.135] (-874.781) (-878.683) -- 0:00:37
      381500 -- [-879.530] (-874.807) (-873.915) (-874.607) * (-874.014) [-878.923] (-875.237) (-875.043) -- 0:00:37
      382000 -- (-876.572) (-877.559) [-875.608] (-880.181) * [-873.710] (-874.418) (-876.231) (-876.363) -- 0:00:37
      382500 -- (-877.227) (-876.924) [-874.621] (-878.709) * (-875.557) (-873.991) (-877.716) [-877.768] -- 0:00:37
      383000 -- (-874.390) [-875.719] (-878.122) (-875.158) * (-878.549) (-879.537) [-879.430] (-879.842) -- 0:00:37
      383500 -- (-876.806) (-876.591) (-874.937) [-877.306] * (-875.708) [-877.952] (-878.871) (-879.259) -- 0:00:36
      384000 -- (-882.459) (-876.377) [-875.163] (-875.652) * (-876.049) (-877.962) (-882.461) [-876.061] -- 0:00:36
      384500 -- (-877.513) (-875.097) [-874.322] (-879.463) * (-874.789) [-876.238] (-877.112) (-880.869) -- 0:00:36
      385000 -- (-873.540) (-876.644) [-874.827] (-876.750) * [-875.021] (-876.687) (-874.943) (-873.946) -- 0:00:36

      Average standard deviation of split frequencies: 0.011494

      385500 -- [-875.525] (-877.697) (-875.921) (-877.752) * [-875.179] (-880.674) (-874.784) (-874.029) -- 0:00:36
      386000 -- (-873.754) [-874.756] (-877.257) (-874.768) * (-875.713) (-878.661) (-877.840) [-877.469] -- 0:00:36
      386500 -- (-873.668) (-874.863) [-876.041] (-878.731) * (-875.684) [-874.875] (-874.915) (-875.011) -- 0:00:36
      387000 -- [-874.294] (-874.524) (-875.035) (-876.938) * (-875.876) (-876.827) [-875.986] (-874.377) -- 0:00:36
      387500 -- (-875.494) (-878.007) (-879.189) [-874.782] * (-874.681) (-875.915) [-875.851] (-875.029) -- 0:00:36
      388000 -- [-874.739] (-874.629) (-880.156) (-876.658) * [-874.460] (-874.354) (-877.500) (-874.102) -- 0:00:36
      388500 -- (-874.368) [-877.868] (-874.243) (-875.001) * (-874.679) (-874.289) [-875.975] (-876.545) -- 0:00:36
      389000 -- (-874.338) [-876.384] (-874.483) (-876.142) * [-874.340] (-874.980) (-875.392) (-874.739) -- 0:00:37
      389500 -- (-878.581) (-875.413) [-874.389] (-879.606) * (-875.226) [-875.324] (-875.635) (-875.244) -- 0:00:37
      390000 -- (-874.522) (-878.041) (-880.189) [-873.849] * (-875.704) (-876.488) (-875.837) [-875.156] -- 0:00:37

      Average standard deviation of split frequencies: 0.011765

      390500 -- (-873.912) (-874.579) [-875.192] (-875.170) * [-875.569] (-877.478) (-875.416) (-878.748) -- 0:00:37
      391000 -- [-876.021] (-874.128) (-874.184) (-874.307) * [-875.702] (-874.486) (-875.414) (-874.281) -- 0:00:37
      391500 -- (-873.388) (-875.625) [-876.891] (-877.264) * (-874.205) [-874.478] (-876.286) (-875.309) -- 0:00:37
      392000 -- (-875.334) (-874.506) (-875.133) [-873.888] * [-874.478] (-874.802) (-874.620) (-877.318) -- 0:00:37
      392500 -- (-875.903) [-874.346] (-874.138) (-874.295) * (-877.537) (-876.188) [-876.383] (-875.424) -- 0:00:37
      393000 -- (-875.867) [-876.402] (-873.415) (-874.787) * (-875.614) (-875.522) (-877.286) [-874.517] -- 0:00:37
      393500 -- (-875.522) [-879.461] (-874.818) (-875.150) * (-878.361) [-875.796] (-874.889) (-874.788) -- 0:00:36
      394000 -- (-875.488) [-874.571] (-873.833) (-875.096) * (-878.190) [-875.958] (-874.048) (-875.609) -- 0:00:36
      394500 -- [-878.001] (-874.630) (-877.785) (-874.019) * (-879.147) (-876.006) (-875.461) [-875.670] -- 0:00:36
      395000 -- [-876.637] (-876.136) (-876.124) (-876.183) * [-879.352] (-876.112) (-873.906) (-876.751) -- 0:00:36

      Average standard deviation of split frequencies: 0.011160

      395500 -- (-875.445) (-880.129) (-876.427) [-876.421] * (-876.708) [-875.984] (-875.485) (-876.543) -- 0:00:36
      396000 -- (-877.879) (-879.593) [-875.479] (-875.545) * (-878.668) [-876.808] (-875.333) (-877.534) -- 0:00:36
      396500 -- [-878.798] (-880.750) (-875.234) (-874.771) * [-876.907] (-876.880) (-876.840) (-877.348) -- 0:00:36
      397000 -- (-881.529) (-878.852) [-873.959] (-874.920) * (-875.606) (-875.286) [-874.545] (-875.141) -- 0:00:36
      397500 -- (-874.870) (-874.588) (-875.985) [-876.873] * (-875.005) [-874.237] (-874.512) (-876.136) -- 0:00:36
      398000 -- [-876.695] (-874.369) (-875.477) (-877.463) * [-875.200] (-876.869) (-877.421) (-877.019) -- 0:00:36
      398500 -- (-875.229) (-874.049) (-876.690) [-877.720] * [-875.636] (-878.334) (-880.096) (-875.730) -- 0:00:36
      399000 -- (-875.108) [-875.181] (-879.534) (-874.821) * [-874.274] (-881.844) (-877.114) (-876.040) -- 0:00:36
      399500 -- (-875.409) [-874.979] (-880.888) (-875.771) * (-874.765) (-874.761) (-877.301) [-873.888] -- 0:00:36
      400000 -- (-876.129) [-879.314] (-873.975) (-876.423) * [-876.001] (-876.231) (-876.459) (-876.298) -- 0:00:36

      Average standard deviation of split frequencies: 0.011030

      400500 -- (-878.839) (-878.297) (-874.791) [-874.425] * [-878.835] (-876.249) (-880.390) (-877.512) -- 0:00:35
      401000 -- (-874.590) (-874.132) [-879.071] (-877.027) * [-877.858] (-875.072) (-879.045) (-877.177) -- 0:00:35
      401500 -- [-874.898] (-879.828) (-880.830) (-876.371) * [-875.798] (-875.822) (-877.179) (-873.867) -- 0:00:35
      402000 -- [-874.890] (-874.835) (-877.108) (-876.237) * (-874.180) (-875.077) [-874.381] (-878.051) -- 0:00:35
      402500 -- [-875.721] (-874.926) (-878.924) (-878.867) * (-876.038) [-875.305] (-874.327) (-876.248) -- 0:00:35
      403000 -- (-875.232) (-875.184) (-877.322) [-875.922] * (-874.494) (-873.701) [-874.643] (-877.543) -- 0:00:35
      403500 -- [-875.871] (-877.168) (-878.044) (-876.059) * [-874.447] (-874.853) (-875.915) (-878.173) -- 0:00:35
      404000 -- (-877.624) (-878.516) (-876.498) [-874.525] * [-874.757] (-876.046) (-873.645) (-876.433) -- 0:00:35
      404500 -- (-876.249) (-877.833) (-876.066) [-874.817] * (-874.684) (-877.763) (-875.543) [-875.170] -- 0:00:35
      405000 -- (-876.763) (-874.072) (-874.304) [-875.003] * [-875.824] (-879.371) (-877.364) (-875.176) -- 0:00:35

      Average standard deviation of split frequencies: 0.011466

      405500 -- (-876.261) (-878.376) (-875.002) [-876.986] * (-877.235) (-880.365) (-878.191) [-873.602] -- 0:00:36
      406000 -- [-875.540] (-876.416) (-877.097) (-878.046) * [-876.132] (-875.023) (-876.425) (-877.945) -- 0:00:36
      406500 -- (-875.337) (-874.111) [-876.406] (-875.104) * (-874.618) (-874.018) [-874.606] (-879.335) -- 0:00:36
      407000 -- (-875.063) [-876.472] (-874.174) (-875.596) * (-874.999) (-874.743) [-874.376] (-875.645) -- 0:00:36
      407500 -- (-876.495) (-877.006) (-876.006) [-875.249] * (-877.915) [-873.733] (-874.907) (-877.472) -- 0:00:36
      408000 -- (-875.214) (-876.734) [-876.154] (-875.989) * (-875.207) (-877.331) [-874.733] (-875.428) -- 0:00:36
      408500 -- (-878.037) (-876.639) (-876.744) [-876.402] * (-875.581) [-875.866] (-875.789) (-878.124) -- 0:00:36
      409000 -- (-876.640) [-875.506] (-875.688) (-876.989) * (-874.245) (-874.881) [-874.708] (-879.086) -- 0:00:36
      409500 -- (-881.839) [-875.733] (-882.769) (-876.537) * (-875.991) (-876.477) [-877.257] (-877.787) -- 0:00:36
      410000 -- (-875.433) [-878.183] (-877.190) (-875.727) * (-874.065) [-877.302] (-874.132) (-878.782) -- 0:00:35

      Average standard deviation of split frequencies: 0.011479

      410500 -- (-876.716) (-876.750) (-876.371) [-874.360] * (-874.907) (-876.426) (-874.925) [-878.164] -- 0:00:35
      411000 -- (-877.020) [-880.472] (-876.823) (-879.493) * (-875.582) (-878.647) (-874.001) [-878.351] -- 0:00:35
      411500 -- (-876.308) [-880.474] (-875.901) (-876.966) * (-878.514) (-875.140) (-873.730) [-875.592] -- 0:00:35
      412000 -- (-877.769) [-879.259] (-874.461) (-874.615) * [-881.619] (-874.591) (-873.667) (-876.460) -- 0:00:35
      412500 -- [-879.778] (-883.057) (-874.089) (-877.342) * (-876.479) [-876.507] (-875.060) (-876.411) -- 0:00:35
      413000 -- (-877.084) (-875.379) (-876.970) [-875.832] * (-876.300) (-874.718) [-874.266] (-875.951) -- 0:00:35
      413500 -- (-876.160) (-875.630) [-873.714] (-874.798) * (-875.821) [-875.105] (-874.511) (-875.288) -- 0:00:35
      414000 -- (-875.030) [-873.967] (-873.761) (-875.086) * (-874.836) (-875.690) (-874.513) [-874.409] -- 0:00:35
      414500 -- (-874.381) (-875.744) [-875.348] (-874.989) * (-875.763) [-875.544] (-874.297) (-874.328) -- 0:00:35
      415000 -- (-874.438) (-877.128) [-881.602] (-873.638) * [-873.902] (-876.616) (-875.358) (-875.202) -- 0:00:35

      Average standard deviation of split frequencies: 0.011686

      415500 -- (-874.789) (-876.059) (-877.790) [-874.263] * (-876.899) (-876.147) (-877.526) [-877.531] -- 0:00:35
      416000 -- (-875.690) (-874.367) [-874.754] (-875.233) * (-875.103) (-876.946) (-879.882) [-878.375] -- 0:00:35
      416500 -- [-874.520] (-876.350) (-876.516) (-878.309) * (-878.899) (-877.813) (-880.284) [-878.480] -- 0:00:35
      417000 -- (-875.582) (-876.484) (-877.744) [-876.721] * (-874.020) (-876.361) (-877.736) [-875.454] -- 0:00:34
      417500 -- (-876.547) (-877.339) [-875.839] (-875.791) * (-874.257) [-875.447] (-874.421) (-874.800) -- 0:00:34
      418000 -- (-878.154) (-876.445) (-876.171) [-875.138] * [-877.661] (-877.986) (-874.185) (-878.498) -- 0:00:34
      418500 -- (-878.287) [-879.826] (-874.711) (-881.100) * [-875.914] (-878.886) (-875.560) (-878.191) -- 0:00:34
      419000 -- (-877.302) [-877.496] (-877.392) (-875.613) * (-875.342) (-874.931) [-875.236] (-874.748) -- 0:00:34
      419500 -- [-876.555] (-875.305) (-874.651) (-873.832) * (-874.546) (-876.843) (-873.780) [-874.711] -- 0:00:34
      420000 -- (-877.561) (-876.768) [-875.493] (-875.369) * (-875.045) [-876.763] (-877.862) (-876.575) -- 0:00:34

      Average standard deviation of split frequencies: 0.010506

      420500 -- [-873.670] (-877.043) (-881.232) (-873.742) * (-877.992) [-875.722] (-875.994) (-873.730) -- 0:00:34
      421000 -- [-874.359] (-877.448) (-876.954) (-874.956) * (-877.080) (-873.745) [-874.570] (-874.669) -- 0:00:34
      421500 -- (-882.933) (-874.840) [-876.629] (-876.656) * [-875.071] (-874.595) (-873.990) (-877.021) -- 0:00:34
      422000 -- (-876.738) [-874.438] (-875.917) (-874.486) * (-876.798) (-874.866) [-874.338] (-880.112) -- 0:00:35
      422500 -- (-875.938) [-875.063] (-879.901) (-874.925) * [-876.046] (-877.210) (-877.422) (-878.767) -- 0:00:35
      423000 -- [-876.879] (-874.117) (-875.294) (-877.674) * (-876.386) (-874.530) (-875.277) [-876.506] -- 0:00:35
      423500 -- (-875.340) (-876.469) [-875.239] (-875.447) * (-874.842) [-874.140] (-875.784) (-878.607) -- 0:00:35
      424000 -- (-875.001) (-879.387) [-876.269] (-879.163) * (-875.854) (-876.234) (-876.250) [-875.151] -- 0:00:35
      424500 -- [-876.607] (-878.655) (-876.709) (-874.830) * (-875.070) [-875.507] (-876.424) (-878.377) -- 0:00:35
      425000 -- (-878.070) (-875.866) (-876.440) [-875.210] * (-879.324) [-874.436] (-874.047) (-874.373) -- 0:00:35

