--- EXPERIMENT NOTES Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500 --- EXPERIMENT PROPERTIES --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/mrbayes_input.nex.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1137.57 -1148.79 2 -1137.58 -1149.81 -------------------------------------- TOTAL -1137.57 -1149.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/mrbayes_input.nex.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.055752 0.000133 0.034925 0.078134 0.054568 1143.17 1257.78 1.000 r(A<->C){all} 0.134661 0.003567 0.030913 0.254384 0.127570 469.02 611.46 1.000 r(A<->G){all} 0.176013 0.004119 0.052163 0.293553 0.169420 470.02 561.53 1.001 r(A<->T){all} 0.059485 0.001406 0.000033 0.131165 0.053183 452.37 534.03 1.001 r(C<->G){all} 0.084981 0.002880 0.000173 0.191168 0.075875 491.64 509.57 1.000 r(C<->T){all} 0.344982 0.006469 0.199141 0.502817 0.338709 678.52 681.85 1.001 r(G<->T){all} 0.199877 0.004387 0.075444 0.327170 0.195841 495.83 614.45 1.001 pi(A){all} 0.251697 0.000276 0.219531 0.284867 0.251695 938.93 1164.32 1.000 pi(C){all} 0.225184 0.000243 0.195861 0.256535 0.224815 1150.03 1211.36 1.000 pi(G){all} 0.209728 0.000231 0.181366 0.240873 0.209306 961.35 1159.48 1.000 pi(T){all} 0.313391 0.000313 0.280244 0.347870 0.313146 1067.31 1136.26 1.000 alpha{1,2} 0.879031 0.888504 0.000174 2.826837 0.567818 983.33 1110.22 1.000 alpha{3} 1.396129 1.276684 0.002101 3.552859 1.091005 1302.26 1310.03 1.000 pinvar{all} 0.332767 0.046524 0.000028 0.714439 0.314464 634.58 660.52 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. --- CODEML SUMMARY
-- Starting log on Thu Oct 20 00:46:27 GMT 2022 -- -- Iteration: /working_dir/input/2_modified/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result-- CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=8, Len=229 C1 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C2 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C3 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C4 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C5 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C6 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C7 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C8 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL .*.*** * *::********************************** C1 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C2 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C3 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C4 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C5 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C6 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C7 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C8 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV *************************************:************ C1 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C2 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C3 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C4 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C5 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C6 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C7 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C8 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG ************************************************** C1 TLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAF C2 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C3 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C4 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C5 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C6 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C7 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C8 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF ********:***************.************************* C1 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C2 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C3 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C4 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C5 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C6 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C7 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C8 YVRSKNGDYSAVTSSADSLTEDEKLLHLV ***************************** -- Starting log on Thu Oct 20 00:47:02 GMT 2022 -- -- Iteration: /working_dir/input/2_modified/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result-- CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=997, Nseq=8, Len=229 C1 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C2 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C3 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C4 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C5 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C6 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C7 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C8 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL .*.*** * *::********************************** C1 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C2 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C3 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C4 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C5 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C6 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C7 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C8 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV *************************************:************ C1 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C2 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C3 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C4 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C5 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C6 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C7 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C8 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG ************************************************** C1 TLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAF C2 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C3 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C4 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C5 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C6 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C7 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C8 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF ********:***************.************************* C1 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C2 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C3 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C4 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C5 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C6 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C7 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C8 YVRSKNGDYSAVTSSADSLTEDEKLLHLV ***************************** -- Starting log on Thu Oct 20 00:46:27 GMT 2022 -- -- Iteration: /working_dir/input/2_modified/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result-- CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=8, Len=229 C1 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C2 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C3 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C4 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C5 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C6 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C7 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL C8 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL .*.*** * *::********************************** C1 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C2 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C3 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C4 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C5 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV C6 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C7 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV C8 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV *************************************:************ C1 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C2 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C3 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C4 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C5 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C6 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C7 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG C8 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG ************************************************** C1 TLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAF C2 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C3 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C4 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C5 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C6 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C7 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF C8 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF ********:***************.************************* C1 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C2 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C3 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C4 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C5 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C6 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C7 YVRSKNGDYSAVTSSADSLTEDEKLLHLV C8 YVRSKNGDYSAVTSSADSLTEDEKLLHLV ***************************** -- Starting log on Thu Oct 20 00:54:01 GMT 2022 -- -- Iteration: /working_dir/pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/gapped_alignment/fubar,175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1-- MrBayes v3.2.6 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/mrbayes_input.nex" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 8 taxa and 687 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1666227246 Setting output file names to "/data/mrbayes_input.nex.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called 'first_pos' Defining charset called 'second_pos' Defining charset called 'third_pos' Defining partition called 'by_codon' Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 387537157 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5401703558 Seed = 563528414 Swapseed = 1666227246 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma The distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Shape parameter is exponentially distributed with parameter (1.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma The distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Shape parameter is exponentially distributed with parameter (1.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma The distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Shape parameter is exponentially distributed with parameter (1.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Active parameters: Partition(s) Parameters 1 2 3 --------------------------- Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 --------------------------- Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(1.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(1.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:GammaDir(1.0,0.1000,1.0,1.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 0.91 % Dirichlet(Revmat{all}) 0.91 % Slider(Revmat{all}) 0.91 % Dirichlet(Pi{all}) 0.91 % Slider(Pi{all}) 1.82 % Multiplier(Alpha{1,2}) 1.82 % Multiplier(Alpha{3}) 1.82 % Slider(Pinvar{all}) 9.09 % ExtSPR(Tau{all},V{all}) 9.09 % ExtTBR(Tau{all},V{all}) 9.09 % NNI(Tau{all},V{all}) 9.09 % ParsSPR(Tau{all},V{all}) 36.36 % Multiplier(V{all}) 12.73 % Nodeslider(V{all}) 5.45 % TLMultiplier(V{all}) Division 1 has 15 unique site patterns Division 2 has 11 unique site patterns Division 3 has 17 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -1313.593730 -- 29.153684 Chain 2 -- -1306.792191 -- 29.153684 Chain 3 -- -1306.142125 -- 29.153684 Chain 4 -- -1306.042308 -- 29.153684 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -1313.803563 -- 29.153684 Chain 2 -- -1305.361167 -- 29.153684 Chain 3 -- -1306.141780 -- 29.153684 Chain 4 -- -1278.756898 -- 29.153684 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-1313.594] (-1306.792) (-1306.142) (-1306.042) * [-1313.804] (-1305.361) (-1306.142) (-1278.757) 1000 -- (-1145.406) (-1151.766) [-1146.070] (-1148.983) * (-1152.128) (-1154.940) (-1144.994) [-1146.691] -- 0:00:00 2000 -- (-1148.203) (-1153.901) (-1147.616) [-1149.007] * (-1146.394) [-1145.014] (-1143.738) (-1154.650) -- 0:00:00 3000 -- (-1145.574) (-1145.427) [-1144.206] (-1152.945) * (-1143.891) (-1143.217) [-1144.308] (-1141.957) -- 0:00:00 4000 -- [-1144.870] (-1144.223) (-1143.554) (-1145.878) * (-1154.885) (-1145.063) (-1144.182) [-1144.430] -- 0:04:09 5000 -- [-1139.866] (-1149.161) (-1140.888) (-1141.588) * [-1143.359] (-1142.029) (-1149.860) (-1150.084) -- 0:03:19 Average standard deviation of split frequencies: 0.087297 6000 -- [-1140.934] (-1143.854) (-1147.463) (-1143.865) * [-1139.321] (-1145.215) (-1146.343) (-1139.218) -- 0:02:45 7000 -- (-1141.724) [-1142.335] (-1143.684) (-1149.201) * [-1146.575] (-1140.905) (-1137.178) (-1144.963) -- 0:02:21 8000 -- (-1142.141) [-1141.764] (-1147.921) (-1140.363) * (-1148.980) (-1142.590) (-1139.953) [-1148.502] -- 0:02:04 9000 -- [-1138.046] (-1146.640) (-1143.090) (-1151.154) * [-1145.717] (-1142.698) (-1139.931) (-1147.253) -- 0:03:40 10000 -- [-1136.822] (-1150.472) (-1147.386) (-1138.135) * (-1146.736) [-1142.617] (-1145.717) (-1148.643) -- 0:03:18 Average standard deviation of split frequencies: 0.066291 11000 -- (-1144.992) (-1143.930) [-1144.092] (-1143.771) * (-1145.654) [-1141.138] (-1147.226) (-1146.902) -- 0:02:59 12000 -- [-1144.221] (-1152.934) (-1142.389) (-1137.480) * (-1143.063) (-1145.790) (-1147.758) [-1147.132] -- 0:02:44 13000 -- (-1145.080) (-1145.636) [-1139.510] (-1141.353) * [-1144.165] (-1145.131) (-1145.991) (-1140.248) -- 0:02:31 14000 -- [-1140.668] (-1141.018) (-1145.071) (-1140.767) * [-1140.297] (-1145.520) (-1144.312) (-1140.019) -- 0:03:31 15000 -- (-1143.343) (-1149.719) (-1142.977) [-1137.575] * (-1160.064) (-1147.172) [-1150.753] (-1139.254) -- 0:03:17 Average standard deviation of split frequencies: 0.029463 16000 -- (-1146.218) [-1142.419] (-1139.704) (-1136.124) * (-1141.970) [-1138.535] (-1143.978) (-1138.147) -- 0:03:04 17000 -- (-1145.470) (-1143.419) [-1140.548] (-1145.279) * (-1146.846) (-1144.848) [-1146.017] (-1146.263) -- 0:02:53 18000 -- (-1138.420) (-1138.924) (-1141.065) [-1137.703] * [-1144.220] (-1148.258) (-1142.344) (-1137.842) -- 0:02:43 19000 -- [-1147.497] (-1145.323) (-1151.951) (-1140.021) * (-1138.806) (-1150.082) [-1138.472] (-1139.834) -- 0:03:26 20000 -- (-1143.642) (-1144.953) (-1153.133) [-1135.905] * (-1144.537) (-1150.461) (-1145.955) [-1138.359] -- 0:03:16 Average standard deviation of split frequencies: 0.028512 21000 -- (-1151.326) (-1139.302) (-1147.371) [-1135.880] * (-1144.550) [-1143.844] (-1149.806) (-1150.377) -- 0:03:06 22000 -- (-1145.253) (-1145.478) (-1143.986) [-1142.292] * (-1142.926) (-1150.442) (-1147.497) [-1138.729] -- 0:02:57 23000 -- (-1141.337) [-1139.562] (-1138.879) (-1144.608) * [-1143.074] (-1138.894) (-1143.044) (-1146.675) -- 0:02:49 24000 -- (-1146.113) (-1149.270) (-1140.752) [-1137.824] * [-1142.081] (-1143.459) (-1147.764) (-1145.501) -- 0:03:23 25000 -- [-1147.559] (-1143.258) (-1148.353) (-1146.589) * (-1145.145) (-1151.436) (-1150.931) [-1143.191] -- 0:03:15 Average standard deviation of split frequencies: 0.037657 26000 -- (-1147.656) (-1148.411) [-1141.972] (-1139.686) * [-1140.772] (-1141.094) (-1151.278) (-1144.634) -- 0:03:07 27000 -- (-1139.509) [-1139.951] (-1138.925) (-1151.887) * (-1143.567) (-1150.562) [-1143.491] (-1139.740) -- 0:03:00 28000 -- (-1141.618) (-1146.663) [-1134.661] (-1143.733) * (-1142.885) (-1140.065) [-1141.437] (-1144.172) -- 0:02:53 29000 -- (-1139.446) (-1145.934) (-1142.255) [-1141.506] * (-1152.843) (-1133.758) (-1150.264) [-1141.103] -- 0:03:20 30000 -- (-1140.463) (-1153.749) [-1138.267] (-1144.583) * [-1147.373] (-1145.041) (-1139.752) (-1147.523) -- 0:03:14 Average standard deviation of split frequencies: 0.039021 31000 -- (-1145.071) [-1139.234] (-1144.414) (-1152.162) * (-1145.546) [-1141.483] (-1143.584) (-1143.343) -- 0:03:07 32000 -- (-1138.547) [-1138.755] (-1140.047) (-1146.320) * (-1142.171) [-1142.560] (-1141.110) (-1146.154) -- 0:03:01 33000 -- (-1143.592) (-1148.469) (-1148.370) [-1154.358] * (-1146.181) (-1142.778) [-1140.447] (-1148.604) -- 0:02:55 34000 -- (-1142.645) (-1145.289) (-1139.004) [-1143.985] * (-1142.548) [-1152.209] (-1138.370) (-1148.608) -- 0:03:18 35000 -- (-1149.978) (-1151.273) [-1136.661] (-1143.862) * (-1149.264) [-1142.571] (-1134.942) (-1147.114) -- 0:03:13 Average standard deviation of split frequencies: 0.031226 36000 -- (-1138.602) [-1145.574] (-1141.915) (-1149.347) * [-1134.269] (-1144.547) (-1135.846) (-1143.759) -- 0:03:07 37000 -- (-1145.913) (-1140.195) [-1142.166] (-1141.004) * [-1143.011] (-1145.041) (-1141.485) (-1151.259) -- 0:03:02 38000 -- (-1141.161) (-1147.271) [-1143.334] (-1145.861) * (-1139.557) [-1136.211] (-1145.961) (-1147.142) -- 0:02:57 39000 -- [-1144.952] (-1146.457) (-1139.680) (-1148.030) * (-1144.753) (-1138.916) [-1141.390] (-1145.583) -- 0:03:17 40000 -- [-1141.599] (-1147.527) (-1143.367) (-1146.243) * (-1142.588) (-1146.497) [-1140.193] (-1148.830) -- 0:03:12 Average standard deviation of split frequencies: 0.036559 41000 -- (-1140.570) (-1145.439) [-1141.544] (-1139.129) * (-1137.759) [-1139.880] (-1146.364) (-1144.914) -- 0:03:07 42000 -- [-1142.807] (-1144.095) (-1148.442) (-1141.463) * [-1137.050] (-1141.023) (-1137.295) (-1156.166) -- 0:03:02 43000 -- (-1145.434) (-1141.258) [-1146.337] (-1141.758) * (-1145.561) [-1135.598] (-1141.539) (-1142.850) -- 0:03:20 44000 -- (-1140.809) (-1137.382) [-1142.608] (-1142.256) * (-1142.074) (-1141.646) [-1144.645] (-1145.399) -- 0:03:15 45000 -- (-1150.525) (-1142.827) (-1141.979) [-1146.277] * (-1143.422) [-1142.909] (-1144.028) (-1147.123) -- 0:03:11 Average standard deviation of split frequencies: 0.035474 46000 -- [-1139.728] (-1142.770) (-1140.868) (-1142.112) * (-1142.891) (-1142.071) [-1139.124] (-1146.299) -- 0:03:06 47000 -- (-1144.081) (-1142.570) (-1138.887) [-1143.147] * (-1154.548) [-1148.354] (-1141.636) (-1147.273) -- 0:03:02 48000 -- (-1145.731) (-1149.456) (-1143.262) [-1150.060] * (-1139.237) (-1148.278) [-1141.686] (-1142.117) -- 0:03:18 49000 -- [-1137.714] (-1147.556) (-1139.887) (-1146.112) * (-1140.018) (-1154.580) [-1137.606] (-1141.973) -- 0:03:14 50000 -- (-1148.367) [-1139.088] (-1146.903) (-1143.916) * (-1139.476) [-1146.054] (-1142.624) (-1144.573) -- 0:03:10 Average standard deviation of split frequencies: 0.025049 51000 -- (-1136.841) [-1139.046] (-1143.524) (-1145.445) * (-1138.915) [-1143.341] (-1143.275) (-1145.543) -- 0:03:06 52000 -- (-1138.035) (-1140.413) (-1140.165) [-1142.524] * [-1144.123] (-1143.426) (-1139.320) (-1144.599) -- 0:03:02 53000 -- (-1136.075) (-1145.186) [-1137.151] (-1145.464) * (-1153.941) (-1142.014) [-1143.074] (-1153.491) -- 0:03:16 54000 -- [-1145.279] (-1139.473) (-1149.019) (-1147.161) * (-1145.883) (-1141.054) [-1140.064] (-1153.041) -- 0:03:12 55000 -- (-1147.617) [-1145.679] (-1138.850) (-1145.565) * (-1147.831) (-1147.388) (-1136.787) [-1144.305] -- 0:03:09 Average standard deviation of split frequencies: 0.029139 56000 -- (-1153.986) (-1140.338) (-1145.592) [-1135.532] * (-1147.882) (-1145.474) [-1145.197] (-1144.219) -- 0:03:05 57000 -- (-1144.609) (-1146.784) (-1149.377) [-1138.847] * [-1144.298] (-1140.078) (-1140.575) (-1141.801) -- 