      Average standard deviation of split frequencies: 0.010089

      425500 -- (-874.718) (-875.249) [-875.194] (-874.217) * (-879.416) [-874.078] (-879.778) (-875.314) -- 0:00:35
      426000 -- (-874.692) (-876.399) [-875.632] (-881.867) * (-877.560) [-874.712] (-877.264) (-874.405) -- 0:00:35
      426500 -- (-874.610) (-877.205) [-873.537] (-879.417) * (-877.405) (-881.793) [-875.427] (-874.125) -- 0:00:34
      427000 -- (-874.929) (-876.245) [-874.951] (-875.347) * (-875.350) (-876.754) (-874.406) [-876.030] -- 0:00:34
      427500 -- [-874.078] (-876.508) (-874.258) (-875.314) * (-877.353) (-875.823) (-875.855) [-875.121] -- 0:00:34
      428000 -- (-874.121) (-874.549) [-876.046] (-877.864) * (-875.424) (-874.838) (-876.459) [-876.648] -- 0:00:34
      428500 -- (-874.353) (-877.000) [-875.321] (-874.801) * (-877.367) (-875.042) [-873.708] (-874.097) -- 0:00:34
      429000 -- (-878.734) (-879.874) [-878.546] (-875.590) * (-875.541) [-876.038] (-873.995) (-875.563) -- 0:00:34
      429500 -- (-879.761) (-877.004) (-874.593) [-875.783] * [-875.160] (-876.622) (-875.196) (-875.874) -- 0:00:34
      430000 -- [-876.296] (-875.088) (-874.134) (-876.631) * [-876.574] (-877.250) (-876.139) (-883.892) -- 0:00:34

      Average standard deviation of split frequencies: 0.010431

      430500 -- (-876.381) (-876.480) [-874.715] (-877.968) * (-875.865) [-876.579] (-874.723) (-875.444) -- 0:00:34
      431000 -- (-875.310) (-875.507) [-874.320] (-879.684) * (-879.189) [-879.298] (-873.722) (-876.817) -- 0:00:34
      431500 -- (-875.734) (-875.544) [-876.531] (-881.932) * (-882.938) [-878.751] (-874.481) (-874.018) -- 0:00:34
      432000 -- [-874.981] (-873.491) (-874.622) (-875.852) * (-877.593) (-874.118) (-875.111) [-874.544] -- 0:00:34
      432500 -- (-875.016) (-873.608) [-875.726] (-877.687) * (-877.116) (-875.418) (-875.948) [-874.311] -- 0:00:34
      433000 -- (-874.228) [-873.732] (-874.666) (-875.870) * [-875.273] (-874.822) (-873.786) (-875.021) -- 0:00:34
      433500 -- (-873.854) [-874.756] (-874.663) (-877.434) * (-875.168) [-876.143] (-875.696) (-877.008) -- 0:00:33
      434000 -- (-874.810) (-874.388) [-879.405] (-875.769) * (-876.890) [-876.161] (-875.140) (-875.633) -- 0:00:33
      434500 -- (-876.234) (-874.830) (-879.306) [-876.006] * [-875.127] (-877.672) (-876.693) (-880.021) -- 0:00:33
      435000 -- (-876.941) [-874.056] (-878.362) (-878.649) * [-875.824] (-874.083) (-874.031) (-874.926) -- 0:00:33

      Average standard deviation of split frequencies: 0.010001

      435500 -- [-875.552] (-878.346) (-878.146) (-876.268) * (-874.342) [-875.391] (-873.679) (-877.105) -- 0:00:33
      436000 -- [-875.429] (-875.918) (-875.290) (-877.144) * (-875.187) (-875.227) [-874.239] (-876.179) -- 0:00:33
      436500 -- [-882.115] (-875.253) (-874.987) (-875.358) * (-874.841) [-874.851] (-880.114) (-874.911) -- 0:00:33
      437000 -- (-877.469) (-874.181) [-875.123] (-875.896) * (-875.939) (-877.688) [-877.082] (-874.550) -- 0:00:33
      437500 -- (-873.914) (-873.808) (-875.641) [-874.949] * (-879.525) (-876.357) [-875.062] (-877.094) -- 0:00:33
      438000 -- (-874.234) (-873.428) (-875.292) [-879.005] * (-881.666) (-878.759) (-875.320) [-875.741] -- 0:00:33
      438500 -- (-875.354) [-874.439] (-876.476) (-874.718) * (-878.051) (-878.108) [-876.274] (-874.172) -- 0:00:34
      439000 -- (-875.861) (-874.521) (-875.052) [-875.002] * (-875.303) (-877.833) (-875.155) [-873.388] -- 0:00:34
      439500 -- (-875.889) (-876.217) [-873.904] (-876.010) * (-875.303) (-877.163) [-875.552] (-873.696) -- 0:00:34
      440000 -- (-876.633) (-875.578) [-875.882] (-876.314) * (-876.048) (-876.368) (-876.350) [-874.279] -- 0:00:34

      Average standard deviation of split frequencies: 0.009942

      440500 -- (-875.563) (-875.564) [-876.330] (-874.345) * (-880.431) [-874.830] (-876.316) (-876.590) -- 0:00:34
      441000 -- [-875.116] (-875.040) (-876.638) (-874.088) * (-876.783) (-874.718) (-877.091) [-875.183] -- 0:00:34
      441500 -- [-874.469] (-874.814) (-878.252) (-883.801) * [-875.363] (-874.403) (-875.693) (-875.386) -- 0:00:34
      442000 -- (-875.813) [-875.193] (-878.148) (-879.121) * [-874.229] (-874.160) (-875.050) (-875.224) -- 0:00:34
      442500 -- (-877.263) [-875.945] (-878.836) (-877.105) * (-874.546) [-877.063] (-878.503) (-874.804) -- 0:00:34
      443000 -- (-876.214) (-875.954) (-879.824) [-876.900] * [-878.238] (-877.296) (-878.653) (-874.490) -- 0:00:33
      443500 -- (-876.939) (-875.093) (-879.885) [-875.533] * (-875.807) (-874.470) [-874.714] (-873.694) -- 0:00:33
      444000 -- [-875.055] (-875.710) (-877.820) (-873.780) * (-877.731) (-874.924) [-875.044] (-875.300) -- 0:00:33
      444500 -- (-877.963) (-873.948) [-875.345] (-874.456) * (-873.587) [-874.989] (-876.788) (-873.967) -- 0:00:33
      445000 -- (-875.938) (-876.064) [-876.450] (-875.647) * (-874.079) [-875.949] (-877.624) (-875.573) -- 0:00:33

      Average standard deviation of split frequencies: 0.009571

      445500 -- (-875.996) (-874.834) (-874.383) [-875.500] * (-875.378) (-875.884) [-876.803] (-876.008) -- 0:00:33
      446000 -- (-881.860) (-874.556) [-874.972] (-878.447) * [-875.134] (-876.630) (-879.280) (-876.312) -- 0:00:33
      446500 -- (-879.730) [-874.525] (-876.226) (-876.329) * (-873.941) (-875.579) [-874.956] (-875.963) -- 0:00:33
      447000 -- [-879.446] (-875.837) (-874.950) (-876.885) * (-874.115) (-874.402) [-875.407] (-875.460) -- 0:00:33
      447500 -- [-874.923] (-875.214) (-877.797) (-880.717) * [-873.766] (-876.585) (-878.368) (-874.821) -- 0:00:33
      448000 -- [-873.846] (-874.174) (-875.709) (-876.734) * [-877.618] (-877.388) (-877.393) (-875.481) -- 0:00:33
      448500 -- [-875.254] (-878.409) (-876.210) (-875.448) * (-876.075) (-876.194) (-877.421) [-874.262] -- 0:00:33
      449000 -- (-876.925) (-878.091) [-875.049] (-876.238) * (-875.508) (-877.272) [-875.865] (-876.644) -- 0:00:33
      449500 -- (-878.095) (-877.035) (-877.029) [-877.880] * (-879.422) [-876.036] (-878.280) (-875.066) -- 0:00:33
      450000 -- [-874.905] (-875.730) (-879.812) (-875.675) * (-874.053) (-877.449) [-877.282] (-876.935) -- 0:00:33

      Average standard deviation of split frequencies: 0.009906

      450500 -- (-878.318) (-876.090) [-878.605] (-875.282) * (-874.486) [-875.550] (-876.680) (-875.179) -- 0:00:32
      451000 -- (-875.215) (-874.747) [-877.851] (-878.429) * (-876.588) (-874.212) [-875.520] (-878.807) -- 0:00:32
      451500 -- (-877.685) (-876.876) [-875.796] (-876.198) * (-876.334) (-876.438) (-877.669) [-874.214] -- 0:00:32
      452000 -- [-873.778] (-876.779) (-874.726) (-879.425) * (-875.921) (-878.297) (-876.261) [-874.322] -- 0:00:32
      452500 -- [-873.447] (-878.777) (-875.400) (-874.388) * (-877.991) (-876.337) [-874.711] (-874.941) -- 0:00:32
      453000 -- (-873.853) [-877.079] (-877.160) (-877.225) * (-880.239) (-875.796) [-874.986] (-875.274) -- 0:00:32
      453500 -- [-874.675] (-877.093) (-878.559) (-879.884) * (-878.348) [-882.666] (-877.514) (-877.397) -- 0:00:32
      454000 -- (-877.582) (-875.881) (-875.710) [-877.875] * (-876.689) [-877.931] (-876.023) (-878.771) -- 0:00:32
      454500 -- [-875.962] (-879.148) (-876.659) (-877.003) * (-878.051) [-878.067] (-875.461) (-873.757) -- 0:00:32
      455000 -- (-877.250) (-875.621) (-877.260) [-876.164] * (-876.486) (-878.338) (-874.593) [-874.802] -- 0:00:32

      Average standard deviation of split frequencies: 0.010095

      455500 -- [-877.436] (-876.191) (-877.322) (-876.032) * [-878.607] (-877.297) (-877.367) (-874.817) -- 0:00:33
      456000 -- (-876.625) (-876.375) (-874.553) [-876.274] * (-877.986) [-876.321] (-876.536) (-876.649) -- 0:00:33
      456500 -- (-874.042) (-876.814) [-875.551] (-877.613) * (-873.696) (-875.903) (-875.814) [-875.112] -- 0:00:33
      457000 -- (-874.060) (-878.111) (-874.580) [-874.544] * (-873.697) (-874.003) [-874.281] (-876.434) -- 0:00:33
      457500 -- (-875.095) (-875.024) [-876.511] (-878.921) * [-874.325] (-875.790) (-875.474) (-874.534) -- 0:00:33
      458000 -- [-875.224] (-874.538) (-877.079) (-879.420) * (-877.752) (-876.637) [-873.887] (-876.771) -- 0:00:33
      458500 -- [-873.707] (-874.164) (-875.668) (-875.365) * (-877.809) (-875.921) (-874.025) [-875.185] -- 0:00:33
      459000 -- (-875.012) (-877.463) [-874.778] (-874.217) * (-875.817) (-875.379) [-879.121] (-876.314) -- 0:00:33
      459500 -- (-875.173) (-874.248) (-875.438) [-873.690] * (-874.469) (-877.646) (-875.985) [-876.241] -- 0:00:32
      460000 -- (-873.812) [-874.139] (-875.500) (-874.494) * (-874.180) [-873.507] (-877.942) (-877.333) -- 0:00:32

      Average standard deviation of split frequencies: 0.010041

      460500 -- [-875.454] (-873.498) (-875.282) (-875.019) * (-874.213) (-873.858) (-874.582) [-875.823] -- 0:00:32
      461000 -- (-878.789) (-874.837) (-873.635) [-875.259] * (-873.806) [-873.793] (-875.337) (-875.502) -- 0:00:32
      461500 -- [-877.066] (-876.274) (-873.635) (-875.842) * (-875.180) [-874.941] (-875.520) (-873.947) -- 0:00:32
      462000 -- (-877.210) [-874.251] (-874.122) (-876.298) * [-875.011] (-876.914) (-875.052) (-873.626) -- 0:00:32
      462500 -- (-880.335) (-875.779) [-873.886] (-880.567) * (-880.400) [-875.093] (-878.577) (-874.581) -- 0:00:32
      463000 -- (-876.509) [-877.341] (-877.815) (-874.809) * [-873.806] (-873.841) (-877.580) (-877.031) -- 0:00:32
      463500 -- (-874.198) (-880.309) [-876.964] (-880.111) * (-876.616) [-875.378] (-875.044) (-874.988) -- 0:00:32
      464000 -- (-874.111) (-874.261) (-877.376) [-874.109] * [-875.596] (-876.337) (-874.851) (-876.118) -- 0:00:32
      464500 -- (-876.083) (-878.076) (-877.628) [-876.224] * [-875.348] (-874.708) (-875.013) (-875.183) -- 0:00:32
      465000 -- (-876.063) [-877.121] (-877.782) (-873.741) * (-878.392) [-875.363] (-875.837) (-876.864) -- 0:00:32

      Average standard deviation of split frequencies: 0.009164

      465500 -- (-875.816) (-875.358) (-875.401) [-874.464] * [-875.723] (-875.594) (-874.815) (-875.260) -- 0:00:32
      466000 -- [-874.239] (-879.730) (-874.419) (-879.057) * (-880.810) [-874.707] (-874.508) (-878.076) -- 0:00:32
      466500 -- (-875.174) (-874.350) (-874.954) [-874.864] * (-880.377) [-877.791] (-874.691) (-878.784) -- 0:00:32
      467000 -- (-877.595) (-876.978) (-875.677) [-877.767] * (-879.612) [-877.088] (-877.130) (-883.472) -- 0:00:31
      467500 -- (-875.487) (-875.089) [-875.466] (-875.675) * (-879.149) (-878.009) (-877.196) [-877.351] -- 0:00:31
      468000 -- (-875.686) (-875.140) [-875.840] (-874.433) * (-875.176) (-875.058) [-874.610] (-876.565) -- 0:00:31
      468500 -- (-876.547) [-875.799] (-875.445) (-875.517) * [-873.896] (-875.058) (-873.792) (-877.119) -- 0:00:31
      469000 -- (-875.467) (-875.150) [-875.623] (-876.570) * (-877.631) (-875.349) (-875.485) [-874.695] -- 0:00:31
      469500 -- (-877.369) [-875.980] (-875.503) (-880.874) * (-874.440) (-874.783) (-875.882) [-878.301] -- 0:00:31
      470000 -- (-878.020) [-877.911] (-878.082) (-881.211) * [-875.997] (-875.239) (-878.015) (-878.964) -- 0:00:31

      Average standard deviation of split frequencies: 0.008792

      470500 -- [-876.867] (-879.150) (-879.037) (-878.208) * (-873.674) (-874.169) (-873.344) [-874.740] -- 0:00:31
      471000 -- (-878.125) (-874.253) [-876.241] (-874.255) * [-875.697] (-878.120) (-874.154) (-876.791) -- 0:00:31
      471500 -- [-877.045] (-878.360) (-874.149) (-874.907) * (-874.829) [-876.678] (-875.568) (-875.791) -- 0:00:31
      472000 -- [-875.242] (-875.920) (-876.604) (-876.334) * [-876.477] (-874.832) (-874.744) (-879.122) -- 0:00:32
      472500 -- (-874.743) [-876.738] (-880.008) (-875.766) * [-874.698] (-874.278) (-880.057) (-879.257) -- 0:00:32
      473000 -- (-875.455) (-875.729) [-875.729] (-875.233) * (-875.674) [-874.822] (-876.297) (-875.770) -- 0:00:32
      473500 -- [-875.045] (-877.101) (-876.463) (-878.929) * (-875.334) [-874.737] (-874.753) (-880.602) -- 0:00:32
      474000 -- (-880.504) [-874.454] (-875.469) (-879.117) * [-877.013] (-874.942) (-875.550) (-874.059) -- 0:00:32
      474500 -- (-887.397) (-875.334) (-877.040) [-876.770] * (-876.368) (-875.319) [-874.062] (-875.259) -- 0:00:32
      475000 -- (-877.671) (-876.021) [-875.674] (-874.976) * (-874.217) (-875.206) [-875.663] (-876.475) -- 0:00:32

      Average standard deviation of split frequencies: 0.009298

      475500 -- (-881.139) (-879.148) [-875.914] (-874.450) * (-877.932) (-874.031) [-874.587] (-875.898) -- 0:00:31
      476000 -- (-874.599) (-874.315) [-875.866] (-877.042) * (-875.072) (-873.843) (-882.314) [-877.736] -- 0:00:31
      476500 -- [-874.607] (-874.786) (-877.265) (-874.870) * [-875.701] (-875.302) (-878.031) (-877.940) -- 0:00:31
      477000 -- (-876.595) (-877.862) (-874.370) [-874.477] * (-874.586) [-877.248] (-876.434) (-877.055) -- 0:00:31
      477500 -- (-877.184) (-877.176) [-875.320] (-873.973) * [-874.877] (-880.065) (-873.841) (-874.643) -- 0:00:31
      478000 -- [-877.281] (-876.706) (-876.236) (-875.605) * (-874.336) [-874.606] (-874.466) (-876.158) -- 0:00:31
      478500 -- (-874.903) (-875.951) [-880.087] (-874.206) * [-873.625] (-875.390) (-875.231) (-878.524) -- 0:00:31
      479000 -- (-876.848) (-875.514) (-876.032) [-875.208] * (-877.159) [-877.115] (-874.429) (-873.786) -- 0:00:31
      479500 -- (-881.099) [-875.213] (-876.134) (-876.402) * [-878.898] (-880.691) (-874.101) (-875.551) -- 0:00:31
      480000 -- (-876.411) (-875.499) [-874.331] (-874.326) * (-880.002) [-876.264] (-874.597) (-874.009) -- 0:00:31

      Average standard deviation of split frequencies: 0.009634

      480500 -- (-875.047) [-873.756] (-874.918) (-873.914) * (-879.622) [-874.563] (-874.607) (-874.138) -- 0:00:31
      481000 -- (-877.215) (-875.872) [-874.807] (-878.131) * (-877.425) (-876.751) (-878.343) [-874.252] -- 0:00:31
      481500 -- (-874.984) (-876.550) [-875.897] (-876.313) * (-876.086) (-874.684) (-875.027) [-874.109] -- 0:00:31
      482000 -- (-874.053) (-874.162) (-874.880) [-876.083] * (-878.513) (-876.657) (-877.498) [-874.352] -- 0:00:31
      482500 -- (-875.693) [-874.373] (-874.211) (-875.988) * (-876.182) [-876.750] (-876.696) (-874.035) -- 0:00:31
      483000 -- (-879.398) (-874.056) (-875.200) [-874.868] * (-874.758) (-875.658) [-873.565] (-874.498) -- 0:00:31
      483500 -- (-875.297) (-877.356) (-876.376) [-880.340] * [-874.191] (-875.189) (-875.257) (-875.911) -- 0:00:30
      484000 -- [-876.178] (-878.252) (-876.372) (-876.736) * (-877.362) (-874.672) [-874.145] (-879.434) -- 0:00:30
      484500 -- (-874.104) (-875.271) [-874.883] (-873.446) * (-875.012) (-874.171) [-874.920] (-876.075) -- 0:00:30
      485000 -- (-874.020) (-874.329) (-875.089) [-875.524] * [-876.353] (-874.717) (-874.519) (-874.377) -- 0:00:30

      Average standard deviation of split frequencies: 0.009985

      485500 -- (-874.788) (-877.348) (-874.500) [-873.804] * [-875.663] (-874.644) (-875.161) (-875.098) -- 0:00:30
      486000 -- (-874.610) [-876.212] (-876.294) (-874.257) * (-876.799) (-874.344) (-875.734) [-874.344] -- 0:00:31
      486500 -- [-881.294] (-874.656) (-878.110) (-876.810) * (-874.958) (-878.546) [-875.467] (-874.690) -- 0:00:31
      487000 -- (-875.127) [-873.628] (-876.511) (-876.647) * (-877.311) (-876.041) [-874.924] (-875.059) -- 0:00:31
      487500 -- (-880.796) (-874.714) (-875.848) [-879.564] * (-874.437) (-876.375) (-875.720) [-874.857] -- 0:00:31
      488000 -- (-877.105) (-876.587) [-873.667] (-882.167) * (-876.364) (-875.703) (-876.753) [-874.384] -- 0:00:31
      488500 -- (-875.505) (-878.579) (-873.614) [-877.843] * (-879.661) (-874.381) (-877.698) [-879.376] -- 0:00:31
      489000 -- (-876.260) (-875.002) (-875.259) [-876.322] * (-878.288) (-876.755) [-878.789] (-882.698) -- 0:00:31
      489500 -- (-877.128) (-874.642) [-874.363] (-876.069) * (-873.656) [-875.955] (-876.713) (-877.682) -- 0:00:31
      490000 -- (-874.152) (-874.947) [-875.893] (-875.110) * (-873.810) (-876.883) (-875.528) [-874.145] -- 0:00:31

      Average standard deviation of split frequencies: 0.010173

      490500 -- (-880.263) (-877.614) [-874.829] (-875.851) * [-876.018] (-877.807) (-876.747) (-873.771) -- 0:00:31
      491000 -- (-873.769) [-874.831] (-878.372) (-874.706) * (-875.057) [-874.342] (-875.684) (-874.558) -- 0:00:31
      491500 -- (-874.939) [-877.289] (-879.224) (-882.174) * (-875.544) (-875.482) (-878.413) [-874.603] -- 0:00:31
      492000 -- (-874.968) (-878.645) (-874.986) [-873.700] * (-875.824) (-877.028) (-874.900) [-877.836] -- 0:00:30
      492500 -- [-874.902] (-879.032) (-875.434) (-880.745) * (-874.838) (-874.391) [-876.129] (-876.436) -- 0:00:30
      493000 -- (-876.272) [-875.458] (-873.890) (-878.406) * (-875.184) [-874.150] (-878.075) (-875.546) -- 0:00:30
      493500 -- [-875.264] (-875.513) (-878.238) (-877.707) * [-874.951] (-875.511) (-876.475) (-875.698) -- 0:00:30
      494000 -- (-874.297) [-875.415] (-879.625) (-876.994) * [-874.466] (-874.467) (-876.724) (-875.463) -- 0:00:30
      494500 -- (-876.655) (-876.529) [-879.969] (-875.054) * (-877.685) (-875.553) [-874.225] (-876.187) -- 0:00:30
      495000 -- (-875.951) [-875.585] (-877.957) (-875.789) * (-875.377) [-874.956] (-874.465) (-873.980) -- 0:00:30

      Average standard deviation of split frequencies: 0.010566

      495500 -- (-875.607) (-877.575) (-877.087) [-875.374] * (-878.102) [-874.963] (-875.037) (-874.950) -- 0:00:30
      496000 -- (-879.526) [-877.049] (-880.022) (-874.255) * (-877.162) [-879.308] (-875.099) (-875.468) -- 0:00:30
      496500 -- (-874.579) (-877.814) (-876.315) [-876.497] * (-879.420) (-874.869) [-875.147] (-875.606) -- 0:00:30
      497000 -- (-875.184) [-876.589] (-877.067) (-875.222) * (-876.221) (-877.163) (-875.124) [-877.011] -- 0:00:30
      497500 -- (-875.727) [-875.829] (-876.643) (-874.268) * (-873.803) (-875.119) (-874.209) [-875.699] -- 0:00:30
      498000 -- [-874.232] (-875.696) (-875.149) (-876.157) * [-874.753] (-875.851) (-874.803) (-882.900) -- 0:00:30
      498500 -- [-877.480] (-874.551) (-873.967) (-880.154) * (-876.879) (-873.942) [-874.855] (-873.697) -- 0:00:30
      499000 -- [-875.131] (-878.297) (-874.212) (-874.750) * (-874.668) (-876.091) [-873.927] (-873.662) -- 0:00:30
      499500 -- [-876.318] (-877.444) (-876.675) (-875.436) * (-876.321) (-874.702) (-874.799) [-874.476] -- 0:00:30
      500000 -- (-875.890) (-874.002) (-874.746) [-875.781] * (-876.473) (-873.910) [-875.184] (-881.382) -- 0:00:30

      Average standard deviation of split frequencies: 0.010080

      500500 -- [-875.738] (-874.607) (-874.234) (-875.698) * (-875.980) (-876.252) (-876.147) [-873.815] -- 0:00:29
      501000 -- (-877.871) (-878.950) [-876.268] (-875.778) * (-878.221) (-875.413) (-877.282) [-874.417] -- 0:00:29
      501500 -- (-875.341) (-876.090) (-874.051) [-874.430] * (-882.189) (-877.346) (-876.700) [-874.089] -- 0:00:30
      502000 -- [-874.707] (-875.602) (-874.396) (-874.613) * [-877.127] (-875.667) (-875.883) (-875.254) -- 0:00:30
      502500 -- (-876.654) (-877.791) (-875.202) [-874.890] * (-883.519) [-878.273] (-876.202) (-877.048) -- 0:00:30
      503000 -- (-880.307) [-876.445] (-875.816) (-874.225) * (-876.297) (-878.174) [-874.473] (-877.930) -- 0:00:30
      503500 -- (-875.243) [-874.948] (-876.836) (-877.914) * [-875.144] (-876.402) (-875.725) (-876.766) -- 0:00:30
      504000 -- [-874.725] (-878.898) (-875.407) (-875.263) * [-874.600] (-876.474) (-876.367) (-877.132) -- 0:00:30
      504500 -- (-874.449) (-883.659) [-876.140] (-874.785) * [-875.684] (-879.868) (-877.855) (-879.962) -- 0:00:30
      505000 -- (-875.681) (-877.391) [-876.449] (-874.388) * [-877.846] (-886.074) (-875.389) (-877.495) -- 0:00:30

      Average standard deviation of split frequencies: 0.010303

      505500 -- [-874.789] (-875.435) (-874.488) (-874.531) * (-874.743) [-876.008] (-876.468) (-876.771) -- 0:00:30
      506000 -- (-874.817) (-874.822) (-877.681) [-875.201] * (-876.023) [-875.513] (-877.195) (-876.510) -- 0:00:30
      506500 -- (-873.906) (-878.964) (-874.377) [-874.664] * (-875.371) (-877.312) [-875.057] (-880.953) -- 0:00:30
      507000 -- (-875.904) [-875.116] (-875.313) (-874.628) * (-876.276) [-875.587] (-874.000) (-875.566) -- 0:00:30
      507500 -- (-875.303) (-875.375) [-877.383] (-874.826) * (-875.299) (-877.373) [-873.435] (-880.340) -- 0:00:30
      508000 -- (-874.047) (-874.376) (-876.889) [-874.638] * [-875.090] (-874.718) (-873.858) (-876.518) -- 0:00:30
      508500 -- [-876.275] (-877.139) (-877.222) (-874.797) * (-876.139) [-876.419] (-874.809) (-880.716) -- 0:00:29
      509000 -- (-875.745) (-882.426) [-875.546] (-874.531) * (-877.507) (-873.886) [-875.029] (-876.223) -- 0:00:29
      509500 -- (-877.343) (-875.601) [-874.518] (-876.432) * (-873.800) (-873.883) (-877.045) [-876.346] -- 0:00:29
      510000 -- [-877.133] (-878.045) (-875.081) (-875.211) * (-873.706) (-874.587) (-875.252) [-876.463] -- 0:00:29