0:03:01 58000 -- (-1139.477) [-1137.879] (-1150.859) (-1140.735) * (-1143.381) (-1144.682) [-1140.900] (-1140.432) -- 0:03:14 59000 -- (-1143.759) (-1138.870) [-1138.772] (-1140.863) * [-1143.666] (-1146.925) (-1140.073) (-1151.118) -- 0:03:11 60000 -- (-1151.253) [-1144.646] (-1138.396) (-1140.615) * [-1142.871] (-1150.862) (-1144.082) (-1149.308) -- 0:03:08 Average standard deviation of split frequencies: 0.029886 61000 -- (-1149.801) (-1138.360) [-1141.179] (-1138.786) * (-1145.205) [-1148.427] (-1139.217) (-1143.616) -- 0:03:04 62000 -- [-1144.294] (-1141.496) (-1139.838) (-1134.423) * (-1144.021) [-1141.579] (-1140.992) (-1146.312) -- 0:03:01 63000 -- [-1142.694] (-1144.235) (-1140.030) (-1140.990) * (-1147.250) (-1151.780) (-1137.136) [-1145.010] -- 0:03:13 64000 -- (-1143.892) (-1151.012) (-1141.743) [-1139.968] * [-1144.570] (-1147.126) (-1148.205) (-1141.191) -- 0:03:10 65000 -- (-1145.806) (-1144.865) (-1143.437) [-1138.583] * (-1140.287) [-1145.315] (-1145.804) (-1144.650) -- 0:03:07 Average standard deviation of split frequencies: 0.027471 66000 -- [-1139.155] (-1145.598) (-1147.445) (-1148.862) * [-1140.065] (-1151.333) (-1143.938) (-1144.307) -- 0:03:03 67000 -- [-1143.981] (-1143.746) (-1142.222) (-1144.461) * [-1140.513] (-1150.467) (-1140.210) (-1145.278) -- 0:03:01 68000 -- [-1143.969] (-1141.763) (-1137.573) (-1137.693) * (-1151.830) (-1143.802) [-1141.004] (-1146.927) -- 0:03:11 69000 -- (-1139.896) (-1148.843) [-1141.287] (-1138.531) * (-1138.872) (-1146.797) (-1141.449) [-1138.312] -- 0:03:08 70000 -- (-1149.528) (-1140.366) (-1149.359) [-1143.645] * [-1137.283] (-1144.577) (-1147.694) (-1152.970) -- 0:03:06 Average standard deviation of split frequencies: 0.028736 71000 -- (-1146.978) (-1139.555) (-1140.356) [-1137.781] * (-1141.285) (-1143.656) (-1142.950) [-1136.483] -- 0:03:03 72000 -- (-1150.943) [-1145.890] (-1139.015) (-1149.339) * (-1138.821) (-1147.709) (-1148.313) [-1141.204] -- 0:03:00 73000 -- (-1149.574) (-1144.805) (-1142.756) [-1140.461] * (-1143.475) [-1151.777] (-1140.168) (-1142.267) -- 0:03:10 74000 -- (-1143.170) [-1148.120] (-1146.468) (-1141.359) * [-1145.049] (-1152.852) (-1148.125) (-1145.008) -- 0:03:07 75000 -- (-1145.508) (-1138.735) (-1136.970) [-1139.488] * [-1142.805] (-1153.444) (-1148.728) (-1134.165) -- 0:03:05 Average standard deviation of split frequencies: 0.032922 76000 -- (-1149.362) (-1142.106) (-1142.021) [-1139.763] * (-1143.323) (-1153.336) (-1154.059) [-1141.758] -- 0:03:02 77000 -- (-1147.456) [-1146.076] (-1144.596) (-1137.313) * [-1139.730] (-1155.669) (-1148.339) (-1138.417) -- 0:03:11 78000 -- (-1142.163) [-1137.361] (-1145.026) (-1149.829) * (-1143.187) [-1144.670] (-1145.339) (-1140.177) -- 0:03:09 79000 -- (-1142.072) (-1144.295) (-1143.192) [-1137.686] * (-1148.307) (-1141.140) [-1143.341] (-1136.923) -- 0:03:06 80000 -- [-1141.960] (-1142.715) (-1139.629) (-1145.650) * (-1144.789) [-1151.208] (-1149.589) (-1145.988) -- 0:03:04 Average standard deviation of split frequencies: 0.029219 81000 -- (-1150.148) (-1140.840) [-1137.958] (-1143.503) * [-1139.850] (-1149.121) (-1145.284) (-1140.831) -- 0:03:01 82000 -- [-1141.018] (-1150.516) (-1145.440) (-1142.377) * [-1144.753] (-1158.497) (-1146.331) (-1143.181) -- 0:03:10 83000 -- (-1144.194) [-1146.351] (-1144.359) (-1138.161) * (-1146.670) (-1146.631) (-1139.337) [-1142.124] -- 0:03:07 84000 -- (-1145.806) (-1142.888) (-1145.585) [-1140.673] * (-1148.055) [-1138.549] (-1149.209) (-1155.576) -- 0:03:05 85000 -- (-1139.366) (-1146.247) [-1146.559] (-1143.504) * (-1150.042) (-1136.602) (-1147.683) [-1136.598] -- 0:03:03 Average standard deviation of split frequencies: 0.030780 86000 -- [-1144.339] (-1151.456) (-1147.125) (-1147.585) * (-1136.989) [-1143.671] (-1139.958) (-1141.126) -- 0:03:00 87000 -- (-1143.310) (-1142.682) (-1141.591) [-1137.541] * [-1144.324] (-1137.191) (-1142.950) (-1145.353) -- 0:03:08 88000 -- (-1138.833) [-1150.345] (-1148.894) (-1136.449) * (-1144.488) [-1143.716] (-1152.374) (-1134.999) -- 0:03:06 89000 -- [-1137.159] (-1157.800) (-1140.125) (-1146.576) * [-1152.479] (-1146.952) (-1143.329) (-1137.132) -- 0:03:04 90000 -- (-1142.404) [-1142.744] (-1150.240) (-1143.483) * (-1147.478) [-1140.341] (-1143.475) (-1137.624) -- 0:03:02 Average standard deviation of split frequencies: 0.020797 91000 -- (-1148.450) (-1148.103) (-1139.566) [-1138.272] * (-1141.877) (-1142.537) [-1137.752] (-1141.700) -- 0:02:59 92000 -- [-1135.883] (-1148.986) (-1144.940) (-1144.792) * (-1136.905) (-1140.945) [-1143.023] (-1149.542) -- 0:03:07 93000 -- (-1149.157) (-1139.110) [-1144.949] (-1141.845) * (-1141.907) [-1148.757] (-1145.627) (-1138.682) -- 0:03:05 94000 -- [-1137.202] (-1148.170) (-1139.264) (-1141.930) * (-1149.071) (-1147.859) [-1138.572] (-1142.799) -- 0:03:03 95000 -- (-1139.714) (-1138.205) (-1146.897) [-1138.729] * (-1136.996) (-1145.820) [-1141.740] (-1142.119) -- 0:03:01 Average standard deviation of split frequencies: 0.021530 96000 -- (-1140.194) (-1145.916) (-1145.591) [-1137.757] * (-1145.134) (-1143.854) (-1145.166) [-1137.339] -- 0:02:58 97000 -- (-1140.048) (-1144.442) [-1141.731] (-1144.405) * (-1144.709) (-1138.063) [-1145.924] (-1143.259) -- 0:03:06 98000 -- (-1141.801) (-1140.071) [-1140.877] (-1141.977) * (-1148.748) (-1146.437) [-1147.243] (-1142.576) -- 0:03:04 99000 -- [-1138.220] (-1145.625) (-1145.657) (-1142.954) * (-1142.751) [-1146.632] (-1141.714) (-1148.397) -- 0:03:02 100000 -- (-1138.344) (-1141.701) [-1146.531] (-1143.883) * (-1147.054) (-1152.340) (-1141.952) [-1136.269] -- 0:03:00 Average standard deviation of split frequencies: 0.020172 101000 -- (-1141.010) (-1147.803) [-1142.947] (-1138.681) * (-1141.220) (-1139.336) (-1147.158) [-1145.586] -- 0:02:58 102000 -- [-1137.844] (-1144.880) (-1147.237) (-1138.599) * (-1136.327) (-1145.364) (-1139.376) [-1135.938] -- 0:03:04 103000 -- [-1139.877] (-1139.452) (-1146.225) (-1140.762) * (-1142.388) [-1140.080] (-1146.382) (-1138.542) -- 0:03:02 104000 -- (-1153.355) (-1144.182) (-1140.898) [-1144.982] * [-1144.997] (-1144.875) (-1142.202) (-1142.658) -- 0:03:00 105000 -- (-1146.074) (-1153.186) (-1148.018) [-1139.488] * (-1146.543) [-1145.900] (-1138.606) (-1139.796) -- 0:02:59 Average standard deviation of split frequencies: 0.019157 106000 -- [-1142.798] (-1147.156) (-1147.561) (-1139.206) * (-1146.910) (-1139.629) [-1142.799] (-1146.319) -- 0:02:57 107000 -- [-1145.417] (-1149.234) (-1147.855) (-1142.379) * (-1149.526) (-1140.005) [-1140.002] (-1143.821) -- 0:03:03 108000 -- [-1138.838] (-1143.259) (-1145.381) (-1139.208) * (-1145.218) [-1142.874] (-1138.969) (-1148.261) -- 0:03:01 109000 -- (-1138.512) [-1136.518] (-1141.908) (-1145.314) * [-1142.555] (-1145.245) (-1138.490) (-1143.354) -- 0:02:59 110000 -- (-1145.671) [-1147.050] (-1138.121) (-1144.205) * (-1148.603) (-1138.586) (-1143.167) [-1138.227] -- 0:02:58 Average standard deviation of split frequencies: 0.019988 111000 -- (-1141.835) (-1153.918) (-1141.408) [-1146.367] * (-1141.802) (-1137.153) (-1152.557) [-1139.253] -- 0:02:56 112000 -- (-1141.543) (-1142.525) [-1138.094] (-1138.154) * (-1137.874) (-1141.392) (-1140.487) [-1139.863] -- 0:03:02 113000 -- (-1144.778) [-1137.971] (-1143.942) (-1143.632) * [-1143.859] (-1146.357) (-1138.202) (-1137.050) -- 0:03:00 114000 -- [-1139.430] (-1141.734) (-1146.247) (-1148.591) * (-1144.261) [-1144.250] (-1144.883) (-1136.349) -- 0:02:58 115000 -- (-1143.123) (-1145.974) [-1139.580] (-1138.804) * [-1138.068] (-1145.205) (-1144.018) (-1141.333) -- 0:02:57 Average standard deviation of split frequencies: 0.019381 116000 -- (-1145.451) (-1146.628) [-1137.378] (-1139.338) * (-1141.376) (-1145.014) [-1140.514] (-1142.460) -- 0:02:55 117000 -- (-1143.404) [-1144.289] (-1137.397) (-1143.489) * [-1140.517] (-1136.634) (-1145.438) (-1143.917) -- 0:03:01 118000 -- (-1143.536) [-1146.151] (-1145.270) (-1147.197) * (-1143.145) (-1142.187) [-1142.387] (-1143.632) -- 0:02:59 119000 -- (-1138.750) (-1139.608) (-1143.325) [-1140.789] * [-1137.694] (-1143.366) (-1150.467) (-1143.289) -- 0:02:57 120000 -- (-1138.934) [-1142.401] (-1154.994) (-1138.973) * (-1150.234) (-1143.379) (-1144.711) [-1146.490] -- 0:02:56 Average standard deviation of split frequencies: 0.016829 121000 -- (-1145.133) (-1140.105) (-1141.792) [-1138.959] * (-1146.183) (-1143.981) [-1143.520] (-1145.856) -- 0:02:54 122000 -- (-1147.155) [-1139.693] (-1140.735) (-1146.927) * (-1143.969) (-1139.650) (-1145.039) [-1140.929] -- 0:02:59 123000 -- (-1145.974) (-1147.050) [-1142.934] (-1140.954) * (-1144.290) [-1143.014] (-1140.088) (-1148.971) -- 0:02:58 124000 -- [-1141.600] (-1139.605) (-1146.710) (-1148.064) * (-1146.818) (-1147.605) (-1139.593) [-1147.379] -- 0:02:56 125000 -- (-1143.778) (-1143.400) (-1147.377) [-1149.755] * (-1139.551) (-1159.523) [-1137.680] (-1148.491) -- 0:02:55 Average standard deviation of split frequencies: 0.017555 126000 -- [-1139.571] (-1150.549) (-1145.661) (-1154.908) * (-1148.615) (-1156.541) [-1139.543] (-1149.580) -- 0:02:53 127000 -- (-1146.773) (-1141.045) (-1145.940) [-1147.976] * (-1144.492) (-1146.705) [-1136.688] (-1153.470) -- 0:02:58 128000 -- (-1144.892) [-1141.239] (-1145.440) (-1144.321) * (-1146.247) (-1151.577) [-1137.950] (-1146.613) -- 0:02:57 129000 -- (-1145.603) (-1146.489) (-1143.340) [-1144.472] * (-1153.159) (-1149.208) (-1145.144) [-1148.876] -- 0:02:55 130000 -- (-1155.833) [-1137.775] (-1137.985) (-1134.510) * (-1147.101) (-1141.148) (-1149.995) [-1146.658] -- 0:02:54 Average standard deviation of split frequencies: 0.017761 131000 -- (-1143.750) [-1139.062] (-1151.023) (-1137.709) * [-1141.572] (-1157.501) (-1145.131) (-1142.598) -- 0:02:59 132000 -- (-1142.723) [-1139.868] (-1141.089) (-1143.415) * (-1144.109) (-1152.360) (-1141.644) [-1135.702] -- 0:02:57 133000 -- (-1153.111) [-1140.078] (-1144.539) (-1145.735) * (-1145.188) (-1149.650) (-1140.086) [-1140.002] -- 