      Average standard deviation of split frequencies: 0.009666

      510500 -- (-875.217) (-876.297) [-874.914] (-875.501) * (-876.153) [-874.054] (-874.574) (-876.124) -- 0:00:29
      511000 -- (-876.720) (-876.022) [-875.684] (-876.006) * (-873.815) (-875.571) [-876.233] (-878.069) -- 0:00:29
      511500 -- (-877.296) (-878.115) [-876.165] (-880.868) * [-874.552] (-875.576) (-874.237) (-876.159) -- 0:00:29
      512000 -- (-877.699) (-878.509) [-874.794] (-877.451) * [-876.930] (-881.758) (-875.697) (-874.029) -- 0:00:29
      512500 -- (-874.258) [-876.884] (-879.232) (-875.654) * (-877.426) (-874.944) [-875.576] (-874.323) -- 0:00:29
      513000 -- (-876.066) (-874.682) (-874.549) [-876.242] * (-879.570) (-873.680) [-876.038] (-874.018) -- 0:00:29
      513500 -- (-879.222) [-874.841] (-874.893) (-874.613) * [-875.769] (-877.615) (-877.926) (-876.250) -- 0:00:29
      514000 -- [-874.380] (-873.620) (-875.486) (-875.675) * (-875.746) [-877.106] (-880.228) (-876.636) -- 0:00:29
      514500 -- (-876.341) (-874.579) (-877.329) [-875.555] * (-875.746) [-878.204] (-877.068) (-876.811) -- 0:00:29
      515000 -- (-875.305) (-873.640) [-874.734] (-874.242) * (-875.820) (-885.030) [-874.506] (-874.405) -- 0:00:29

      Average standard deviation of split frequencies: 0.009535

      515500 -- (-875.250) (-881.451) [-877.746] (-875.127) * [-879.651] (-878.423) (-878.779) (-881.418) -- 0:00:29
      516000 -- [-874.416] (-877.221) (-875.409) (-875.332) * [-874.516] (-878.717) (-879.644) (-878.981) -- 0:00:29
      516500 -- (-878.292) (-875.728) (-877.187) [-874.829] * (-875.586) (-876.694) (-877.011) [-877.686] -- 0:00:29
      517000 -- (-876.111) (-875.342) [-875.689] (-874.635) * (-875.824) (-874.192) [-878.289] (-874.415) -- 0:00:28
      517500 -- (-875.961) (-874.507) (-874.191) [-874.532] * [-876.145] (-876.287) (-876.036) (-873.979) -- 0:00:28
      518000 -- (-874.942) (-875.431) [-876.364] (-873.736) * [-874.656] (-876.914) (-875.861) (-875.242) -- 0:00:28
      518500 -- [-879.816] (-874.237) (-874.663) (-875.887) * [-876.862] (-874.694) (-875.363) (-873.813) -- 0:00:29
      519000 -- (-876.684) (-878.363) [-874.408] (-880.836) * (-874.862) (-875.598) [-873.783] (-874.781) -- 0:00:29
      519500 -- (-877.295) [-878.159] (-875.153) (-877.960) * (-874.293) (-876.770) [-876.058] (-874.421) -- 0:00:29
      520000 -- [-875.694] (-876.955) (-878.207) (-876.572) * (-875.033) (-875.545) (-874.983) [-877.735] -- 0:00:29

      Average standard deviation of split frequencies: 0.009235

      520500 -- (-874.446) (-875.547) [-876.861] (-874.324) * [-874.234] (-873.603) (-877.627) (-875.593) -- 0:00:29
      521000 -- [-873.917] (-879.525) (-877.545) (-873.975) * [-874.471] (-874.299) (-876.384) (-880.026) -- 0:00:29
      521500 -- (-874.902) (-882.419) [-873.816] (-875.892) * (-874.397) (-875.364) [-874.611] (-878.571) -- 0:00:29
      522000 -- [-876.892] (-876.329) (-875.108) (-875.048) * (-876.662) (-878.943) [-873.806] (-877.080) -- 0:00:29
      522500 -- (-875.895) (-874.316) [-875.587] (-875.236) * (-878.009) (-876.976) (-873.825) [-875.915] -- 0:00:29
      523000 -- [-878.218] (-874.405) (-874.181) (-876.660) * [-875.296] (-875.685) (-875.500) (-875.241) -- 0:00:29
      523500 -- (-876.062) [-874.893] (-874.286) (-874.618) * (-875.464) (-876.842) [-875.974] (-875.416) -- 0:00:29
      524000 -- (-875.882) (-876.246) (-877.980) [-873.690] * (-878.237) (-875.724) (-876.132) [-875.197] -- 0:00:29
      524500 -- (-874.317) (-873.769) (-878.895) [-874.368] * (-875.244) [-875.437] (-880.828) (-877.076) -- 0:00:29
      525000 -- (-875.167) (-876.869) (-879.153) [-874.726] * [-874.086] (-874.902) (-875.841) (-875.301) -- 0:00:28

      Average standard deviation of split frequencies: 0.009858

      525500 -- (-874.255) (-876.330) (-875.740) [-874.135] * (-874.591) [-876.530] (-874.580) (-874.181) -- 0:00:28
      526000 -- (-873.693) [-874.820] (-877.848) (-878.509) * (-879.133) (-874.388) (-874.485) [-877.532] -- 0:00:28
      526500 -- (-873.475) (-873.370) [-874.875] (-874.899) * (-876.969) [-876.505] (-874.270) (-877.042) -- 0:00:28
      527000 -- (-876.867) [-874.147] (-877.158) (-874.494) * (-876.155) (-877.978) [-875.986] (-875.504) -- 0:00:28
      527500 -- (-878.006) [-874.721] (-877.095) (-878.790) * (-879.364) [-874.020] (-880.477) (-874.528) -- 0:00:28
      528000 -- (-877.447) (-875.675) (-876.763) [-877.341] * (-875.348) (-874.231) [-874.671] (-873.380) -- 0:00:28
      528500 -- (-878.095) (-873.781) (-873.877) [-874.095] * (-875.812) [-874.047] (-874.905) (-874.536) -- 0:00:28
      529000 -- (-876.137) [-873.445] (-875.704) (-874.694) * (-875.345) [-874.647] (-874.977) (-874.229) -- 0:00:28
      529500 -- (-876.731) [-874.187] (-875.608) (-878.869) * (-877.948) (-877.788) [-876.365] (-874.469) -- 0:00:28
      530000 -- [-877.102] (-875.624) (-879.265) (-878.292) * (-877.772) [-878.163] (-876.479) (-878.437) -- 0:00:28

      Average standard deviation of split frequencies: 0.010049

      530500 -- (-877.705) (-876.311) (-875.175) [-876.151] * (-873.922) [-875.571] (-877.493) (-879.799) -- 0:00:28
      531000 -- (-879.414) (-875.255) (-875.167) [-874.880] * [-876.130] (-875.327) (-877.468) (-879.475) -- 0:00:28
      531500 -- (-878.668) [-874.713] (-876.636) (-874.736) * [-877.067] (-874.012) (-874.573) (-876.345) -- 0:00:28
      532000 -- (-874.388) (-874.005) (-873.703) [-874.667] * (-874.153) (-876.415) (-874.398) [-874.665] -- 0:00:28
      532500 -- (-875.632) (-875.201) (-875.781) [-877.465] * (-875.923) [-875.003] (-876.739) (-876.129) -- 0:00:28
      533000 -- (-874.394) [-874.297] (-878.049) (-875.597) * (-877.212) [-875.677] (-875.474) (-875.001) -- 0:00:28
      533500 -- (-874.856) [-876.125] (-876.666) (-877.829) * (-877.136) [-873.700] (-874.269) (-874.755) -- 0:00:27
      534000 -- (-875.569) (-880.311) (-876.838) [-875.738] * (-878.074) (-875.448) [-876.253] (-876.016) -- 0:00:27
      534500 -- (-875.513) (-874.566) [-882.035] (-875.992) * (-878.574) (-875.904) [-874.572] (-880.129) -- 0:00:27
      535000 -- (-876.310) [-874.438] (-879.639) (-875.772) * (-876.222) (-874.140) [-876.998] (-875.814) -- 0:00:28

      Average standard deviation of split frequencies: 0.010224

      535500 -- (-874.647) (-875.334) (-881.967) [-875.393] * (-874.802) (-874.834) [-875.927] (-875.531) -- 0:00:28
      536000 -- (-877.230) [-873.993] (-876.540) (-875.157) * (-878.387) (-876.650) [-874.234] (-877.073) -- 0:00:28
      536500 -- (-874.942) (-873.800) (-875.110) [-876.647] * (-875.456) [-880.242] (-873.949) (-874.501) -- 0:00:28
      537000 -- [-875.614] (-874.951) (-874.232) (-877.060) * (-875.380) (-874.409) [-875.287] (-875.269) -- 0:00:28
      537500 -- (-875.341) (-874.035) (-875.223) [-875.908] * [-877.304] (-874.336) (-875.197) (-875.850) -- 0:00:28
      538000 -- [-875.228] (-876.067) (-875.855) (-875.525) * (-877.166) (-876.213) [-876.440] (-874.655) -- 0:00:28
      538500 -- (-877.183) [-875.730] (-874.721) (-874.311) * (-877.432) [-875.935] (-877.106) (-880.549) -- 0:00:28
      539000 -- (-876.195) (-873.987) [-875.684] (-875.644) * (-878.856) (-875.296) [-875.917] (-876.053) -- 0:00:28
      539500 -- (-875.511) [-874.079] (-874.795) (-876.484) * (-877.164) [-875.270] (-874.231) (-875.504) -- 0:00:28
      540000 -- (-882.948) (-876.533) [-873.649] (-876.434) * (-878.950) (-876.057) (-875.478) [-873.809] -- 0:00:28

      Average standard deviation of split frequencies: 0.010844

      540500 -- (-877.090) (-873.773) [-873.702] (-875.589) * (-875.578) (-877.001) [-876.555] (-878.003) -- 0:00:28
      541000 -- (-876.876) (-875.485) (-873.513) [-874.708] * (-882.800) (-876.941) [-877.492] (-877.309) -- 0:00:27
      541500 -- [-876.678] (-878.101) (-877.937) (-877.249) * [-875.174] (-875.064) (-878.636) (-877.244) -- 0:00:27
      542000 -- (-875.339) (-874.805) [-876.773] (-875.898) * (-877.310) [-877.026] (-880.332) (-875.825) -- 0:00:27
      542500 -- [-874.983] (-876.896) (-878.623) (-877.270) * (-875.332) [-875.312] (-875.321) (-879.908) -- 0:00:27
      543000 -- (-876.028) (-880.009) (-874.594) [-876.919] * (-878.601) (-879.231) [-874.693] (-873.412) -- 0:00:27
      543500 -- [-875.692] (-877.834) (-875.863) (-877.696) * (-876.063) (-876.420) (-877.040) [-874.056] -- 0:00:27
      544000 -- (-874.009) [-876.074] (-874.357) (-876.724) * (-876.448) (-876.382) (-875.817) [-874.542] -- 0:00:27
      544500 -- (-875.355) (-876.274) (-876.197) [-875.563] * (-874.360) (-874.713) [-874.397] (-875.815) -- 0:00:27
      545000 -- (-876.038) (-875.827) [-874.772] (-875.219) * (-876.754) (-875.802) [-877.062] (-875.878) -- 0:00:27

      Average standard deviation of split frequencies: 0.010522

      545500 -- (-877.626) [-875.640] (-878.109) (-873.873) * (-876.582) (-874.857) [-875.136] (-875.613) -- 0:00:27
      546000 -- (-876.415) [-875.169] (-877.614) (-876.650) * [-874.136] (-874.542) (-875.035) (-876.838) -- 0:00:27
      546500 -- [-874.408] (-875.759) (-874.574) (-876.724) * (-874.966) (-875.973) [-873.953] (-876.110) -- 0:00:27
      547000 -- (-878.132) (-875.747) (-874.712) [-875.531] * (-876.579) [-876.863] (-879.087) (-875.135) -- 0:00:27
      547500 -- (-875.395) (-877.355) [-875.709] (-874.356) * (-875.749) (-876.885) (-874.351) [-876.121] -- 0:00:27
      548000 -- (-875.000) (-877.879) (-874.889) [-873.716] * (-876.653) (-878.993) [-874.088] (-879.898) -- 0:00:27
      548500 -- (-877.229) (-877.501) (-876.429) [-875.475] * (-874.649) (-877.100) [-875.885] (-876.337) -- 0:00:27
      549000 -- [-874.688] (-875.634) (-877.115) (-874.573) * (-876.524) (-876.687) (-874.215) [-873.820] -- 0:00:27
      549500 -- (-875.117) [-873.963] (-875.561) (-875.912) * (-879.444) (-874.571) (-881.597) [-875.402] -- 0:00:27
      550000 -- (-873.928) (-877.206) (-874.952) [-875.506] * (-876.781) [-879.916] (-873.951) (-879.911) -- 0:00:27