0:02:56 134000 -- (-1144.258) [-1134.559] (-1142.031) (-1142.345) * (-1148.510) (-1141.494) [-1134.515] (-1141.353) -- 0:02:54 135000 -- (-1144.938) [-1144.046] (-1139.113) (-1144.004) * (-1143.116) [-1139.939] (-1144.446) (-1147.063) -- 0:02:53 Average standard deviation of split frequencies: 0.017064 136000 -- (-1147.340) (-1155.602) (-1138.141) [-1141.964] * (-1140.140) (-1143.841) (-1139.559) [-1140.871] -- 0:02:57 137000 -- (-1154.110) [-1143.288] (-1142.860) (-1144.335) * (-1150.433) (-1144.453) (-1146.448) [-1142.726] -- 0:02:56 138000 -- (-1151.002) (-1144.070) (-1144.455) [-1146.488] * (-1143.273) (-1141.963) (-1144.259) [-1145.092] -- 0:02:54 139000 -- (-1152.202) [-1141.692] (-1141.854) (-1138.354) * (-1144.451) (-1142.352) (-1138.667) [-1141.329] -- 0:02:53 140000 -- (-1143.933) (-1139.297) (-1142.828) [-1136.471] * (-1146.779) [-1142.626] (-1145.682) (-1145.508) -- 0:02:52 Average standard deviation of split frequencies: 0.019592 141000 -- (-1147.211) [-1139.672] (-1148.512) (-1140.653) * (-1146.001) [-1140.331] (-1140.604) (-1139.960) -- 0:02:56 142000 -- [-1143.497] (-1150.356) (-1150.713) (-1139.484) * (-1146.966) [-1154.155] (-1142.337) (-1144.564) -- 0:02:55 143000 -- (-1150.387) (-1150.751) [-1145.736] (-1141.132) * (-1139.340) [-1139.990] (-1146.091) (-1138.912) -- 0:02:53 144000 -- [-1143.277] (-1138.518) (-1143.362) (-1152.432) * (-1144.032) (-1140.940) (-1144.635) [-1146.669] -- 0:02:52 145000 -- (-1139.809) (-1146.202) (-1145.742) [-1138.995] * (-1140.934) (-1143.870) [-1138.354] (-1142.654) -- 0:02:51 Average standard deviation of split frequencies: 0.019124 146000 -- (-1138.656) (-1151.301) [-1136.615] (-1143.690) * (-1150.658) (-1141.863) (-1145.796) [-1147.052] -- 0:02:55 147000 -- (-1142.275) (-1143.912) (-1148.156) [-1142.542] * (-1161.086) (-1136.879) [-1144.532] (-1147.387) -- 0:02:54 148000 -- (-1150.049) [-1141.996] (-1140.034) (-1150.277) * (-1146.538) (-1142.714) [-1142.423] (-1141.930) -- 0:02:52 149000 -- (-1145.203) (-1141.184) (-1144.784) [-1139.874] * (-1143.871) (-1141.716) (-1142.351) [-1141.849] -- 0:02:51 150000 -- (-1157.845) (-1140.868) [-1142.254] (-1143.611) * (-1145.324) (-1149.727) (-1143.093) [-1141.099] -- 0:02:50 Average standard deviation of split frequencies: 0.020698 151000 -- (-1140.420) (-1142.650) [-1145.686] (-1146.218) * (-1144.487) (-1136.556) (-1143.223) [-1142.121] -- 0:02:54 152000 -- (-1143.100) (-1140.043) (-1146.603) [-1144.231] * (-1144.036) [-1142.956] (-1140.093) (-1142.368) -- 0:02:52 153000 -- (-1140.573) (-1144.427) [-1140.789] (-1149.504) * (-1145.175) (-1135.531) (-1141.843) [-1140.442] -- 0:02:51 154000 -- (-1138.283) (-1149.440) (-1135.291) [-1140.641] * (-1141.487) (-1147.285) (-1139.395) [-1140.353] -- 0:02:50 155000 -- (-1141.057) (-1146.278) (-1140.652) [-1142.416] * [-1140.383] (-1142.835) (-1141.664) (-1138.498) -- 0:02:49 Average standard deviation of split frequencies: 0.020920 156000 -- [-1147.505] (-1147.240) (-1140.715) (-1145.677) * (-1149.388) (-1148.757) (-1140.451) [-1137.475] -- 0:02:53 157000 -- (-1142.652) (-1142.208) (-1141.022) [-1137.891] * (-1147.037) (-1140.640) [-1141.013] (-1153.960) -- 0:02:51 158000 -- (-1151.421) (-1144.094) (-1141.937) [-1143.579] * (-1141.401) [-1147.311] (-1141.657) (-1142.274) -- 0:02:50 159000 -- (-1146.879) (-1144.326) (-1140.732) [-1139.911] * (-1136.939) [-1143.926] (-1149.906) (-1152.544) -- 0:02:49 160000 -- (-1146.576) (-1144.358) [-1145.268] (-1147.678) * (-1150.960) (-1141.568) (-1137.116) [-1137.534] -- 0:02:48 Average standard deviation of split frequencies: 0.020313 161000 -- (-1148.861) (-1140.639) (-1139.000) [-1147.818] * (-1149.069) (-1143.143) [-1142.698] (-1143.124) -- 0:02:51 162000 -- (-1139.369) (-1144.223) (-1144.777) [-1143.793] * (-1139.950) [-1137.093] (-1146.682) (-1139.745) -- 0:02:50 163000 -- [-1139.793] (-1140.377) (-1145.738) (-1146.246) * [-1143.517] (-1141.734) (-1146.038) (-1142.189) -- 0:02:49 164000 -- (-1144.236) [-1140.460] (-1140.304) (-1143.622) * [-1145.926] (-1143.689) (-1146.715) (-1141.230) -- 0:02:48 165000 -- (-1146.154) (-1143.328) (-1147.208) [-1141.336] * (-1144.731) [-1138.261] (-1145.331) (-1150.974) -- 0:02:52 Average standard deviation of split frequencies: 0.019660 166000 -- (-1144.210) (-1142.203) [-1140.690] (-1146.649) * (-1140.139) (-1141.167) (-1152.405) [-1145.194] -- 0:02:50 167000 -- (-1150.051) (-1136.524) [-1142.761] (-1146.766) * (-1149.123) (-1144.400) [-1149.274] (-1145.170) -- 0:02:49 168000 -- (-1140.940) (-1151.676) [-1139.840] (-1144.537) * (-1142.879) (-1148.816) [-1142.502] (-1142.064) -- 0:02:48 169000 -- (-1146.869) (-1139.675) (-1141.785) [-1141.313] * (-1141.791) (-1142.229) (-1139.816) [-1138.906] -- 0:02:47 170000 -- (-1140.989) (-1143.598) (-1142.792) [-1138.304] * (-1144.886) [-1147.550] (-1145.271) (-1149.847) -- 0:02:50 Average standard deviation of split frequencies: 0.017423 171000 -- [-1147.197] (-1150.757) (-1146.436) (-1145.766) * (-1138.892) [-1136.608] (-1148.953) (-1139.806) -- 0:02:49 172000 -- [-1139.664] (-1142.842) (-1142.791) (-1138.340) * (-1148.732) [-1140.755] (-1140.470) (-1136.459) -- 0:02:48 173000 -- [-1141.296] (-1142.351) (-1146.280) (-1145.356) * (-1140.150) (-1140.920) (-1139.739) [-1145.123] -- 0:02:47 174000 -- (-1144.144) (-1149.005) (-1143.517) [-1141.453] * (-1141.537) (-1143.099) [-1135.750] (-1143.145) -- 0:02:46 175000 -- (-1143.835) (-1141.916) [-1145.160] (-1139.480) * (-1145.545) [-1137.509] (-1141.956) (-1143.463) -- 0:02:49 Average standard deviation of split frequencies: 0.018955 176000 -- [-1144.230] (-1144.777) (-1136.437) (-1155.068) * (-1140.946) [-1135.019] (-1138.447) (-1147.048) -- 0:02:48 177000 -- (-1150.157) (-1148.604) (-1140.464) [-1143.480] * (-1146.771) (-1137.774) [-1144.375] (-1150.416) -- 0:02:47 178000 -- (-1147.708) (-1140.799) [-1140.090] (-1138.786) * (-1145.142) (-1141.140) (-1149.995) [-1136.979] -- 0:02:46 179000 -- [-1136.297] (-1139.716) (-1137.013) (-1147.737) * (-1143.789) (-1143.754) (-1142.431) [-1137.269] -- 0:02:45 180000 -- (-1140.821) (-1142.738) [-1140.822] (-1137.977) * (-1138.005) (-1144.497) [-1134.830] (-1140.409) -- 0:02:48 Average standard deviation of split frequencies: 0.018867 181000 -- [-1145.708] (-1143.802) (-1144.669) (-1145.343) * (-1138.540) (-1155.497) (-1139.327) [-1140.019] -- 0:02:47 182000 -- (-1141.773) (-1149.128) (-1141.190) [-1143.001] * [-1138.676] (-1144.001) (-1141.426) (-1147.045) -- 0:02:46 183000 -- (-1140.537) (-1142.388) [-1140.508] (-1146.022) * (-1140.801) (-1142.243) [-1141.213] (-1141.926) -- 0:02:45 184000 -- (-1140.452) [-1145.380] (-1145.441) (-1138.241) * (-1145.632) (-1148.053) [-1139.764] (-1140.317) -- 0:02:44 185000 -- (-1156.707) [-1141.279] (-1146.136) (-1141.474) * (-1141.139) (-1138.422) [-1137.358] (-1140.554) -- 0:02:47 Average standard deviation of split frequencies: 0.018131 186000 -- [-1140.818] (-1138.212) (-1141.398) (-1142.165) * (-1145.160) (-1156.606) [-1142.815] (-1145.854) -- 0:02:46 187000 -- [-1142.911] (-1147.425) (-1136.156) (-1140.981) * (-1146.964) [-1139.904] (-1139.482) (-1151.563) -- 0:02:45 188000 -- (-1139.848) [-1139.334] (-1134.460) (-1143.835) * (-1142.953) [-1141.036] (-1145.847) (-1136.118) -- 0:02:44 189000 -- (-1144.163) (-1147.069) (-1143.895) [-1141.168] * (-1141.136) [-1146.127] (-1144.129) (-1142.346) -- 0:02:43 190000 -- (-1144.657) (-1137.074) (-1137.085) [-1145.496] * (-1146.196) (-1138.707) [-1138.537] (-1148.860) -- 0:02:46 Average standard deviation of split frequencies: 0.017307 191000 -- (-1140.798) (-1145.503) [-1140.886] (-1142.525) * (-1142.478) (-1150.506) (-1146.103) [-1136.966] -- 0:02:45 192000 -- (-1140.457) [-1143.764] (-1138.970) (-1137.031) * (-1142.875) (-1139.325) (-1148.582) [-1139.943] -- 0:02:44 193000 -- [-1145.153] (-1146.759) (-1144.931) (-1139.813) * (-1147.880) (-1141.382) [-1140.479] (-1141.179) -- 0:02:43 194000 -- (-1141.885) [-1142.043] (-1145.053) (-1146.885) * (-1140.965) [-1142.734] (-1145.768) (-1144.380) -- 0:02:42 195000 -- (-1145.353) (-1154.213) (-1139.133) [-1146.332] * (-1137.623) (-1143.747) [-1138.960] (-1145.796) -- 0:02:45 Average standard deviation of split frequencies: 0.014061 196000 -- (-1150.849) (-1146.044) [-1140.935] (-1137.631) * [-1138.191] (-1148.952) (-1139.594) (-1148.394) -- 0:02:44 197000 -- (-1144.339) (-1146.532) [-1136.913] (-1144.378) * (-1145.509) (-1143.822) [-1135.658] (-1144.729) -- 0:02:43 198000 -- [-1139.762] (-1144.973) (-1155.995) (-1144.428) * (-1153.019) (-1145.798) (-1148.147) [-1136.987] -- 0:02:42 199000 -- (-1140.196) (-1140.492) (-1148.698) [-1141.934] * [-1140.510] (-1140.200) (-1142.211) (-1143.073) -- 0:02:41 200000 -- (-1141.753) [-1146.908] (-1141.876) (-1139.100) * (-1145.250) (-1144.155) [-1137.151] (-1143.474) -- 0:02:44 Average standard deviation of split frequencies: 0.014637 201000 -- (-1153.680) (-1142.889) (-1149.369) [-1145.319] * [-1136.445] (-1147.873) (-1141.626) (-1140.273) -- 0:02:42 202000 -- (-1151.167) (-1152.492) (-1146.619) [-1141.987] * (-1140.514) (-1155.346) [-1137.133] (-1138.048) -- 0:02:41 203000 -- (-1140.427) (-1144.180) [-1139.660] (-1143.115) * (-1152.911) (-1141.112) [-1141.225] (-1151.093) -- 0:02:40 204000 -- [-1148.137] (-1136.695) (-1143.578) (-1142.613) * (-1140.187) [-1146.815] (-1139.750) (-1146.767) -- 0:02:39 205000 -- (-1157.321) (-1140.601) (-1145.227) [-1139.771] * [-1137.696] (-1144.741) (-1140.547) (-1142.491) -- 0:02:42 Average standard deviation of split frequencies: 0.013554 206000 -- (-1144.772) (-1139.567) (-1140.455) [-1140.379] * (-1147.612) (-1141.166) (-1142.476) [-1142.246] -- 0:02:41 207000 -- (-1137.886) (-1137.182) (-1151.774) [-1139.101] * [-1147.088] (-1140.776) (-1139.922) (-1139.434) -- 0:02:40 208000 -- (-1153.722) [-1144.495] (-1147.609) (-1145.994) * [-1143.247] (-1143.161) (-1147.880) (-1143.851) -- 0:02:39 209000 -- [-1141.845] (-1147.338) (-1141.956) (-1144.838) * (-1145.883) (-1144.416) (-1139.820) [-1148.654] -- 