      Average standard deviation of split frequencies: 0.010444

      550500 -- (-876.796) [-875.345] (-875.278) (-875.187) * [-873.469] (-874.405) (-876.048) (-877.161) -- 0:00:26
      551000 -- (-874.623) [-873.752] (-876.164) (-874.980) * (-874.046) [-873.958] (-878.493) (-876.108) -- 0:00:27
      551500 -- (-876.530) (-873.805) (-877.362) [-876.978] * (-874.747) (-873.494) (-874.548) [-875.870] -- 0:00:27
      552000 -- (-876.034) (-874.041) (-874.419) [-873.930] * (-875.065) (-875.879) [-874.077] (-874.344) -- 0:00:27
      552500 -- (-880.181) (-875.071) (-875.660) [-875.369] * (-877.068) (-875.048) [-874.107] (-877.696) -- 0:00:27
      553000 -- (-878.385) (-875.490) [-875.247] (-876.394) * (-874.848) [-876.260] (-874.125) (-876.718) -- 0:00:27
      553500 -- (-879.066) [-874.670] (-877.185) (-874.785) * (-874.835) [-878.693] (-875.520) (-874.448) -- 0:00:27
      554000 -- (-875.271) (-875.152) (-874.865) [-873.861] * (-876.582) (-876.583) (-875.700) [-875.660] -- 0:00:27
      554500 -- (-875.985) (-874.287) [-876.869] (-874.790) * [-875.460] (-878.162) (-876.808) (-875.749) -- 0:00:27
      555000 -- [-876.959] (-874.219) (-875.686) (-877.453) * (-878.323) (-877.982) [-879.128] (-876.287) -- 0:00:27

      Average standard deviation of split frequencies: 0.010570

      555500 -- (-874.433) (-874.356) [-876.147] (-874.224) * (-873.764) (-875.476) (-874.900) [-876.277] -- 0:00:27
      556000 -- [-876.782] (-874.933) (-881.245) (-876.238) * (-874.829) (-876.348) (-874.389) [-874.909] -- 0:00:27
      556500 -- [-876.465] (-876.854) (-879.509) (-876.844) * (-874.771) (-877.917) (-874.971) [-874.378] -- 0:00:27
      557000 -- (-879.163) (-879.809) (-873.888) [-874.994] * (-875.438) (-877.434) [-880.202] (-875.355) -- 0:00:27
      557500 -- [-875.644] (-875.861) (-873.870) (-874.725) * [-875.500] (-874.210) (-880.911) (-877.041) -- 0:00:26
      558000 -- (-873.620) [-873.920] (-876.595) (-877.251) * (-877.182) [-873.732] (-875.850) (-877.419) -- 0:00:26
      558500 -- [-878.103] (-875.926) (-877.343) (-879.550) * [-875.039] (-873.619) (-874.734) (-876.712) -- 0:00:26
      559000 -- (-878.349) (-876.306) [-874.578] (-875.993) * (-876.592) [-873.383] (-874.542) (-877.095) -- 0:00:26
      559500 -- (-876.595) (-877.280) (-875.059) [-875.485] * [-875.907] (-874.980) (-873.768) (-875.542) -- 0:00:26
      560000 -- [-879.445] (-879.764) (-874.677) (-878.535) * (-880.256) (-877.272) [-874.118] (-879.572) -- 0:00:26

      Average standard deviation of split frequencies: 0.009354

      560500 -- (-876.273) [-874.736] (-875.446) (-878.784) * (-887.338) [-876.913] (-874.360) (-879.509) -- 0:00:26
      561000 -- (-877.699) (-878.512) [-876.363] (-877.328) * (-887.670) (-875.588) (-873.870) [-875.347] -- 0:00:26
      561500 -- (-875.163) [-882.461] (-881.300) (-875.666) * (-874.857) (-876.686) [-876.725] (-877.167) -- 0:00:26
      562000 -- (-875.839) [-875.601] (-875.550) (-874.628) * [-875.564] (-876.511) (-874.541) (-876.842) -- 0:00:26
      562500 -- (-874.713) [-874.896] (-876.919) (-873.677) * (-874.446) (-874.702) (-875.447) [-873.858] -- 0:00:26
      563000 -- (-878.382) (-874.515) [-874.789] (-874.034) * (-874.284) (-875.610) (-877.588) [-874.652] -- 0:00:26
      563500 -- (-875.962) (-879.370) (-875.416) [-878.495] * (-874.059) (-875.891) (-874.022) [-874.612] -- 0:00:26
      564000 -- (-874.446) [-875.249] (-873.919) (-876.443) * (-877.682) (-876.375) (-876.985) [-875.524] -- 0:00:26
      564500 -- [-873.914] (-876.722) (-877.436) (-878.342) * (-878.431) (-875.121) (-873.760) [-878.392] -- 0:00:26
      565000 -- (-875.140) [-875.025] (-876.543) (-876.163) * (-875.066) (-876.225) (-878.258) [-874.720] -- 0:00:26

      Average standard deviation of split frequencies: 0.009422

      565500 -- [-873.779] (-877.748) (-878.440) (-875.405) * (-879.962) [-878.294] (-876.549) (-875.022) -- 0:00:26
      566000 -- (-874.478) (-875.896) (-878.201) [-874.787] * (-875.686) (-874.177) (-879.144) [-874.761] -- 0:00:26
      566500 -- [-874.499] (-874.673) (-876.371) (-875.478) * (-875.152) [-876.072] (-877.129) (-875.100) -- 0:00:26
      567000 -- (-878.385) [-876.224] (-875.841) (-876.859) * (-874.916) (-874.926) [-876.462] (-876.257) -- 0:00:25
      567500 -- (-879.105) [-875.114] (-881.526) (-876.703) * (-874.380) [-875.538] (-876.783) (-878.902) -- 0:00:25
      568000 -- [-875.395] (-876.680) (-876.255) (-877.051) * [-873.868] (-874.620) (-875.434) (-878.703) -- 0:00:26
      568500 -- (-875.747) (-879.748) (-875.340) [-875.192] * (-874.055) (-877.095) [-874.351] (-877.822) -- 0:00:26
      569000 -- (-879.191) (-876.821) [-879.611] (-874.187) * (-876.310) [-879.222] (-874.818) (-875.283) -- 0:00:26
      569500 -- [-875.555] (-879.982) (-875.661) (-876.384) * (-873.986) (-875.054) (-874.435) [-878.802] -- 0:00:26
      570000 -- [-877.139] (-877.574) (-876.207) (-876.206) * (-877.608) (-874.521) [-875.212] (-876.928) -- 0:00:26

      Average standard deviation of split frequencies: 0.009252

      570500 -- (-875.296) (-874.889) [-874.958] (-879.901) * [-878.893] (-875.560) (-876.060) (-876.658) -- 0:00:26
      571000 -- [-874.820] (-876.482) (-873.922) (-878.512) * [-874.841] (-874.640) (-876.487) (-876.698) -- 0:00:26
      571500 -- (-878.443) (-876.104) (-876.466) [-877.199] * [-878.536] (-874.636) (-878.704) (-880.220) -- 0:00:26
      572000 -- (-879.722) (-875.484) (-876.469) [-876.886] * [-873.622] (-876.402) (-876.813) (-880.025) -- 0:00:26
      572500 -- (-877.082) (-876.342) [-875.714] (-874.732) * (-873.637) (-880.021) [-874.735] (-874.646) -- 0:00:26
      573000 -- (-874.562) [-878.616] (-876.987) (-875.577) * (-874.564) (-877.916) (-873.840) [-876.664] -- 0:00:26
      573500 -- [-878.805] (-875.996) (-876.263) (-877.728) * (-877.060) [-875.306] (-879.503) (-876.547) -- 0:00:26
      574000 -- (-874.908) (-874.518) (-875.681) [-873.798] * (-883.760) [-876.142] (-880.083) (-874.433) -- 0:00:25
      574500 -- [-875.986] (-874.153) (-875.048) (-876.716) * [-878.007] (-874.714) (-875.024) (-875.985) -- 0:00:25
      575000 -- (-878.159) (-874.845) (-875.328) [-874.599] * (-874.682) (-877.143) (-875.671) [-875.010] -- 0:00:25

      Average standard deviation of split frequencies: 0.009221

      575500 -- (-878.994) [-874.698] (-874.377) (-876.574) * (-877.137) (-878.340) (-876.812) [-874.014] -- 0:00:25
      576000 -- (-877.408) (-877.952) (-877.263) [-876.137] * (-877.131) (-878.835) (-878.264) [-874.113] -- 0:00:25
      576500 -- (-881.906) (-873.751) [-875.190] (-874.922) * (-874.931) [-880.859] (-876.457) (-877.997) -- 0:00:25
      577000 -- (-876.970) [-873.750] (-875.783) (-874.076) * (-876.546) (-876.523) (-875.414) [-876.949] -- 0:00:25
      577500 -- (-876.124) (-876.800) (-875.797) [-874.064] * (-877.572) (-876.455) (-876.432) [-875.708] -- 0:00:25
      578000 -- (-877.399) (-877.051) (-876.047) [-874.196] * [-880.309] (-874.980) (-875.347) (-875.897) -- 0:00:25
      578500 -- (-876.990) (-879.198) [-874.700] (-874.299) * (-881.290) (-874.200) (-875.661) [-874.377] -- 0:00:25
      579000 -- (-880.107) (-876.261) (-875.125) [-874.018] * (-875.079) (-877.070) [-874.832] (-876.220) -- 0:00:25
      579500 -- (-875.201) [-876.451] (-874.120) (-873.750) * [-875.345] (-874.038) (-874.638) (-875.612) -- 0:00:25
      580000 -- (-874.878) (-874.627) (-875.484) [-874.183] * (-875.203) (-874.179) [-874.169] (-877.793) -- 0:00:25

      Average standard deviation of split frequencies: 0.009309

      580500 -- (-874.583) [-873.540] (-877.199) (-880.240) * (-876.334) (-874.008) [-874.420] (-877.120) -- 0:00:25
      581000 -- [-875.006] (-873.988) (-875.195) (-877.918) * (-873.711) (-874.663) [-875.817] (-874.476) -- 0:00:25
      581500 -- (-873.603) (-874.483) (-878.063) [-874.907] * (-874.284) [-874.663] (-875.215) (-884.108) -- 0:00:25
      582000 -- (-873.580) [-874.687] (-873.511) (-875.016) * [-874.906] (-875.544) (-873.816) (-874.996) -- 0:00:25
      582500 -- (-877.980) (-878.413) [-876.238] (-878.849) * [-876.559] (-877.370) (-876.069) (-875.840) -- 0:00:25
      583000 -- (-877.019) (-881.285) (-877.812) [-875.813] * [-876.716] (-884.432) (-874.396) (-873.777) -- 0:00:25
      583500 -- (-874.790) [-880.045] (-878.267) (-876.671) * [-875.060] (-877.774) (-874.631) (-876.532) -- 0:00:24
      584000 -- [-877.389] (-877.100) (-876.156) (-876.187) * (-877.402) [-876.426] (-880.989) (-876.429) -- 0:00:24
      584500 -- [-879.550] (-874.537) (-875.086) (-875.884) * (-879.352) [-874.512] (-878.156) (-874.617) -- 0:00:25
      585000 -- [-875.159] (-874.175) (-874.836) (-876.035) * [-875.656] (-875.016) (-875.483) (-874.108) -- 0:00:25

      Average standard deviation of split frequencies: 0.009117

      585500 -- (-875.077) [-873.801] (-874.604) (-877.206) * (-880.494) (-876.551) (-876.995) [-875.407] -- 0:00:25
      586000 -- [-878.311] (-875.126) (-874.100) (-876.530) * (-875.465) (-874.532) [-874.905] (-875.365) -- 0:00:25
      586500 -- (-876.094) (-880.763) (-873.951) [-874.248] * (-875.653) (-874.910) (-876.022) [-875.633] -- 0:00:25
      587000 -- (-874.397) (-876.813) (-876.574) [-874.481] * (-877.631) [-875.063] (-873.741) (-876.667) -- 0:00:25
      587500 -- [-878.910] (-877.166) (-879.873) (-880.833) * (-873.992) (-877.137) [-875.645] (-874.672) -- 0:00:25
      588000 -- [-877.510] (-875.389) (-877.480) (-876.374) * (-874.672) (-874.567) (-876.211) [-874.874] -- 0:00:25
      588500 -- (-876.024) (-875.761) (-882.326) [-874.311] * [-875.405] (-873.997) (-877.337) (-876.418) -- 0:00:25
      589000 -- [-876.393] (-877.809) (-879.004) (-877.794) * (-878.866) (-877.479) (-874.623) [-875.814] -- 0:00:25
      589500 -- (-881.829) [-877.713] (-876.246) (-875.472) * (-874.267) (-877.713) [-874.706] (-876.020) -- 0:00:25
      590000 -- (-877.397) (-883.889) (-874.128) [-874.157] * [-876.328] (-875.727) (-875.987) (-878.373) -- 0:00:25