0:02:38 210000 -- [-1144.001] (-1153.515) (-1142.435) (-1145.379) * [-1149.738] (-1150.717) (-1142.287) (-1148.520) -- 0:02:41 Average standard deviation of split frequencies: 0.012910 211000 -- [-1138.589] (-1147.272) (-1143.028) (-1152.211) * (-1150.368) (-1140.219) [-1143.851] (-1143.004) -- 0:02:40 212000 -- [-1136.575] (-1141.247) (-1150.442) (-1142.353) * (-1141.363) (-1137.082) (-1141.943) [-1137.077] -- 0:02:39 213000 -- (-1139.183) (-1146.812) [-1138.600] (-1144.162) * (-1147.527) (-1138.079) [-1138.738] (-1142.534) -- 0:02:38 214000 -- (-1144.197) (-1146.961) [-1139.128] (-1141.262) * (-1139.463) [-1139.224] (-1140.427) (-1145.431) -- 0:02:41 215000 -- (-1149.595) [-1140.490] (-1141.520) (-1147.482) * [-1139.195] (-1149.257) (-1143.443) (-1145.832) -- 0:02:40 Average standard deviation of split frequencies: 0.012423 216000 -- (-1139.038) [-1146.136] (-1139.402) (-1140.624) * (-1147.826) (-1141.189) (-1149.503) [-1144.124] -- 0:02:39 217000 -- (-1146.957) (-1144.185) (-1145.357) [-1137.033] * (-1151.856) [-1136.849] (-1143.122) (-1143.694) -- 0:02:38 218000 -- [-1138.689] (-1146.324) (-1152.069) (-1147.800) * (-1143.771) (-1141.695) (-1144.054) [-1135.488] -- 0:02:37 219000 -- (-1138.626) (-1144.690) [-1139.715] (-1137.694) * (-1143.556) [-1142.617] (-1152.785) (-1148.476) -- 0:02:40 220000 -- (-1137.220) (-1145.970) [-1148.600] (-1136.853) * [-1139.076] (-1140.187) (-1140.310) (-1146.615) -- 0:02:39 Average standard deviation of split frequencies: 0.010681 221000 -- (-1150.625) (-1144.537) (-1141.603) [-1139.895] * (-1141.590) (-1145.961) [-1147.759] (-1143.583) -- 0:02:38 222000 -- (-1140.671) [-1137.098] (-1148.948) (-1144.850) * (-1139.766) [-1137.443] (-1144.707) (-1140.524) -- 0:02:37 223000 -- (-1138.512) (-1141.478) [-1146.281] (-1136.816) * (-1140.959) (-1145.560) (-1143.600) [-1136.475] -- 0:02:36 224000 -- (-1138.093) (-1144.240) [-1136.265] (-1156.116) * (-1150.603) (-1141.950) [-1143.922] (-1144.845) -- 0:02:39 225000 -- (-1145.240) (-1143.632) (-1147.079) [-1140.340] * (-1148.712) (-1146.425) (-1140.494) [-1138.879] -- 0:02:38 Average standard deviation of split frequencies: 0.010911 226000 -- (-1137.587) (-1145.261) (-1144.446) [-1141.834] * (-1140.644) (-1141.682) [-1144.963] (-1150.651) -- 0:02:37 227000 -- (-1142.691) (-1151.688) [-1141.946] (-1144.435) * (-1141.043) (-1149.467) [-1139.861] (-1141.523) -- 0:02:36 228000 -- (-1141.321) (-1144.737) [-1138.743] (-1135.246) * (-1141.579) (-1147.568) (-1145.281) [-1137.342] -- 0:02:35 229000 -- (-1145.378) (-1139.957) (-1140.946) [-1148.448] * (-1140.370) (-1143.984) [-1145.283] (-1144.781) -- 0:02:38 230000 -- (-1141.790) [-1142.292] (-1142.845) (-1141.156) * [-1144.065] (-1143.244) (-1138.039) (-1140.583) -- 0:02:37 Average standard deviation of split frequencies: 0.009747 231000 -- (-1137.421) [-1140.360] (-1140.451) (-1147.195) * (-1146.941) [-1146.742] (-1146.612) (-1147.438) -- 0:02:36 232000 -- [-1140.655] (-1143.341) (-1146.236) (-1139.420) * [-1140.188] (-1140.255) (-1145.364) (-1142.620) -- 0:02:35 233000 -- (-1146.525) (-1144.171) [-1143.405] (-1140.315) * (-1145.377) (-1143.001) [-1142.970] (-1142.594) -- 0:02:34 234000 -- [-1139.827] (-1145.618) (-1142.510) (-1140.580) * (-1142.902) (-1139.298) [-1143.530] (-1151.790) -- 0:02:37 235000 -- [-1136.191] (-1140.617) (-1144.671) (-1152.777) * [-1142.708] (-1141.709) (-1148.463) (-1143.187) -- 0:02:36 Average standard deviation of split frequencies: 0.009373 236000 -- (-1146.393) (-1148.864) (-1149.537) [-1145.372] * (-1144.610) (-1144.110) (-1150.531) [-1138.395] -- 0:02:35 237000 -- [-1146.485] (-1150.491) (-1148.071) (-1147.072) * (-1143.824) (-1143.635) (-1145.019) [-1143.241] -- 0:02:34 238000 -- (-1141.790) (-1145.238) [-1138.354] (-1150.057) * [-1137.898] (-1141.850) (-1154.034) (-1146.910) -- 0:02:33 239000 -- (-1143.829) (-1145.989) (-1141.178) [-1140.405] * [-1146.591] (-1143.080) (-1150.335) (-1152.762) -- 0:02:36 240000 -- [-1146.735] (-1141.967) (-1155.392) (-1142.820) * (-1142.281) [-1147.563] (-1149.009) (-1134.433) -- 0:02:35 Average standard deviation of split frequencies: 0.008739 241000 -- [-1143.000] (-1143.372) (-1153.512) (-1143.942) * (-1138.698) (-1147.175) (-1145.409) [-1142.997] -- 0:02:34 242000 -- [-1140.045] (-1149.584) (-1142.098) (-1145.367) * (-1157.905) (-1145.269) [-1140.128] (-1158.429) -- 0:02:33 243000 -- (-1138.389) [-1143.834] (-1143.691) (-1148.631) * (-1149.070) [-1142.193] (-1145.120) (-1140.773) -- 0:02:32 244000 -- (-1141.690) (-1145.092) (-1143.406) [-1143.476] * (-1143.242) [-1141.149] (-1143.699) (-1144.621) -- 0:02:34 245000 -- [-1139.367] (-1143.456) (-1144.289) (-1146.737) * (-1143.433) (-1145.646) [-1145.585] (-1137.870) -- 0:02:34 Average standard deviation of split frequencies: 0.008697 246000 -- (-1138.830) [-1140.183] (-1146.919) (-1150.605) * [-1144.165] (-1139.217) (-1152.393) (-1154.065) -- 0:02:33 247000 -- [-1139.647] (-1145.228) (-1144.818) (-1150.913) * [-1140.592] (-1145.881) (-1149.237) (-1143.757) -- 0:02:32 248000 -- (-1135.936) (-1145.865) [-1141.894] (-1148.948) * (-1147.699) (-1142.936) (-1145.972) [-1140.153] -- 0:02:31 249000 -- (-1137.481) (-1139.132) [-1145.614] (-1148.535) * (-1147.489) [-1141.819] (-1142.575) (-1142.910) -- 0:02:33 250000 -- (-1144.734) [-1143.605] (-1145.649) (-1143.159) * (-1138.368) (-1147.698) [-1138.645] (-1139.037) -- 0:02:33 Average standard deviation of split frequencies: 0.008535 251000 -- (-1138.404) [-1136.934] (-1138.928) (-1146.420) * (-1143.898) (-1148.237) [-1143.117] (-1144.759) -- 0:02:32 252000 -- [-1142.877] (-1148.793) (-1145.397) (-1144.676) * [-1139.627] (-1157.867) (-1151.159) (-1140.063) -- 0:02:31 253000 -- [-1140.858] (-1144.834) (-1139.629) (-1143.072) * (-1141.088) (-1147.381) [-1140.468] (-1139.540) -- 0:02:30 254000 -- (-1143.335) (-1141.402) (-1146.537) [-1140.045] * (-1145.051) (-1143.142) [-1140.867] (-1140.686) -- 0:02:32 255000 -- (-1153.184) [-1143.251] (-1145.757) (-1144.712) * (-1144.096) [-1141.357] (-1143.154) (-1140.115) -- 0:02:31 Average standard deviation of split frequencies: 0.009915 256000 -- (-1159.940) [-1143.444] (-1145.060) (-1155.671) * (-1155.135) (-1156.404) [-1141.884] (-1139.170) -- 0:02:31 257000 -- (-1153.446) (-1149.052) [-1138.492] (-1141.103) * (-1143.258) [-1142.580] (-1143.772) (-1150.023) -- 0:02:30 258000 -- (-1147.059) [-1143.262] (-1145.731) (-1138.935) * (-1141.205) (-1142.433) [-1141.199] (-1144.986) -- 0:02:29 259000 -- (-1139.101) [-1142.573] (-1140.704) (-1141.217) * (-1143.222) [-1137.699] (-1148.680) (-1146.625) -- 0:02:31 260000 -- (-1141.034) (-1147.722) (-1141.093) [-1133.610] * [-1145.547] (-1139.313) (-1161.397) (-1145.691) -- 0:02:30 Average standard deviation of split frequencies: 0.009599 261000 -- [-1141.654] (-1150.434) (-1140.954) (-1145.796) * (-1141.866) [-1141.338] (-1149.695) (-1144.194) -- 0:02:30 262000 -- (-1144.203) [-1145.214] (-1138.474) (-1145.504) * (-1155.755) [-1146.931] (-1143.547) (-1144.447) -- 0:02:29 263000 -- (-1141.260) (-1137.397) [-1143.024] (-1137.622) * [-1141.216] (-1149.095) (-1141.139) (-1138.586) -- 0:02:28 264000 -- (-1146.325) (-1140.469) [-1140.208] (-1140.562) * (-1145.450) (-1146.110) (-1153.302) [-1140.429] -- 0:02:30 265000 -- (-1152.488) (-1141.152) (-1145.276) [-1139.569] * (-1140.229) [-1137.164] (-1144.898) (-1146.296) -- 0:02:29 Average standard deviation of split frequencies: 0.009679 266000 -- (-1143.122) (-1149.539) (-1145.280) [-1138.953] * (-1144.059) [-1143.718] (-1144.619) (-1149.367) -- 0:02:29 267000 -- (-1149.811) (-1144.733) [-1140.625] (-1143.856) * [-1137.180] (-1135.376) (-1139.951) (-1144.397) -- 0:02:28 268000 -- (-1144.257) [-1140.709] (-1147.969) (-1147.384) * (-1141.829) (-1147.155) [-1141.587] (-1145.602) -- 0:02:27 269000 -- (-1146.612) (-1143.853) [-1136.446] (-1143.558) * (-1141.324) (-1139.333) [-1143.799] (-1160.616) -- 0:02:29 270000 -- (-1151.211) (-1141.700) [-1142.916] (-1143.224) * [-1143.408] (-1144.699) (-1142.406) (-1148.968) -- 0:02:28 Average standard deviation of split frequencies: 0.010718 271000 -- (-1153.615) [-1138.771] (-1139.314) (-1142.060) * [-1140.073] (-1145.890) (-1147.589) (-1141.299) -- 0:02:27 272000 -- (-1144.369) (-1141.450) (-1142.918) [-1144.037] * (-1139.507) (-1144.969) (-1139.918) [-1137.631] -- 0:02:27 273000 -- (-1142.619) (-1149.377) (-1146.016) [-1138.858] * (-1149.837) (-1140.544) (-1140.196) [-1144.717] -- 0:02:29 274000 -- (-1150.035) [-1145.931] (-1136.792) (-1144.996) * (-1144.220) [-1141.336] (-1145.926) (-1140.951) -- 0:02:28 275000 -- (-1148.530) (-1143.290) (-1135.712) [-1146.716] * [-1144.096] (-1137.576) (-1144.256) (-1143.461) -- 0:02:27 Average standard deviation of split frequencies: 0.010379 276000 -- (-1143.311) (-1139.827) [-1147.431] (-1141.820) * [-1143.453] (-1136.624) (-1138.395) (-1149.980) -- 0:02:26 277000 -- (-1151.915) (-1144.588) (-1139.198) [-1139.048] * [-1139.969] (-1139.798) (-1139.601) (-1149.667) -- 0:02:26 278000 -- (-1140.957) [-1137.481] (-1142.610) (-1147.521) * (-1142.101) [-1143.951] (-1134.866) (-1151.759) -- 0:02:28 279000 -- (-1142.247) (-1150.216) [-1142.755] (-1142.377) * (-1146.953) (-1141.657) (-1139.751) [-1138.315] -- 0:02:27 280000 -- (-1141.111) (-1144.845) [-1139.619] (-1139.987) * (-1151.011) (-1149.951) [-1137.990] (-1145.947) -- 0:02:26 Average standard deviation of split frequencies: 0.010207 281000 -- (-1136.683) (-1149.567) [-1144.498] (-1140.214) * (-1142.287) (-1149.642) (-1145.843) [-1145.514] -- 0:02:25 282000 -- (-1158.865) (-1139.434) (-1149.521) [-1142.364] * [-1145.235] (-1142.525) (-1142.215) (-1139.833) -- 0:02:25 283000 -- (-1144.361) (-1148.512) [-1139.207] (-1146.209) * [-1145.230] (-1139.009) (-1143.097) (-1140.128) -- 0:02:26 284000 -- [-1137.545] (-1161.297) (-1138.765) (-1143.034) * (-1153.355) (-1145.138) (-1140.570) [-1138.672] -- 0:02:26 285000 -- (-1151.990) [-1145.298] (-1148.771) (-1145.208) * [-1146.971] (-1141.806) (-1137.139) (-1144.982) -- 