      Average standard deviation of split frequencies: 0.009205

      590500 -- (-875.832) [-875.309] (-876.937) (-876.564) * [-877.603] (-876.745) (-875.742) (-875.806) -- 0:00:24
      591000 -- (-876.075) [-875.126] (-876.731) (-875.160) * (-876.856) [-874.209] (-874.105) (-877.006) -- 0:00:24
      591500 -- (-877.306) (-873.872) [-877.287] (-875.780) * (-873.941) (-874.542) [-874.565] (-873.660) -- 0:00:24
      592000 -- (-876.725) (-873.843) (-879.907) [-875.354] * (-875.841) (-878.350) (-877.213) [-874.652] -- 0:00:24
      592500 -- [-874.186] (-874.069) (-879.464) (-875.394) * [-877.376] (-877.030) (-876.830) (-877.330) -- 0:00:24
      593000 -- (-877.424) (-877.419) (-885.789) [-874.815] * [-876.096] (-877.693) (-875.871) (-874.953) -- 0:00:24
      593500 -- (-874.966) (-876.257) [-874.822] (-875.087) * [-878.909] (-873.705) (-875.610) (-876.372) -- 0:00:24
      594000 -- [-874.638] (-874.985) (-876.303) (-877.485) * (-877.550) [-877.018] (-875.504) (-874.414) -- 0:00:24
      594500 -- (-879.172) (-874.973) [-874.531] (-878.867) * [-875.714] (-877.445) (-879.178) (-874.728) -- 0:00:24
      595000 -- (-877.380) (-875.263) (-878.356) [-874.877] * (-877.609) [-877.918] (-878.062) (-874.166) -- 0:00:24

      Average standard deviation of split frequencies: 0.009386

      595500 -- (-879.720) (-875.201) [-874.683] (-874.681) * (-877.373) [-875.326] (-874.328) (-876.066) -- 0:00:24
      596000 -- (-880.289) [-877.457] (-877.080) (-874.667) * (-877.007) [-876.514] (-876.994) (-877.196) -- 0:00:24
      596500 -- (-874.827) [-877.209] (-876.820) (-881.811) * (-877.017) (-878.775) [-874.814] (-877.156) -- 0:00:24
      597000 -- [-876.300] (-875.506) (-874.951) (-878.099) * [-875.331] (-876.811) (-875.072) (-877.099) -- 0:00:24
      597500 -- (-875.891) (-873.911) (-874.371) [-874.874] * (-875.876) (-876.113) [-874.337] (-875.691) -- 0:00:24
      598000 -- (-877.382) (-876.078) [-874.563] (-875.378) * (-874.793) [-876.411] (-875.045) (-879.052) -- 0:00:24
      598500 -- (-876.875) [-875.050] (-874.155) (-879.432) * (-874.603) [-874.577] (-875.945) (-876.880) -- 0:00:24
      599000 -- (-877.520) (-874.841) [-876.869] (-874.988) * (-874.640) [-874.657] (-878.292) (-878.409) -- 0:00:24
      599500 -- (-881.337) (-876.588) [-877.056] (-874.596) * (-874.128) (-875.395) (-875.723) [-878.874] -- 0:00:24
      600000 -- [-876.109] (-874.991) (-874.879) (-874.015) * (-874.128) (-874.296) [-873.736] (-874.067) -- 0:00:24

      Average standard deviation of split frequencies: 0.009208

      600500 -- (-873.603) (-875.952) [-874.548] (-877.635) * (-876.460) (-876.010) [-873.914] (-874.332) -- 0:00:24
      601000 -- [-874.225] (-874.000) (-875.796) (-875.781) * [-876.244] (-878.099) (-876.945) (-875.115) -- 0:00:24
      601500 -- (-874.273) (-874.810) [-875.765] (-874.222) * (-876.017) (-874.679) (-873.750) [-874.196] -- 0:00:24
      602000 -- (-875.485) [-876.207] (-876.444) (-874.478) * (-875.294) (-874.597) [-874.416] (-877.385) -- 0:00:24
      602500 -- (-874.682) [-874.111] (-875.905) (-876.372) * [-874.850] (-875.575) (-874.570) (-876.220) -- 0:00:24
      603000 -- [-875.253] (-877.736) (-875.192) (-877.226) * [-875.967] (-878.136) (-874.212) (-875.325) -- 0:00:24
      603500 -- (-874.675) (-878.950) (-875.202) [-877.195] * (-874.617) (-875.907) (-876.501) [-876.070] -- 0:00:24
      604000 -- [-876.466] (-879.067) (-877.773) (-883.466) * (-873.959) (-877.512) (-874.193) [-874.688] -- 0:00:24
      604500 -- [-880.233] (-877.061) (-875.624) (-883.054) * (-874.303) [-878.864] (-875.553) (-876.705) -- 0:00:24
      605000 -- (-879.108) (-878.159) [-876.332] (-880.207) * (-876.629) [-878.246] (-876.954) (-874.269) -- 0:00:24

      Average standard deviation of split frequencies: 0.009594

      605500 -- (-875.013) (-878.310) [-875.007] (-877.854) * (-876.721) (-877.717) (-877.072) [-875.115] -- 0:00:24
      606000 -- (-874.404) (-874.740) [-874.778] (-875.141) * [-878.984] (-875.163) (-876.029) (-876.316) -- 0:00:24
      606500 -- [-877.574] (-873.912) (-879.559) (-877.683) * (-874.146) (-876.238) [-874.194] (-874.411) -- 0:00:24
      607000 -- (-880.374) [-874.937] (-876.191) (-874.802) * (-874.429) (-874.041) [-873.990] (-874.977) -- 0:00:23
      607500 -- (-880.734) (-875.593) [-874.377] (-876.578) * (-877.748) (-875.482) [-874.561] (-876.071) -- 0:00:23
      608000 -- (-875.229) [-875.886] (-873.636) (-877.308) * (-876.556) [-874.959] (-876.628) (-874.994) -- 0:00:23
      608500 -- (-875.634) (-876.161) [-873.634] (-873.743) * (-876.446) [-875.438] (-877.601) (-875.950) -- 0:00:23
      609000 -- (-881.868) (-874.972) [-877.390] (-879.565) * (-876.272) [-875.280] (-874.363) (-874.917) -- 0:00:23
      609500 -- (-882.432) (-877.685) (-878.291) [-874.860] * [-875.079] (-877.167) (-878.558) (-873.602) -- 0:00:23
      610000 -- (-877.555) [-875.991] (-874.613) (-875.112) * (-874.882) (-874.169) (-875.983) [-876.395] -- 0:00:23

      Average standard deviation of split frequencies: 0.009006

      610500 -- [-875.360] (-875.916) (-876.325) (-874.802) * (-875.678) (-875.573) [-874.452] (-874.742) -- 0:00:23
      611000 -- (-880.899) (-875.257) (-881.159) [-874.260] * [-875.103] (-874.261) (-877.029) (-874.011) -- 0:00:23
      611500 -- [-875.879] (-875.315) (-877.568) (-873.887) * (-875.393) [-876.841] (-878.361) (-874.380) -- 0:00:23
      612000 -- (-874.224) (-874.173) [-877.329] (-876.799) * (-880.803) (-878.187) [-879.992] (-879.264) -- 0:00:23
      612500 -- (-874.875) [-875.177] (-874.143) (-876.105) * (-877.620) [-878.660] (-874.830) (-876.826) -- 0:00:23
      613000 -- (-878.447) (-875.754) (-875.389) [-875.845] * (-876.611) [-876.520] (-875.360) (-876.805) -- 0:00:23
      613500 -- (-878.003) (-875.562) (-877.101) [-875.432] * (-876.790) (-877.486) [-873.614] (-878.684) -- 0:00:23
      614000 -- (-874.133) [-875.149] (-878.787) (-879.338) * (-876.359) (-875.913) (-873.382) [-877.238] -- 0:00:23
      614500 -- [-875.013] (-875.450) (-877.079) (-875.047) * [-874.862] (-873.903) (-878.638) (-878.048) -- 0:00:23
      615000 -- (-877.988) (-873.965) [-878.550] (-873.483) * (-874.083) (-874.426) [-875.657] (-875.811) -- 0:00:23

      Average standard deviation of split frequencies: 0.009081

      615500 -- (-877.456) (-876.500) [-875.606] (-876.202) * (-875.313) [-877.069] (-875.258) (-876.732) -- 0:00:23
      616000 -- (-879.587) (-874.639) [-874.798] (-879.501) * (-878.412) (-877.166) [-873.854] (-874.399) -- 0:00:23
      616500 -- (-876.385) (-875.908) (-874.334) [-874.815] * (-873.910) (-876.485) (-873.495) [-875.439] -- 0:00:23
      617000 -- (-878.171) (-873.627) (-875.125) [-875.391] * (-875.484) (-876.853) (-874.466) [-876.812] -- 0:00:23
      617500 -- (-876.082) (-875.421) [-874.362] (-873.939) * (-875.230) [-878.338] (-875.521) (-877.550) -- 0:00:23
      618000 -- (-879.150) (-875.571) [-875.464] (-876.755) * (-876.394) (-875.843) [-876.522] (-876.471) -- 0:00:23
      618500 -- [-875.495] (-875.217) (-877.381) (-873.634) * (-875.619) [-873.914] (-876.635) (-874.796) -- 0:00:23
      619000 -- (-879.950) (-875.398) [-874.583] (-873.787) * [-874.967] (-878.137) (-878.041) (-877.685) -- 0:00:23
      619500 -- [-876.540] (-878.486) (-874.756) (-875.660) * (-875.285) (-878.509) (-874.607) [-876.627] -- 0:00:23
      620000 -- [-875.560] (-875.631) (-874.201) (-878.480) * [-875.795] (-873.696) (-873.776) (-876.458) -- 0:00:23

      Average standard deviation of split frequencies: 0.008557

      620500 -- (-876.738) (-876.985) (-878.897) [-875.166] * (-879.922) (-873.681) [-877.511] (-877.548) -- 0:00:23
      621000 -- (-880.560) [-875.597] (-877.757) (-875.623) * (-874.813) (-877.055) [-877.406] (-874.520) -- 0:00:23
      621500 -- (-874.326) [-875.920] (-881.899) (-874.881) * (-873.992) [-873.821] (-877.985) (-875.041) -- 0:00:23
      622000 -- (-875.203) (-877.184) (-880.406) [-875.820] * [-874.326] (-874.564) (-878.422) (-876.990) -- 0:00:23
      622500 -- (-875.613) (-873.667) (-875.667) [-875.131] * [-875.583] (-874.869) (-876.120) (-876.014) -- 0:00:23
      623000 -- [-874.254] (-874.831) (-874.857) (-875.089) * (-876.153) (-875.172) [-875.919] (-876.153) -- 0:00:22
      623500 -- (-875.705) (-879.378) (-875.129) [-874.163] * (-879.387) [-876.391] (-874.472) (-875.949) -- 0:00:22
      624000 -- (-876.015) [-873.629] (-874.175) (-875.167) * (-874.218) [-876.471] (-875.977) (-875.118) -- 0:00:22
      624500 -- (-874.957) (-880.084) [-876.810] (-873.774) * (-874.173) (-874.934) (-876.349) [-879.018] -- 0:00:22
      625000 -- (-873.957) [-873.936] (-880.038) (-873.841) * (-874.324) [-875.184] (-874.093) (-874.593) -- 0:00:22

      Average standard deviation of split frequencies: 0.008434

      625500 -- [-875.471] (-876.208) (-874.806) (-877.013) * (-877.634) (-875.019) [-875.009] (-874.319) -- 0:00:22
      626000 -- (-874.386) (-875.654) (-875.182) [-873.659] * (-875.187) (-875.149) (-875.072) [-876.877] -- 0:00:22
      626500 -- (-879.107) (-875.767) (-878.945) [-873.768] * [-874.995] (-874.750) (-875.177) (-879.113) -- 0:00:22
      627000 -- [-878.497] (-876.056) (-876.517) (-876.587) * (-876.580) (-877.325) [-877.835] (-880.102) -- 0:00:22
      627500 -- (-876.352) (-876.819) [-875.862] (-879.016) * (-877.732) (-877.526) (-877.023) [-878.522] -- 0:00:22
      628000 -- [-874.141] (-878.269) (-874.717) (-877.072) * [-875.677] (-875.824) (-879.858) (-875.184) -- 0:00:22
      628500 -- [-875.102] (-876.114) (-876.444) (-876.137) * (-880.251) (-875.258) [-874.547] (-874.229) -- 0:00:22
      629000 -- [-874.393] (-877.459) (-873.760) (-876.251) * (-876.605) (-875.598) [-875.446] (-876.913) -- 0:00:22
      629500 -- (-874.596) (-877.671) (-875.211) [-876.423] * (-876.715) (-875.905) (-874.639) [-875.255] -- 0:00:22
      630000 -- (-875.711) (-878.661) (-876.474) [-876.106] * (-879.169) (-876.657) (-875.466) [-876.606] -- 0:00:22

      Average standard deviation of split frequencies: 0.008023

      630500 -- (-874.269) [-878.516] (-875.648) (-876.473) * (-876.274) (-877.749) (-877.352) [-875.543] -- 0:00:22
      631000 -- [-875.875] (-875.913) (-874.990) (-874.317) * (-875.070) [-876.153] (-875.204) (-875.609) -- 0:00:22
      631500 -- (-875.906) (-876.380) (-875.920) [-875.234] * [-874.798] (-876.564) (-876.077) (-875.436) -- 0:00:22
      632000 -- (-875.616) (-874.360) [-875.962] (-875.150) * (-874.933) (-877.285) [-875.588] (-876.383) -- 0:00:22
      632500 -- (-876.538) (-874.320) [-875.278] (-880.702) * (-877.021) (-880.775) (-873.994) [-874.358] -- 0:00:22
      633000 -- (-877.717) (-875.281) [-875.677] (-877.898) * (-877.234) (-874.217) (-875.938) [-876.585] -- 0:00:22
      633500 -- (-876.031) (-877.481) [-874.090] (-876.986) * (-876.448) (-875.881) (-874.758) [-876.880] -- 0:00:22
      634000 -- [-878.280] (-877.628) (-875.306) (-875.003) * (-874.165) [-876.621] (-873.958) (-876.048) -- 0:00:22
      634500 -- (-874.095) [-874.427] (-877.670) (-873.808) * (-882.049) (-876.543) [-874.645] (-877.255) -- 0:00:22
      635000 -- (-875.632) [-874.996] (-876.543) (-877.264) * (-876.687) [-875.907] (-875.371) (-875.584) -- 0:00:22