0:02:25 Average standard deviation of split frequencies: 0.009890 286000 -- (-1146.254) [-1145.865] (-1144.023) (-1148.458) * (-1146.303) [-1140.473] (-1142.229) (-1141.567) -- 0:02:24 287000 -- (-1141.310) (-1141.811) [-1144.447] (-1147.812) * (-1142.515) [-1142.266] (-1148.658) (-1146.500) -- 0:02:24 288000 -- [-1139.900] (-1145.837) (-1139.318) (-1140.338) * [-1139.000] (-1139.337) (-1139.763) (-1139.037) -- 0:02:25 289000 -- (-1142.639) [-1141.367] (-1138.469) (-1146.562) * (-1142.329) (-1139.009) (-1143.621) [-1140.199] -- 0:02:25 290000 -- (-1141.287) (-1153.637) (-1143.491) [-1145.431] * (-1137.758) [-1143.216] (-1146.882) (-1150.352) -- 0:02:24 Average standard deviation of split frequencies: 0.008982 291000 -- (-1146.406) (-1150.736) [-1138.797] (-1141.875) * (-1143.475) (-1146.168) [-1144.363] (-1142.034) -- 0:02:23 292000 -- [-1141.680] (-1144.380) (-1137.399) (-1144.463) * [-1146.334] (-1146.790) (-1140.279) (-1141.061) -- 0:02:23 293000 -- (-1141.003) [-1137.916] (-1142.035) (-1144.591) * (-1141.072) (-1144.327) [-1138.126] (-1147.406) -- 0:02:24 294000 -- [-1136.242] (-1152.144) (-1151.081) (-1146.541) * (-1150.941) (-1149.062) (-1140.118) [-1145.948] -- 0:02:24 295000 -- (-1147.250) (-1139.303) (-1150.229) [-1141.449] * (-1143.121) (-1142.822) [-1142.900] (-1135.564) -- 0:02:23 Average standard deviation of split frequencies: 0.010046 296000 -- (-1139.972) (-1144.321) (-1157.617) [-1150.323] * (-1155.828) (-1145.372) (-1148.300) [-1140.292] -- 0:02:22 297000 -- [-1138.353] (-1142.875) (-1148.983) (-1142.172) * (-1142.811) [-1143.890] (-1146.672) (-1142.285) -- 0:02:22 298000 -- (-1141.977) [-1140.343] (-1145.881) (-1141.434) * (-1141.350) (-1144.550) [-1144.422] (-1143.572) -- 0:02:23 299000 -- (-1149.166) (-1138.169) [-1146.569] (-1142.333) * (-1156.762) (-1146.715) [-1142.430] (-1148.318) -- 0:02:23 300000 -- (-1139.493) (-1143.070) (-1149.188) [-1141.174] * (-1148.040) [-1144.486] (-1142.278) (-1136.506) -- 0:02:22 Average standard deviation of split frequencies: 0.010493 301000 -- [-1142.588] (-1145.824) (-1147.279) (-1145.711) * (-1141.937) (-1144.064) [-1141.016] (-1144.353) -- 0:02:21 302000 -- (-1139.070) (-1152.187) (-1135.720) [-1140.301] * (-1147.347) (-1144.636) (-1147.829) [-1137.062] -- 0:02:20 303000 -- (-1145.583) [-1143.367] (-1139.421) (-1140.908) * (-1143.782) [-1139.928] (-1140.088) (-1140.017) -- 0:02:22 304000 -- (-1142.920) [-1142.476] (-1143.153) (-1150.068) * (-1137.141) (-1152.594) [-1135.786] (-1138.141) -- 0:02:21 305000 -- (-1140.968) [-1146.006] (-1144.260) (-1139.803) * (-1140.107) (-1141.531) (-1142.540) [-1143.216] -- 0:02:21 Average standard deviation of split frequencies: 0.011613 306000 -- (-1146.713) (-1143.066) (-1142.956) [-1141.752] * (-1138.497) (-1146.788) [-1142.531] (-1139.700) -- 0:02:20 307000 -- (-1146.897) (-1136.336) (-1140.578) [-1139.690] * (-1144.909) (-1156.838) (-1144.194) [-1139.444] -- 0:02:19 308000 -- (-1142.577) (-1141.928) [-1141.050] (-1142.619) * (-1141.796) [-1137.187] (-1143.267) (-1139.285) -- 0:02:21 309000 -- (-1145.970) [-1140.596] (-1140.059) (-1145.224) * (-1140.586) [-1138.907] (-1147.310) (-1138.680) -- 0:02:20 310000 -- [-1137.786] (-1137.314) (-1142.956) (-1151.416) * (-1145.771) (-1142.955) (-1153.224) [-1139.803] -- 0:02:20 Average standard deviation of split frequencies: 0.010738 311000 -- (-1140.391) (-1149.320) (-1139.222) [-1144.378] * [-1143.169] (-1142.537) (-1145.608) (-1141.585) -- 0:02:19 312000 -- (-1143.691) (-1139.600) [-1138.869] (-1149.706) * (-1140.797) [-1139.506] (-1138.005) (-1140.843) -- 0:02:18 313000 -- (-1143.644) (-1144.634) (-1146.665) [-1142.682] * [-1143.838] (-1148.154) (-1139.883) (-1147.842) -- 0:02:20 314000 -- (-1148.765) (-1144.753) [-1144.218] (-1143.734) * (-1151.697) (-1142.057) [-1142.429] (-1142.610) -- 0:02:19 315000 -- [-1140.676] (-1154.254) (-1148.883) (-1140.724) * (-1143.295) (-1140.910) [-1146.409] (-1136.968) -- 0:02:19 Average standard deviation of split frequencies: 0.009410 316000 -- [-1154.209] (-1148.464) (-1141.606) (-1148.019) * (-1146.593) [-1142.303] (-1140.834) (-1139.498) -- 0:02:18 317000 -- (-1142.545) (-1150.719) (-1141.205) [-1142.491] * (-1147.188) (-1143.061) [-1143.660] (-1143.020) -- 0:02:17 318000 -- (-1139.929) (-1139.905) (-1149.898) [-1143.016] * (-1139.072) (-1146.561) [-1142.603] (-1138.387) -- 0:02:19 319000 -- (-1136.806) (-1141.459) [-1143.767] (-1140.858) * (-1138.939) (-1140.418) [-1140.135] (-1143.437) -- 0:02:18 320000 -- (-1153.676) [-1135.378] (-1146.891) (-1140.146) * [-1140.855] (-1142.717) (-1157.574) (-1142.853) -- 0:02:18 Average standard deviation of split frequencies: 0.009273 321000 -- (-1144.025) (-1145.685) (-1144.445) [-1141.389] * (-1147.908) [-1141.956] (-1143.262) (-1139.907) -- 0:02:17 322000 -- (-1137.674) (-1146.224) (-1140.875) [-1140.845] * (-1146.163) [-1141.554] (-1140.554) (-1142.339) -- 0:02:16 323000 -- [-1139.644] (-1141.469) (-1144.314) (-1145.842) * [-1133.828] (-1145.978) (-1141.561) (-1144.539) -- 0:02:18 324000 -- (-1146.010) (-1141.982) (-1141.030) [-1145.081] * [-1141.487] (-1139.419) (-1146.853) (-1140.455) -- 0:02:17 325000 -- (-1144.173) (-1142.227) (-1148.749) [-1141.432] * [-1137.695] (-1146.359) (-1142.021) (-1136.441) -- 0:02:17 Average standard deviation of split frequencies: 0.009566 326000 -- (-1142.655) (-1143.377) [-1141.645] (-1138.716) * (-1147.462) (-1139.302) (-1139.171) [-1140.830] -- 0:02:16 327000 -- (-1142.881) (-1138.537) (-1146.231) [-1137.192] * (-1145.072) [-1137.659] (-1143.390) (-1141.362) -- 0:02:15 328000 -- [-1145.012] (-1141.625) (-1139.752) (-1143.706) * (-1158.352) [-1134.548] (-1144.181) (-1139.910) -- 0:02:17 329000 -- (-1141.188) [-1136.836] (-1137.907) (-1148.487) * (-1136.625) [-1146.753] (-1160.585) (-1152.693) -- 0:02:16 330000 -- (-1154.470) [-1140.780] (-1142.259) (-1154.811) * [-1144.347] (-1161.898) (-1143.430) (-1150.773) -- 0:02:16 Average standard deviation of split frequencies: 0.009650 331000 -- (-1150.659) [-1146.666] (-1139.646) (-1147.466) * [-1138.413] (-1141.136) (-1145.606) (-1145.341) -- 0:02:15 332000 -- (-1145.172) [-1148.942] (-1140.605) (-1149.401) * [-1136.603] (-1139.743) (-1144.436) (-1141.336) -- 0:02:14 333000 -- [-1147.411] (-1145.558) (-1143.681) (-1147.462) * (-1142.804) [-1144.757] (-1146.049) (-1140.225) -- 0:02:16 334000 -- (-1140.356) (-1146.292) [-1142.224] (-1151.385) * (-1141.634) (-1144.961) (-1141.912) [-1144.960] -- 0:02:15 335000 -- (-1147.640) [-1142.102] (-1136.559) (-1138.093) * (-1142.491) (-1140.929) [-1140.872] (-1138.168) -- 0:02:14 Average standard deviation of split frequencies: 0.009713 336000 -- (-1135.491) [-1141.242] (-1147.948) (-1141.269) * (-1134.012) (-1139.629) (-1142.632) [-1139.609] -- 0:02:14 337000 -- (-1160.092) (-1145.876) [-1138.454] (-1143.994) * [-1135.174] (-1150.084) (-1147.359) (-1136.419) -- 0:02:15 338000 -- (-1145.506) (-1143.655) [-1137.365] (-1142.920) * [-1138.452] (-1141.257) (-1141.290) (-1141.977) -- 0:02:15 339000 -- (-1144.976) [-1144.140] (-1148.129) (-1145.612) * (-1138.439) (-1138.455) (-1141.425) [-1142.424] -- 0:02:14 340000 -- (-1142.278) (-1142.248) (-1148.497) [-1145.347] * (-1133.701) [-1144.037] (-1147.830) (-1141.143) -- 0:02:13 Average standard deviation of split frequencies: 0.010112 341000 -- (-1146.564) (-1142.590) [-1143.279] (-1146.455) * (-1150.283) [-1144.366] (-1143.991) (-1143.096) -- 0:02:13 342000 -- (-1138.042) [-1140.534] (-1144.272) (-1147.406) * (-1150.481) (-1143.237) [-1137.265] (-1141.211) -- 0:02:14 343000 -- (-1150.004) [-1146.307] (-1152.611) (-1145.508) * (-1139.847) [-1143.675] (-1143.145) (-1155.046) -- 0:02:14 344000 -- (-1144.323) (-1143.004) (-1145.314) [-1142.354] * (-1142.708) (-1139.726) [-1145.929] (-1137.577) -- 0:02:13 345000 -- [-1139.275] (-1146.939) (-1146.944) (-1142.878) * (-1148.121) (-1146.692) [-1143.910] (-1141.848) -- 0:02:12 Average standard deviation of split frequencies: 0.008489 346000 -- (-1149.021) (-1147.132) [-1140.937] (-1146.793) * (-1149.140) (-1142.852) [-1135.792] (-1144.192) -- 0:02:14 347000 -- [-1151.578] (-1141.373) (-1146.987) (-1150.098) * (-1147.295) (-1146.842) [-1140.815] (-1141.807) -- 0:02:13 348000 -- (-1139.347) (-1145.639) [-1139.982] (-1139.908) * (-1150.498) [-1140.727] (-1141.714) (-1144.396) -- 0:02:13 349000 -- (-1144.895) [-1143.413] (-1138.827) (-1146.109) * (-1145.233) (-1149.248) [-1138.631] (-1143.670) -- 0:02:12 350000 -- (-1138.763) [-1140.179] (-1147.803) (-1142.487) * [-1145.848] (-1149.579) (-1149.403) (-1143.799) -- 0:02:13 Average standard deviation of split frequencies: 0.008169 351000 -- (-1147.202) (-1160.090) [-1136.478] (-1141.147) * (-1147.997) (-1143.812) (-1144.072) [-1137.995] -- 0:02:13 352000 -- (-1146.378) (-1143.072) [-1142.963] (-1139.972) * (-1148.149) (-1154.808) [-1145.670] (-1140.694) -- 0:02:12 353000 -- (-1144.991) (-1147.095) [-1150.921] (-1142.879) * (-1146.453) (-1148.547) (-1143.981) [-1138.843] -- 0:02:11 354000 -- [-1145.905] (-1142.102) (-1159.986) (-1136.725) * (-1148.825) (-1151.760) (-1148.209) [-1143.989] -- 0:02:11 355000 -- (-1145.941) [-1140.867] (-1139.316) (-1144.170) * (-1146.924) [-1143.257] (-1135.777) (-1146.966) -- 0:02:12 Average standard deviation of split frequencies: 0.009371 356000 -- (-1153.220) (-1147.043) (-1139.479) [-1139.340] * [-1140.803] (-1144.136) (-1148.688) (-1145.967) -- 0:02:12 357000 -- (-1145.055) (-1145.851) (-1144.541) [-1141.982] * (-1141.689) (-1143.374) (-1146.527) [-1135.319] -- 0:02:11 358000 -- (-1146.817) (-1144.909) (-1145.120) [-1139.487] * (-1144.010) (-1143.593) (-1137.287) [-1141.432] -- 0:02:10 359000 -- (-1150.520) (-1135.927) (-1142.665) [-1141.819] * [-1137.937] (-1145.676) (-1139.552) (-1143.818) -- 0:02:10 360000 -- (-1144.867) [-1139.878] (-1150.375) (-1140.431) * [-1137.608] (-1153.365) (-1143.749) (-1138.540) -- 0:02:11 Average standard deviation of split frequencies: 0.008948 