      Average standard deviation of split frequencies: 0.007956

      635500 -- (-875.335) [-874.029] (-875.975) (-877.608) * (-875.914) (-880.045) [-876.046] (-879.320) -- 0:00:22
      636000 -- (-877.426) [-874.660] (-879.889) (-875.681) * (-874.680) [-878.018] (-875.260) (-878.834) -- 0:00:22
      636500 -- (-877.092) (-874.295) [-874.063] (-876.591) * (-876.235) (-875.641) (-876.791) [-874.740] -- 0:00:22
      637000 -- (-875.993) [-875.475] (-878.668) (-876.507) * (-874.640) (-879.124) [-876.896] (-875.674) -- 0:00:22
      637500 -- (-874.696) [-875.686] (-877.811) (-877.185) * (-876.154) [-878.416] (-876.193) (-876.482) -- 0:00:22
      638000 -- [-874.558] (-879.337) (-881.859) (-878.422) * (-874.583) (-876.906) (-877.020) [-874.773] -- 0:00:22
      638500 -- [-873.407] (-874.560) (-875.622) (-876.329) * (-874.598) [-875.166] (-875.975) (-874.869) -- 0:00:22
      639000 -- (-879.462) (-877.202) (-875.376) [-874.681] * (-876.827) (-876.647) [-878.335] (-880.239) -- 0:00:22
      639500 -- [-876.000] (-879.445) (-876.582) (-878.686) * (-875.973) [-874.235] (-880.682) (-875.950) -- 0:00:21
      640000 -- [-878.789] (-875.741) (-875.689) (-874.770) * (-875.016) (-875.375) (-876.324) [-877.308] -- 0:00:21

      Average standard deviation of split frequencies: 0.007947

      640500 -- (-874.595) (-875.130) (-876.672) [-873.931] * (-876.425) [-875.307] (-876.439) (-876.320) -- 0:00:21
      641000 -- (-877.661) [-880.105] (-874.086) (-877.879) * (-876.072) (-876.569) [-879.052] (-876.478) -- 0:00:21
      641500 -- (-874.201) (-879.258) [-874.650] (-874.864) * (-878.528) (-880.587) (-881.095) [-874.928] -- 0:00:21
      642000 -- [-876.413] (-876.732) (-874.999) (-878.916) * (-878.691) [-878.041] (-876.230) (-875.007) -- 0:00:21
      642500 -- (-874.547) [-874.506] (-876.697) (-878.088) * [-875.361] (-876.255) (-874.159) (-878.525) -- 0:00:21
      643000 -- (-876.536) (-875.404) (-876.729) [-875.492] * (-881.543) (-875.323) [-877.808] (-874.831) -- 0:00:21
      643500 -- (-874.298) (-875.673) (-876.016) [-878.330] * (-876.811) (-877.319) [-878.854] (-874.812) -- 0:00:21
      644000 -- (-875.846) [-874.936] (-875.055) (-875.627) * (-880.356) (-874.429) [-879.094] (-875.009) -- 0:00:21
      644500 -- (-877.633) (-875.467) [-876.277] (-874.527) * (-874.700) (-876.169) [-874.929] (-875.782) -- 0:00:21
      645000 -- (-874.640) (-876.541) [-881.939] (-874.222) * [-876.371] (-874.417) (-878.635) (-877.281) -- 0:00:21

      Average standard deviation of split frequencies: 0.007686

      645500 -- (-875.402) (-875.084) (-875.328) [-876.999] * (-875.155) (-877.026) (-877.357) [-875.718] -- 0:00:21
      646000 -- (-876.932) (-874.559) [-875.364] (-878.158) * [-874.470] (-875.339) (-877.821) (-877.467) -- 0:00:21
      646500 -- (-875.450) (-874.497) [-875.844] (-877.388) * [-875.448] (-875.203) (-873.614) (-878.753) -- 0:00:21
      647000 -- [-877.180] (-875.522) (-876.074) (-875.629) * (-877.308) (-875.966) (-875.979) [-876.976] -- 0:00:21
      647500 -- (-874.942) [-875.182] (-875.993) (-874.938) * (-876.777) [-878.845] (-877.913) (-878.061) -- 0:00:21
      648000 -- (-879.118) (-874.103) [-875.258] (-876.952) * [-875.852] (-874.167) (-874.989) (-875.523) -- 0:00:21
      648500 -- (-873.752) (-875.883) [-873.901] (-877.974) * (-874.900) (-874.024) [-875.403] (-875.219) -- 0:00:21
      649000 -- (-875.514) [-877.499] (-876.726) (-874.780) * (-876.192) (-873.506) [-874.539] (-875.558) -- 0:00:21
      649500 -- (-875.111) (-876.001) (-879.315) [-876.881] * (-877.654) [-873.482] (-876.092) (-873.986) -- 0:00:21
      650000 -- (-873.510) (-878.089) [-873.692] (-874.659) * (-876.202) (-874.461) (-874.783) [-877.195] -- 0:00:21

      Average standard deviation of split frequencies: 0.007776

      650500 -- (-874.867) (-876.625) (-873.692) [-874.944] * (-874.674) [-875.092] (-875.993) (-876.156) -- 0:00:21
      651000 -- (-874.281) [-875.059] (-877.066) (-878.294) * (-876.347) [-875.994] (-875.341) (-874.925) -- 0:00:21
      651500 -- (-876.768) (-875.468) [-876.713] (-875.610) * (-874.631) (-877.825) [-877.913] (-876.804) -- 0:00:21
      652000 -- (-874.575) (-880.570) (-874.322) [-876.283] * (-875.171) [-875.407] (-875.992) (-875.506) -- 0:00:21
      652500 -- (-876.470) (-879.073) (-874.256) [-874.518] * (-873.967) (-878.224) (-879.440) [-875.888] -- 0:00:21
      653000 -- (-874.589) (-875.331) [-874.924] (-881.262) * (-876.587) [-875.265] (-879.133) (-874.617) -- 0:00:21
      653500 -- (-876.050) (-876.407) (-873.643) [-874.576] * (-874.819) (-874.313) [-876.663] (-876.007) -- 0:00:21
      654000 -- [-876.447] (-876.089) (-876.394) (-875.615) * [-877.292] (-875.738) (-880.622) (-875.325) -- 0:00:21
      654500 -- [-874.671] (-877.704) (-875.098) (-878.464) * [-878.173] (-874.318) (-875.570) (-874.546) -- 0:00:21
      655000 -- (-876.065) [-875.024] (-875.038) (-879.995) * (-873.809) [-874.778] (-874.766) (-875.827) -- 0:00:21

      Average standard deviation of split frequencies: 0.007330

      655500 -- (-877.262) [-876.784] (-875.492) (-881.104) * (-874.823) (-873.973) [-878.679] (-873.625) -- 0:00:21
      656000 -- (-874.290) (-877.237) [-876.209] (-877.631) * (-876.501) (-877.031) (-879.465) [-875.978] -- 0:00:20
      656500 -- (-876.518) [-875.685] (-878.237) (-876.966) * (-874.759) [-877.710] (-879.376) (-876.306) -- 0:00:20
      657000 -- [-875.804] (-874.129) (-878.449) (-875.617) * [-875.069] (-876.165) (-880.965) (-875.513) -- 0:00:20
      657500 -- (-878.569) [-874.178] (-878.769) (-874.350) * (-876.555) [-874.338] (-878.607) (-876.570) -- 0:00:20
      658000 -- (-878.341) (-874.773) (-878.144) [-875.472] * (-875.420) (-877.608) (-875.406) [-876.163] -- 0:00:20
      658500 -- (-875.696) [-876.131] (-874.436) (-876.703) * (-875.222) (-878.579) (-876.969) [-875.633] -- 0:00:20
      659000 -- [-875.672] (-875.284) (-875.429) (-874.829) * [-875.314] (-875.044) (-875.299) (-876.429) -- 0:00:20
      659500 -- (-874.044) [-876.622] (-873.653) (-877.347) * [-875.424] (-874.760) (-873.858) (-874.622) -- 0:00:20
      660000 -- (-876.244) [-874.318] (-876.016) (-878.279) * [-874.699] (-876.986) (-873.629) (-874.178) -- 0:00:20

      Average standard deviation of split frequencies: 0.007468

      660500 -- (-877.041) (-875.974) [-875.960] (-877.201) * (-875.744) (-877.634) [-873.635] (-876.226) -- 0:00:20
      661000 -- (-876.222) (-877.506) (-874.049) [-878.120] * [-877.420] (-873.925) (-876.101) (-874.506) -- 0:00:20
      661500 -- [-873.886] (-874.993) (-873.614) (-876.269) * [-874.776] (-877.746) (-875.868) (-874.108) -- 0:00:20
      662000 -- (-875.213) (-875.073) [-875.900] (-877.080) * (-877.027) (-876.272) [-875.168] (-876.136) -- 0:00:20
      662500 -- (-875.568) [-875.784] (-873.525) (-875.292) * [-875.731] (-879.483) (-876.359) (-878.976) -- 0:00:20
      663000 -- (-881.342) [-874.319] (-876.232) (-875.068) * (-874.896) (-876.786) [-875.215] (-875.037) -- 0:00:20
      663500 -- (-883.463) (-876.998) (-875.932) [-875.153] * (-875.787) (-875.234) [-875.502] (-874.991) -- 0:00:20
      664000 -- [-879.964] (-876.663) (-875.242) (-878.008) * (-876.524) (-880.924) [-874.414] (-875.889) -- 0:00:20
      664500 -- [-875.514] (-875.850) (-874.805) (-878.002) * [-873.810] (-875.412) (-874.095) (-875.296) -- 0:00:20
      665000 -- (-876.372) (-876.026) [-873.997] (-877.114) * [-874.557] (-873.911) (-876.289) (-874.715) -- 0:00:20

      Average standard deviation of split frequencies: 0.007975

      665500 -- (-874.470) [-880.441] (-876.549) (-878.278) * (-874.246) [-875.171] (-873.743) (-874.900) -- 0:00:20
      666000 -- [-875.163] (-877.192) (-875.151) (-877.917) * (-877.639) (-874.053) [-878.852] (-874.551) -- 0:00:20
      666500 -- (-874.862) (-875.042) [-876.590] (-876.741) * (-874.886) [-873.835] (-874.774) (-874.800) -- 0:00:20
      667000 -- (-874.277) [-874.749] (-875.164) (-877.367) * (-877.511) (-874.453) [-876.302] (-874.164) -- 0:00:20
      667500 -- (-875.314) (-874.721) (-877.239) [-875.481] * (-876.714) [-874.231] (-879.488) (-875.393) -- 0:00:20
      668000 -- (-881.688) (-876.150) (-877.882) [-873.484] * (-878.663) (-875.209) (-877.372) [-875.877] -- 0:00:20
      668500 -- (-877.083) (-874.095) (-877.607) [-876.652] * (-876.163) (-874.150) (-881.457) [-876.277] -- 0:00:20
      669000 -- (-876.603) (-874.472) [-873.620] (-876.264) * (-877.524) (-874.079) [-877.834] (-876.765) -- 0:00:20
      669500 -- [-877.955] (-874.133) (-875.321) (-875.901) * (-876.756) (-873.860) [-880.264] (-876.541) -- 0:00:20
      670000 -- [-874.825] (-874.012) (-875.425) (-877.739) * (-877.679) (-877.577) (-873.694) [-876.554] -- 0:00:20

      Average standard deviation of split frequencies: 0.007826

      670500 -- [-877.603] (-876.007) (-875.767) (-874.242) * (-877.465) [-875.807] (-874.698) (-876.152) -- 0:00:20
      671000 -- [-875.090] (-876.760) (-877.109) (-879.535) * (-873.988) (-877.133) (-875.363) [-875.522] -- 0:00:20
      671500 -- (-874.969) (-879.962) [-874.559] (-874.894) * (-874.938) (-880.248) [-875.905] (-875.763) -- 0:00:20
      672000 -- (-874.916) (-878.211) [-873.892] (-875.934) * (-874.511) (-876.808) (-876.782) [-875.199] -- 0:00:20
      672500 -- (-875.083) [-875.424] (-873.699) (-873.827) * (-873.988) (-876.295) [-876.051] (-876.554) -- 0:00:19
      673000 -- (-873.658) (-876.197) (-874.345) [-874.031] * [-875.841] (-879.507) (-875.198) (-876.336) -- 0:00:19
      673500 -- [-874.560] (-874.615) (-877.570) (-875.507) * (-875.472) [-875.224] (-875.629) (-876.909) -- 0:00:19
      674000 -- (-874.673) (-874.938) [-873.932] (-875.482) * (-874.558) [-874.990] (-875.199) (-877.648) -- 0:00:19
      674500 -- (-874.169) [-875.073] (-875.957) (-877.135) * (-876.669) (-877.158) (-878.156) [-875.820] -- 0:00:19
      675000 -- (-875.930) [-874.461] (-880.920) (-878.783) * [-876.605] (-875.584) (-877.872) (-876.994) -- 0:00:19