361000 -- (-1152.295) (-1140.947) (-1141.104) [-1143.745] * (-1143.989) [-1144.981] (-1142.076) (-1139.847) -- 0:02:10 362000 -- (-1141.165) [-1138.752] (-1140.944) (-1139.094) * (-1141.129) (-1142.441) (-1151.166) [-1139.417] -- 0:02:10 363000 -- (-1145.370) [-1145.314] (-1142.859) (-1138.231) * [-1142.696] (-1142.266) (-1146.581) (-1142.762) -- 0:02:09 364000 -- (-1151.007) (-1142.293) (-1137.280) [-1141.732] * [-1138.586] (-1141.532) (-1144.512) (-1145.503) -- 0:02:09 365000 -- [-1145.023] (-1149.188) (-1143.541) (-1135.064) * (-1147.613) [-1137.879] (-1137.866) (-1154.979) -- 0:02:10 Average standard deviation of split frequencies: 0.008421 366000 -- (-1147.925) (-1144.962) [-1141.289] (-1144.252) * (-1147.644) [-1142.556] (-1139.971) (-1140.278) -- 0:02:09 367000 -- [-1144.428] (-1146.312) (-1140.361) (-1149.317) * (-1149.112) (-1143.280) (-1147.150) [-1143.141] -- 0:02:09 368000 -- (-1149.188) (-1138.377) [-1145.443] (-1138.771) * (-1145.901) [-1136.761] (-1144.401) (-1147.624) -- 0:02:08 369000 -- (-1153.375) (-1146.434) [-1142.977] (-1141.893) * (-1142.356) (-1151.898) [-1140.381] (-1146.465) -- 0:02:08 370000 -- [-1142.898] (-1151.576) (-1143.369) (-1146.127) * (-1146.914) (-1146.268) [-1139.676] (-1147.660) -- 0:02:09 Average standard deviation of split frequencies: 0.008413 371000 -- (-1138.969) (-1141.704) (-1146.974) [-1144.046] * [-1141.328] (-1139.991) (-1141.934) (-1137.618) -- 0:02:08 372000 -- [-1140.898] (-1148.134) (-1142.064) (-1146.494) * (-1146.757) (-1151.758) [-1139.474] (-1145.011) -- 0:02:08 373000 -- (-1146.893) (-1139.926) (-1155.840) [-1138.931] * (-1148.915) (-1143.663) [-1140.670] (-1139.464) -- 0:02:07 374000 -- (-1140.494) (-1144.587) [-1139.607] (-1147.003) * (-1142.451) (-1144.584) [-1143.429] (-1153.405) -- 0:02:07 375000 -- (-1147.039) (-1145.682) (-1137.249) [-1149.812] * (-1139.419) (-1142.388) (-1146.772) [-1153.521] -- 0:02:08 Average standard deviation of split frequencies: 0.008198 376000 -- (-1147.213) [-1144.099] (-1140.790) (-1142.164) * [-1139.972] (-1142.932) (-1139.424) (-1138.419) -- 0:02:07 377000 -- (-1147.019) (-1145.398) (-1143.893) [-1142.009] * (-1142.721) [-1146.081] (-1142.567) (-1141.502) -- 0:02:07 378000 -- [-1141.245] (-1139.688) (-1141.285) (-1151.935) * [-1144.919] (-1150.601) (-1139.861) (-1145.823) -- 0:02:06 379000 -- (-1140.165) [-1141.694] (-1140.229) (-1136.624) * (-1138.527) (-1135.718) (-1146.485) [-1139.690] -- 0:02:06 380000 -- (-1148.997) (-1142.512) (-1144.609) [-1133.621] * (-1139.761) (-1143.861) [-1140.773] (-1140.082) -- 0:02:07 Average standard deviation of split frequencies: 0.008764 381000 -- (-1146.933) (-1139.048) [-1146.920] (-1142.164) * (-1141.115) (-1137.648) (-1140.266) [-1141.729] -- 0:02:06 382000 -- (-1149.235) [-1138.914] (-1155.008) (-1140.500) * [-1142.402] (-1141.873) (-1135.735) (-1149.813) -- 0:02:06 383000 -- (-1148.883) [-1139.382] (-1136.649) (-1144.070) * [-1141.684] (-1146.172) (-1144.965) (-1153.695) -- 0:02:05 384000 -- (-1145.840) (-1139.302) (-1149.027) [-1138.932] * [-1144.708] (-1140.127) (-1149.477) (-1149.469) -- 0:02:05 385000 -- (-1140.109) [-1134.578] (-1142.365) (-1141.706) * [-1136.566] (-1135.062) (-1150.922) (-1145.895) -- 0:02:06 Average standard deviation of split frequencies: 0.008643 386000 -- (-1140.830) (-1143.977) [-1141.254] (-1139.983) * (-1142.065) (-1141.968) (-1140.002) [-1144.920] -- 0:02:05 387000 -- (-1147.605) [-1138.173] (-1148.585) (-1141.823) * (-1148.833) (-1138.410) [-1141.962] (-1146.653) -- 0:02:05 388000 -- (-1142.177) (-1139.030) (-1144.050) [-1142.202] * (-1146.594) [-1146.780] (-1142.202) (-1147.525) -- 0:02:04 389000 -- [-1143.725] (-1139.190) (-1146.776) (-1137.808) * (-1144.085) (-1146.516) [-1149.956] (-1144.359) -- 0:02:04 390000 -- (-1147.813) (-1152.377) (-1142.445) [-1141.147] * (-1142.252) [-1145.044] (-1143.380) (-1137.087) -- 0:02:05 Average standard deviation of split frequencies: 0.008447 391000 -- (-1140.450) (-1136.483) (-1139.789) [-1139.066] * [-1143.731] (-1144.238) (-1141.330) (-1145.195) -- 0:02:04 392000 -- (-1135.710) (-1144.339) (-1146.430) [-1138.746] * [-1143.914] (-1145.701) (-1148.948) (-1142.244) -- 0:02:04 393000 -- (-1142.538) (-1137.162) (-1142.771) [-1143.174] * [-1142.953] (-1141.800) (-1142.647) (-1145.737) -- 0:02:03 394000 -- [-1147.383] (-1138.410) (-1140.343) (-1145.610) * (-1146.624) [-1145.884] (-1148.251) (-1148.961) -- 0:02:03 395000 -- [-1138.001] (-1135.788) (-1147.815) (-1141.492) * (-1147.311) [-1134.659] (-1141.559) (-1144.085) -- 0:02:04 Average standard deviation of split frequencies: 0.008608 396000 -- (-1141.032) (-1137.512) (-1145.295) [-1139.883] * (-1160.308) [-1149.877] (-1140.375) (-1145.605) -- 0:02:03 397000 -- [-1146.942] (-1142.456) (-1141.546) (-1141.020) * [-1143.430] (-1147.254) (-1154.446) (-1136.645) -- 0:02:03 398000 -- [-1145.626] (-1141.944) (-1146.546) (-1140.109) * (-1139.656) (-1156.900) [-1145.287] (-1139.817) -- 0:02:02 399000 -- (-1142.141) (-1143.876) [-1144.505] (-1136.102) * [-1141.980] (-1149.442) (-1145.140) (-1142.616) -- 0:02:02 400000 -- (-1138.838) (-1147.754) [-1142.062] (-1142.346) * [-1144.104] (-1147.106) (-1143.239) (-1138.708) -- 0:02:03 Average standard deviation of split frequencies: 0.008869 401000 -- (-1146.135) (-1148.831) [-1139.027] (-1140.439) * (-1139.192) (-1145.834) (-1143.517) [-1144.108] -- 0:02:02 402000 -- [-1140.299] (-1146.144) (-1152.007) (-1146.884) * [-1141.006] (-1151.186) (-1146.119) (-1148.036) -- 0:02:01 403000 -- (-1138.812) (-1139.306) (-1139.161) [-1150.438] * [-1145.165] (-1140.833) (-1139.113) (-1140.667) -- 0:02:01 404000 -- (-1145.858) (-1136.675) (-1142.210) [-1144.985] * [-1134.485] (-1143.539) (-1140.806) (-1140.760) -- 0:02:02 405000 -- (-1145.841) (-1136.722) [-1144.305] (-1144.116) * (-1139.645) (-1141.890) (-1141.396) [-1140.773] -- 0:02:01 Average standard deviation of split frequencies: 0.008753 406000 -- (-1143.671) (-1147.716) [-1135.799] (-1145.445) * [-1142.268] (-1138.871) (-1150.817) (-1137.403) -- 0:02:01 407000 -- (-1149.744) [-1138.696] (-1145.847) (-1150.999) * (-1153.479) [-1141.071] (-1148.970) (-1145.832) -- 0:02:00 408000 -- (-1137.565) (-1144.588) [-1145.667] (-1148.026) * (-1146.963) [-1139.384] (-1143.929) (-1142.730) -- 0:02:00 409000 -- (-1142.710) [-1141.135] (-1143.675) (-1143.602) * (-1147.842) [-1143.455] (-1137.757) (-1145.884) -- 0:02:01 410000 -- (-1141.329) [-1136.372] (-1146.007) (-1142.607) * (-1144.893) (-1150.159) [-1140.242] (-1152.682) -- 0:02:00 Average standard deviation of split frequencies: 0.008565 411000 -- (-1139.702) (-1148.697) (-1149.252) [-1141.550] * [-1142.856] (-1148.490) (-1151.406) (-1147.328) -- 0:02:00 412000 -- (-1144.849) (-1143.210) [-1143.844] (-1141.376) * [-1135.610] (-1143.884) (-1146.955) (-1140.803) -- 0:01:59 413000 -- (-1147.290) [-1143.963] (-1141.522) (-1146.785) * [-1144.866] (-1144.480) (-1145.535) (-1141.910) -- 0:01:59 414000 -- (-1138.611) [-1143.135] (-1144.166) (-1135.935) * [-1138.787] (-1136.335) (-1138.299) (-1139.820) -- 0:02:00 415000 -- (-1152.188) (-1142.031) (-1139.188) [-1144.185] * (-1137.938) (-1148.312) (-1146.991) [-1139.883] -- 0:01:59 Average standard deviation of split frequencies: 0.008194 416000 -- (-1140.446) [-1136.934] (-1145.575) (-1142.174) * (-1144.700) (-1138.500) (-1144.899) [-1138.348] -- 0:01:59 417000 -- [-1147.162] (-1145.544) (-1143.490) (-1144.418) * (-1139.206) [-1142.242] (-1140.302) (-1150.276) -- 0:01:58 418000 -- (-1148.069) (-1136.117) [-1140.944] (-1145.347) * (-1141.393) (-1137.850) [-1138.850] (-1139.452) -- 0:01:58 419000 -- (-1143.488) (-1141.361) [-1143.511] (-1156.836) * (-1144.465) (-1139.863) (-1141.466) [-1146.547] -- 0:01:59 420000 -- (-1143.314) (-1143.214) [-1137.974] (-1145.515) * (-1136.921) (-1145.662) (-1141.745) [-1148.347] -- 0:01:58 Average standard deviation of split frequencies: 0.009310 421000 -- (-1139.873) [-1141.031] (-1141.847) (-1148.354) * (-1146.529) (-1139.022) [-1141.059] (-1146.230) -- 0:01:58 422000 -- [-1140.884] (-1142.006) (-1142.133) (-1138.650) * (-1140.338) (-1144.760) (-1142.859) [-1143.789] -- 0:01:57 423000 -- (-1143.209) (-1148.740) (-1141.559) [-1141.309] * (-1141.572) (-1152.185) (-1144.034) [-1141.192] -- 0:01:57 424000 -- (-1143.962) [-1141.182] (-1151.918) (-1145.012) * (-1138.704) [-1137.452] (-1148.956) (-1145.519) -- 0:01:58 425000 -- (-1141.333) (-1139.616) (-1138.572) [-1135.923] * (-1142.522) (-1144.111) [-1143.760] (-1136.105) -- 0:01:57 Average standard deviation of split frequencies: 0.009534 426000 -- (-1138.460) [-1140.485] (-1145.559) (-1139.724) * [-1142.328] (-1147.349) (-1144.169) (-1140.629) -- 0:01:57 427000 -- (-1141.258) [-1138.096] (-1149.588) (-1143.138) * (-1137.466) (-1147.254) (-1143.394) [-1147.411] -- 0:01:56 428000 -- [-1143.222] (-1139.910) (-1143.816) (-1145.600) * (-1147.817) [-1150.186] (-1138.373) (-1143.261) -- 0:01:56 429000 -- (-1148.076) [-1139.679] (-1142.769) (-1143.234) * [-1140.292] (-1154.272) (-1143.596) (-1142.873) -- 0:01:57 430000 -- [-1142.313] (-1149.392) (-1143.851) (-1150.873) * (-1138.156) [-1141.693] (-1143.220) (-1145.997) -- 0:01:56 Average standard deviation of split frequencies: 0.009430 431000 -- (-1142.479) [-1143.854] (-1141.525) (-1140.239) * (-1144.002) [-1138.895] (-1144.760) (-1151.277) -- 0:01:56 432000 -- (-1146.535) [-1139.738] (-1136.488) (-1150.915) * (-1139.070) [-1140.756] (-1140.202) (-1146.071) -- 0:01:55 433000 -- (-1143.963) [-1138.230] (-1146.185) (-1151.271) * (-1137.446) (-1143.513) (-1149.430) [-1141.800] -- 0:01:55 434000 -- (-1144.258) (-1145.921) (-1146.060) [-1141.957] * (-1152.446) (-1152.415) (-1149.048) [-1136.656] -- 0:01:56 435000 -- (-1153.787) (-1149.753) (-1149.008) [-1142.328] * (-1148.590) [-1148.874] (-1143.895) (-1143.756) -- 0:01:55 Average standard deviation of split frequencies: 0.009731 436000 -- (-1142.406) (-1139.785) [-1144.793] (-1145.028) * (-1140.564) [-1148.568] (-1146.994) (-1141.597) -- 