      Average standard deviation of split frequencies: 0.007857

      675500 -- [-883.351] (-874.017) (-875.510) (-878.048) * [-876.387] (-874.909) (-874.430) (-873.952) -- 0:00:19
      676000 -- (-875.808) [-874.812] (-878.785) (-876.331) * (-875.225) [-874.452] (-876.399) (-873.427) -- 0:00:19
      676500 -- (-877.218) (-873.901) [-876.576] (-881.196) * (-877.238) (-876.609) [-873.623] (-877.268) -- 0:00:19
      677000 -- (-875.272) [-875.447] (-874.718) (-877.895) * (-876.238) (-876.005) [-874.571] (-877.325) -- 0:00:19
      677500 -- [-874.277] (-875.475) (-874.956) (-876.387) * (-876.930) [-873.665] (-874.837) (-874.224) -- 0:00:19
      678000 -- (-873.855) [-876.319] (-876.556) (-873.702) * (-881.087) (-874.354) [-874.958] (-878.319) -- 0:00:19
      678500 -- (-877.596) (-878.981) [-875.415] (-874.561) * [-875.169] (-873.512) (-878.625) (-876.009) -- 0:00:19
      679000 -- [-875.131] (-876.279) (-877.084) (-874.355) * (-876.550) (-875.887) (-875.159) [-878.361] -- 0:00:19
      679500 -- (-878.589) (-876.022) [-876.164] (-873.909) * [-873.387] (-873.955) (-879.786) (-874.010) -- 0:00:19
      680000 -- (-876.681) (-877.184) [-875.809] (-874.900) * [-873.387] (-875.549) (-878.424) (-873.911) -- 0:00:19

      Average standard deviation of split frequencies: 0.007618

      680500 -- (-875.009) (-874.546) [-874.936] (-876.506) * [-875.602] (-878.297) (-879.939) (-874.201) -- 0:00:19
      681000 -- [-873.636] (-874.526) (-876.683) (-879.593) * (-877.825) [-878.352] (-876.997) (-874.664) -- 0:00:19
      681500 -- [-874.502] (-877.579) (-875.000) (-877.777) * (-878.968) (-876.650) (-873.635) [-877.226] -- 0:00:19
      682000 -- (-873.994) (-873.886) (-877.445) [-877.957] * (-877.338) (-882.298) (-876.446) [-879.147] -- 0:00:19
      682500 -- (-874.705) (-874.715) (-877.596) [-874.530] * (-880.359) (-879.892) (-875.601) [-874.281] -- 0:00:19
      683000 -- (-875.678) (-878.998) (-880.323) [-874.819] * (-874.606) (-885.588) (-874.666) [-874.064] -- 0:00:19
      683500 -- (-888.704) (-876.782) [-874.401] (-876.199) * [-874.481] (-877.876) (-877.446) (-874.769) -- 0:00:19
      684000 -- [-873.784] (-875.803) (-873.762) (-875.091) * (-874.906) (-874.646) [-877.168] (-874.059) -- 0:00:19
      684500 -- [-875.539] (-873.655) (-874.060) (-874.571) * (-874.700) [-874.016] (-874.655) (-873.793) -- 0:00:19
      685000 -- (-873.743) (-875.992) (-874.050) [-873.979] * [-874.469] (-879.205) (-876.456) (-877.104) -- 0:00:19

      Average standard deviation of split frequencies: 0.007788

      685500 -- (-877.476) (-876.878) [-874.817] (-874.968) * (-876.530) (-880.522) (-878.055) [-873.589] -- 0:00:19
      686000 -- (-877.356) (-879.193) [-873.600] (-877.346) * (-874.981) [-876.109] (-878.703) (-873.822) -- 0:00:19
      686500 -- (-875.386) (-875.730) (-873.946) [-874.436] * (-877.495) (-874.788) [-877.860] (-874.224) -- 0:00:19
      687000 -- [-874.803] (-874.232) (-875.212) (-877.021) * (-877.082) [-878.289] (-877.547) (-874.089) -- 0:00:19
      687500 -- (-874.645) (-874.856) (-875.220) [-875.031] * [-876.560] (-875.385) (-875.960) (-874.882) -- 0:00:19
      688000 -- [-877.583] (-873.880) (-878.211) (-880.225) * (-880.242) [-875.726] (-881.040) (-874.411) -- 0:00:19
      688500 -- (-876.135) (-879.763) (-875.999) [-875.220] * (-877.382) (-874.348) [-876.571] (-877.985) -- 0:00:19
      689000 -- [-876.382] (-875.659) (-876.793) (-876.346) * [-876.010] (-876.480) (-875.381) (-877.693) -- 0:00:18
      689500 -- (-877.073) (-876.867) [-877.117] (-876.204) * (-878.064) (-879.674) (-877.432) [-875.601] -- 0:00:18
      690000 -- (-875.719) (-876.544) (-877.560) [-874.480] * (-880.429) [-875.662] (-878.461) (-875.887) -- 0:00:18

      Average standard deviation of split frequencies: 0.007917

      690500 -- (-876.490) (-874.927) [-875.343] (-875.300) * (-879.322) (-875.815) (-875.164) [-875.577] -- 0:00:18
      691000 -- (-875.543) [-874.995] (-879.059) (-873.835) * (-882.354) (-876.526) (-875.108) [-878.102] -- 0:00:18
      691500 -- (-876.104) [-876.459] (-875.712) (-873.600) * (-878.944) [-875.963] (-875.126) (-878.255) -- 0:00:18
      692000 -- (-875.456) (-875.253) [-876.635] (-874.106) * (-879.098) (-875.059) [-874.822] (-876.758) -- 0:00:18
      692500 -- [-876.307] (-873.579) (-879.057) (-876.703) * (-876.754) [-875.388] (-876.615) (-878.232) -- 0:00:18
      693000 -- [-874.724] (-874.267) (-879.296) (-875.181) * (-874.345) (-875.941) [-877.003] (-876.872) -- 0:00:18
      693500 -- (-877.615) (-874.256) [-875.863] (-879.254) * (-881.747) [-874.286] (-874.847) (-877.121) -- 0:00:18
      694000 -- [-874.494] (-875.265) (-877.923) (-875.281) * [-874.091] (-876.806) (-877.333) (-879.794) -- 0:00:18
      694500 -- (-876.285) [-873.497] (-881.528) (-874.776) * (-874.728) (-876.210) (-874.486) [-878.207] -- 0:00:18
      695000 -- (-876.659) (-878.427) [-876.825] (-874.917) * (-875.008) (-874.596) [-873.989] (-875.446) -- 0:00:18

      Average standard deviation of split frequencies: 0.007812

      695500 -- (-875.209) (-878.642) [-874.981] (-878.072) * (-875.351) (-875.728) (-875.139) [-875.534] -- 0:00:18
      696000 -- (-876.954) (-874.946) [-873.862] (-874.404) * [-879.806] (-876.918) (-878.582) (-877.848) -- 0:00:18
      696500 -- (-876.716) (-875.061) (-874.389) [-874.332] * (-876.270) [-873.893] (-875.066) (-876.201) -- 0:00:18
      697000 -- (-874.127) (-873.976) [-877.203] (-874.132) * (-879.897) [-875.536] (-877.652) (-874.246) -- 0:00:18
      697500 -- (-874.056) [-874.412] (-878.641) (-875.475) * (-874.149) (-875.537) (-877.783) [-873.756] -- 0:00:18
      698000 -- (-878.613) [-875.072] (-878.807) (-878.677) * (-874.446) (-875.110) [-874.462] (-876.594) -- 0:00:18
      698500 -- (-874.074) [-875.948] (-876.194) (-878.860) * [-874.728] (-874.418) (-876.428) (-878.122) -- 0:00:18
      699000 -- (-874.192) (-874.904) (-874.458) [-874.798] * (-876.242) [-875.921] (-875.987) (-874.575) -- 0:00:18
      699500 -- (-876.910) (-875.555) (-874.698) [-874.217] * (-876.308) (-877.365) [-875.294] (-876.742) -- 0:00:18
      700000 -- (-875.737) [-874.926] (-875.503) (-876.289) * [-878.269] (-875.357) (-875.547) (-875.007) -- 0:00:18

      Average standard deviation of split frequencies: 0.007849

      700500 -- (-874.428) (-874.946) [-877.825] (-878.836) * (-875.234) [-874.789] (-875.294) (-875.017) -- 0:00:18
      701000 -- [-874.967] (-883.424) (-874.600) (-874.704) * (-874.397) (-875.337) (-876.858) [-876.812] -- 0:00:18
      701500 -- (-875.741) (-873.702) (-875.531) [-874.291] * (-876.709) (-876.451) (-877.412) [-876.626] -- 0:00:18
      702000 -- (-875.772) (-874.823) (-880.494) [-877.577] * [-875.595] (-877.119) (-878.393) (-875.869) -- 0:00:18
      702500 -- (-875.327) [-878.489] (-876.732) (-875.732) * (-874.879) (-882.672) (-878.180) [-873.754] -- 0:00:18
      703000 -- (-874.701) (-881.599) [-875.754] (-873.982) * (-876.706) (-876.850) [-876.661] (-874.735) -- 0:00:18
      703500 -- (-874.264) (-875.458) [-879.094] (-876.629) * (-874.918) (-876.606) (-874.587) [-874.522] -- 0:00:18
      704000 -- (-874.451) [-874.300] (-877.524) (-875.517) * [-878.601] (-879.449) (-875.569) (-878.070) -- 0:00:18
      704500 -- [-875.077] (-875.407) (-875.565) (-876.384) * [-875.241] (-875.991) (-874.701) (-877.056) -- 0:00:18
      705000 -- (-874.553) (-874.618) (-874.145) [-877.531] * [-875.690] (-875.235) (-875.114) (-878.030) -- 0:00:17

      Average standard deviation of split frequencies: 0.007968

      705500 -- [-873.903] (-875.960) (-878.280) (-876.330) * [-874.526] (-881.704) (-876.192) (-875.103) -- 0:00:17
      706000 -- [-875.547] (-877.191) (-877.674) (-877.312) * (-874.755) [-876.741] (-878.670) (-874.562) -- 0:00:17
      706500 -- [-874.612] (-875.566) (-875.609) (-875.213) * [-875.726] (-878.021) (-877.004) (-875.512) -- 0:00:17
      707000 -- (-877.875) (-874.277) [-875.634] (-875.494) * (-881.037) [-875.187] (-874.890) (-874.987) -- 0:00:17
      707500 -- (-873.775) (-874.787) [-873.769] (-874.505) * (-878.182) (-874.749) [-873.994] (-874.926) -- 0:00:17
      708000 -- [-873.386] (-873.774) (-873.801) (-875.250) * [-875.175] (-876.957) (-876.334) (-874.125) -- 0:00:17
      708500 -- [-873.956] (-874.881) (-873.885) (-875.861) * [-875.315] (-879.074) (-877.576) (-877.569) -- 0:00:17
      709000 -- (-874.076) [-873.929] (-873.885) (-878.327) * (-875.860) (-875.534) [-879.972] (-874.522) -- 0:00:17
      709500 -- (-874.320) (-874.642) (-879.813) [-874.595] * (-875.582) [-874.446] (-878.703) (-879.888) -- 0:00:17
      710000 -- (-874.044) [-875.306] (-878.968) (-873.441) * (-874.621) (-877.290) [-876.560] (-877.118) -- 0:00:17

      Average standard deviation of split frequencies: 0.007380

      710500 -- [-876.318] (-876.721) (-876.659) (-874.370) * (-876.068) (-879.182) (-876.276) [-877.741] -- 0:00:17
      711000 -- [-874.629] (-876.819) (-876.449) (-875.820) * [-876.771] (-877.852) (-876.712) (-878.486) -- 0:00:17
      711500 -- (-875.734) (-875.000) (-875.314) [-878.112] * (-876.105) (-877.180) (-875.963) [-877.391] -- 0:00:17
      712000 -- (-875.071) (-875.902) [-875.193] (-876.394) * [-877.168] (-876.264) (-876.937) (-874.290) -- 0:00:17
      712500 -- (-874.231) (-875.102) [-874.462] (-875.482) * [-874.975] (-877.904) (-878.024) (-877.325) -- 0:00:17
      713000 -- (-873.815) (-876.503) (-877.442) [-875.122] * (-875.859) (-876.446) [-875.805] (-879.114) -- 0:00:17
      713500 -- (-873.815) [-874.634] (-875.942) (-874.071) * (-878.583) (-876.913) (-878.652) [-878.322] -- 0:00:17
      714000 -- (-875.394) (-875.464) (-874.922) [-877.702] * (-876.103) (-881.002) [-874.474] (-879.733) -- 0:00:17
      714500 -- (-873.587) (-874.588) [-876.533] (-880.872) * (-876.392) (-877.861) [-873.849] (-875.416) -- 0:00:17
      715000 -- [-874.817] (-874.646) (-874.086) (-875.914) * (-873.817) [-876.069] (-874.239) (-875.291) -- 0:00:17

      Average standard deviation of split frequencies: 0.007242

      715500 -- (-874.011) (-877.853) (-874.132) [-875.230] * (-875.540) [-874.595] (-873.771) (-880.463) -- 0:00:17
      716000 -- [-874.257] (-873.865) (-875.573) (-874.804) * [-877.164] (-874.654) (-875.241) (-875.912) -- 0:00:17
      716500 -- [-874.723] (-874.477) (-875.560) (-875.128) * [-877.087] (-873.865) (-875.993) (-873.992) -- 0:00:17
      717000 -- (-876.136) (-876.121) [-875.549] (-874.219) * (-880.499) [-874.142] (-875.495) (-874.562) -- 0:00:17
      717500 -- (-875.021) [-878.353] (-877.308) (-881.970) * (-881.610) (-876.857) (-877.521) [-876.864] -- 0:00:17
      718000 -- [-876.226] (-878.992) (-875.950) (-874.316) * [-875.087] (-877.661) (-878.021) (-874.246) -- 0:00:17
      718500 -- [-875.214] (-876.740) (-876.071) (-880.338) * (-875.724) (-875.321) [-876.445] (-874.405) -- 0:00:17
      719000 -- (-881.167) [-873.770] (-875.744) (-876.762) * (-874.055) (-875.195) (-875.048) [-875.134] -- 0:00:17
      719500 -- [-875.547] (-874.439) (-875.699) (-875.608) * (-877.644) (-876.923)