0:01:55 437000 -- (-1152.218) (-1144.779) (-1140.427) [-1139.039] * (-1150.998) (-1145.730) (-1144.035) [-1137.571] -- 0:01:54 438000 -- (-1143.338) (-1147.097) [-1138.817] (-1140.494) * (-1145.684) (-1151.913) [-1145.758] (-1142.445) -- 0:01:54 439000 -- [-1139.564] (-1148.123) (-1142.764) (-1143.401) * (-1145.509) (-1143.349) (-1142.472) [-1145.345] -- 0:01:55 440000 -- (-1146.678) [-1145.403] (-1140.668) (-1144.391) * (-1142.431) (-1141.391) (-1142.851) [-1135.569] -- 0:01:54 Average standard deviation of split frequencies: 0.009299 441000 -- [-1142.467] (-1149.279) (-1136.419) (-1144.392) * (-1146.680) (-1140.877) (-1141.254) [-1141.778] -- 0:01:54 442000 -- (-1144.494) (-1141.146) [-1141.748] (-1142.001) * (-1145.754) (-1144.567) (-1139.684) [-1138.742] -- 0:01:53 443000 -- (-1150.264) (-1141.932) [-1143.264] (-1141.606) * (-1150.360) [-1136.893] (-1143.589) (-1146.656) -- 0:01:54 444000 -- (-1148.623) [-1144.231] (-1145.944) (-1148.599) * (-1147.610) (-1143.875) [-1142.262] (-1136.902) -- 0:01:53 445000 -- (-1144.609) (-1144.406) (-1141.135) [-1145.883] * (-1140.014) (-1160.120) [-1137.354] (-1145.075) -- 0:01:53 Average standard deviation of split frequencies: 0.008293 446000 -- (-1140.513) (-1142.114) (-1140.680) [-1139.158] * (-1145.293) (-1138.801) [-1138.514] (-1144.773) -- 0:01:53 447000 -- [-1140.840] (-1153.950) (-1149.262) (-1149.541) * (-1155.583) (-1146.386) (-1138.241) [-1144.134] -- 0:01:52 448000 -- (-1145.486) [-1140.591] (-1137.968) (-1143.590) * (-1142.603) (-1140.646) (-1143.154) [-1150.955] -- 0:01:53 449000 -- (-1139.278) (-1140.542) [-1140.143] (-1145.858) * (-1146.546) [-1143.390] (-1143.486) (-1147.982) -- 0:01:52 450000 -- [-1147.279] (-1138.491) (-1144.224) (-1144.003) * (-1155.032) (-1147.087) [-1137.081] (-1144.036) -- 0:01:52 Average standard deviation of split frequencies: 0.008529 451000 -- (-1143.519) (-1141.617) (-1148.716) [-1133.834] * (-1146.342) [-1139.988] (-1140.217) (-1143.680) -- 0:01:51 452000 -- (-1143.575) (-1150.353) [-1138.233] (-1142.939) * (-1141.351) [-1141.733] (-1152.871) (-1142.224) -- 0:01:51 453000 -- [-1146.047] (-1145.897) (-1139.835) (-1141.754) * [-1139.848] (-1141.065) (-1140.085) (-1149.726) -- 0:01:52 454000 -- (-1145.897) (-1137.898) [-1143.464] (-1143.610) * [-1146.345] (-1144.046) (-1151.018) (-1153.829) -- 0:01:51 455000 -- (-1160.705) (-1141.624) [-1147.102] (-1137.612) * (-1139.055) [-1141.828] (-1142.019) (-1149.273) -- 0:01:51 Average standard deviation of split frequencies: 0.008509 456000 -- (-1137.825) (-1149.450) (-1149.237) [-1140.560] * (-1141.704) (-1141.571) [-1138.237] (-1145.947) -- 0:01:50 457000 -- [-1140.990] (-1140.622) (-1147.097) (-1145.375) * (-1139.443) (-1141.336) (-1139.174) [-1134.480] -- 0:01:50 458000 -- [-1142.655] (-1143.521) (-1147.581) (-1141.786) * [-1151.434] (-1146.428) (-1138.073) (-1147.739) -- 0:01:51 459000 -- (-1148.711) (-1155.360) (-1145.955) [-1145.535] * [-1144.284] (-1149.864) (-1138.481) (-1144.634) -- 0:01:50 460000 -- (-1141.198) [-1136.282] (-1151.460) (-1140.065) * (-1142.125) [-1141.942] (-1143.401) (-1145.016) -- 0:01:50 Average standard deviation of split frequencies: 0.008816 461000 -- (-1140.914) [-1140.972] (-1146.588) (-1145.931) * (-1144.296) (-1142.402) (-1143.498) [-1145.146] -- 0:01:49 462000 -- (-1158.581) (-1141.690) (-1148.312) [-1140.419] * (-1138.629) (-1146.227) [-1140.529] (-1143.321) -- 0:01:49 463000 -- (-1140.851) (-1137.759) (-1152.632) [-1139.821] * (-1144.399) (-1145.926) (-1144.674) [-1142.290] -- 0:01:50 464000 -- [-1136.252] (-1142.235) (-1147.956) (-1144.490) * (-1134.579) [-1148.251] (-1144.229) (-1138.686) -- 0:01:49 465000 -- (-1154.711) (-1143.768) [-1138.819] (-1141.201) * (-1143.327) [-1137.610] (-1141.762) (-1140.464) -- 0:01:49 Average standard deviation of split frequencies: 0.008404 466000 -- (-1138.150) (-1143.398) [-1141.182] (-1144.876) * (-1149.140) [-1139.845] (-1145.732) (-1138.762) -- 0:01:48 467000 -- (-1148.466) (-1140.643) (-1148.627) [-1143.554] * (-1140.304) [-1138.570] (-1137.342) (-1150.092) -- 0:01:48 468000 -- (-1142.959) (-1148.546) (-1147.372) [-1147.093] * (-1149.876) (-1141.063) (-1141.132) [-1137.333] -- 0:01:49 469000 -- (-1148.933) (-1151.455) (-1147.204) [-1138.124] * [-1141.106] (-1149.002) (-1143.847) (-1140.516) -- 0:01:48 470000 -- [-1138.533] (-1147.419) (-1143.592) (-1145.666) * [-1140.713] (-1144.025) (-1148.096) (-1137.549) -- 0:01:48 Average standard deviation of split frequencies: 0.007781 471000 -- [-1136.373] (-1147.740) (-1147.759) (-1143.038) * (-1148.068) [-1139.337] (-1138.995) (-1137.884) -- 0:01:47 472000 -- [-1139.617] (-1141.324) (-1143.541) (-1146.855) * (-1141.117) (-1147.771) (-1141.492) [-1150.445] -- 0:01:47 473000 -- (-1139.870) (-1142.082) (-1138.756) [-1154.889] * [-1144.306] (-1138.720) (-1139.277) (-1141.474) -- 0:01:48 474000 -- (-1138.992) (-1144.372) [-1137.919] (-1141.146) * (-1141.304) [-1146.685] (-1146.321) (-1149.340) -- 0:01:47 475000 -- (-1143.269) (-1154.160) (-1140.794) [-1138.869] * (-1149.375) (-1147.646) (-1146.285) [-1145.816] -- 0:01:47 Average standard deviation of split frequencies: 0.008304 476000 -- (-1140.132) (-1147.832) (-1142.211) [-1147.686] * [-1145.556] (-1143.660) (-1148.013) (-1151.622) -- 0:01:46 477000 -- [-1141.893] (-1143.894) (-1137.814) (-1143.033) * (-1144.783) (-1145.245) [-1140.777] (-1147.929) -- 0:01:46 478000 -- (-1147.193) [-1144.828] (-1144.236) (-1138.306) * (-1143.297) (-1146.829) [-1141.191] (-1147.031) -- 0:01:47 479000 -- [-1147.244] (-1143.804) (-1138.559) (-1141.269) * (-1145.265) [-1140.771] (-1144.172) (-1146.451) -- 0:01:46 480000 -- [-1139.399] (-1148.383) (-1148.745) (-1136.811) * (-1139.373) [-1145.947] (-1140.035) (-1145.365) -- 0:01:46 Average standard deviation of split frequencies: 0.009430 481000 -- [-1138.783] (-1146.241) (-1145.293) (-1140.890) * (-1141.406) (-1141.207) (-1143.019) [-1144.350] -- 0:01:45 482000 -- [-1139.112] (-1145.792) (-1142.188) (-1155.204) * [-1139.617] (-1140.725) (-1145.654) (-1156.449) -- 0:01:46 483000 -- [-1141.884] (-1138.092) (-1142.966) (-1151.084) * [-1141.215] (-1144.364) (-1145.235) (-1148.857) -- 0:01:45 484000 -- (-1141.260) [-1149.920] (-1151.192) (-1146.121) * (-1143.758) (-1140.213) [-1141.026] (-1143.502) -- 0:01:45 485000 -- (-1147.477) (-1139.872) [-1151.428] (-1150.180) * [-1141.551] (-1141.165) (-1144.516) (-1150.055) -- 0:01:45 Average standard deviation of split frequencies: 0.009476 486000 -- (-1145.780) (-1135.044) (-1143.413) [-1140.492] * (-1147.469) [-1142.347] (-1145.086) (-1138.820) -- 0:01:44 487000 -- (-1143.878) [-1142.668] (-1146.572) (-1135.824) * (-1146.764) (-1146.383) (-1149.754) [-1141.843] -- 0:01:45 488000 -- (-1145.662) [-1146.389] (-1144.992) (-1142.545) * (-1149.027) (-1140.418) [-1144.553] (-1148.141) -- 0:01:44 489000 -- (-1142.565) [-1143.124] (-1150.478) (-1141.020) * [-1143.000] (-1150.143) (-1142.704) (-1142.222) -- 0:01:44 490000 -- (-1138.551) [-1141.297] (-1148.501) (-1145.396) * (-1150.872) [-1140.803] (-1141.994) (-1142.039) -- 0:01:44 Average standard deviation of split frequencies: 0.009090 491000 -- (-1144.399) [-1135.191] (-1144.387) (-1147.067) * (-1141.815) (-1146.258) (-1140.627) [-1138.850] -- 0:01:43 492000 -- (-1143.591) (-1142.795) (-1141.752) [-1139.614] * (-1139.023) (-1148.280) (-1144.311) [-1142.159] -- 0:01:44 493000 -- (-1151.151) (-1141.322) (-1150.640) [-1142.298] * (-1144.908) [-1141.002] (-1140.616) (-1141.557) -- 0:01:43 494000 -- (-1139.295) (-1144.205) [-1142.633] (-1151.688) * (-1145.994) (-1143.479) [-1141.783] (-1149.259) -- 0:01:43 495000 -- [-1140.724] (-1144.147) (-1151.320) (-1139.738) * (-1146.087) (-1144.165) (-1149.928) [-1137.211] -- 0:01:43 Average standard deviation of split frequencies: 0.009723 496000 -- (-1139.020) (-1137.633) (-1140.449) [-1143.856] * (-1140.929) [-1137.851] (-1149.235) (-1140.841) -- 0:01:42 497000 -- [-1137.793] (-1151.252) (-1140.573) (-1147.710) * (-1151.115) (-1141.936) [-1139.661] (-1145.908) -- 0:01:43 498000 -- [-1138.696] (-1145.796) (-1150.723) (-1139.524) * (-1144.199) (-1145.687) [-1136.689] (-1148.566) -- 0:01:42 499000 -- (-1140.655) [-1146.945] (-1143.157) (-1146.845) * (-1147.567) (-1144.660) [-1141.919] (-1153.966) -- 0:01:42 500000 -- [-1142.891] (-1141.776) (-1140.962) (-1145.169) * (-1136.889) (-1136.911) (-1138.275) [-1141.689] -- 0:01:42 Average standard deviation of split frequencies: 0.009053 501000 -- (-1141.337) (-1141.484) (-1145.788) [-1140.543] * [-1144.245] (-1145.368) (-1138.452) (-1138.940) -- 0:01:41 502000 -- (-1138.986) (-1141.705) [-1142.340] (-1146.900) * (-1146.284) [-1136.339] (-1141.471) (-1142.010) -- 0:01:42 503000 -- [-1137.189] (-1134.599) (-1148.860) (-1146.380) * (-1138.622) (-1138.174) (-1149.275) [-1136.351] -- 0:01:41 504000 -- (-1137.497) (-1136.875) [-1137.260] (-1140.925) * (-1144.519) (-1149.817) [-1149.348] (-1137.351) -- 0:01:41 505000 -- (-1144.387) (-1146.494) (-1141.514) [-1142.743] * (-1144.930) (-1137.467) [-1140.976] (-1142.863) -- 0:01:40 Average standard deviation of split frequencies: 0.008313 506000 -- [-1140.347] (-1148.842) (-1142.566) (-1143.028) * (-1153.808) (-1136.842) [-1142.658] (-1141.491) -- 0:01:40 507000 -- (-1144.650) [-1146.512] (-1139.754) (-1145.012) * [-1137.487] (-1143.135) (-1147.438) (-1152.437) -- 0:01:41 508000 -- (-1138.426) (-1143.342) [-1139.969] (-1143.338) * (-1143.560) (-1144.804) (-1145.561) [-1136.807] -- 0:01:40 509000 -- (-1140.742) (-1134.469) (-1144.191) [-1145.317] * (-1141.226) (-1137.723) [-1139.965] (-1140.193) -- 0:01:40 510000 -- (-1137.002) (-1139.881) (-1142.276) [-1144.256] * (-1138.790) (-1142.895) (-1149.449) [-1149.856] -- 0:01:39 Average standard deviation of split frequencies: 0.008237 511000 -- (-1141.641) [-1147.477] (-1139.224) (-1143.920) * (-1145.674) (-1142.770) [-1138.773] (-1144.486) -- 0:01:39 512000 -- (-1147.505) (-1149.111) [-1136.503] (-1147.534) * (-1146.245) (-1142.948) (-1135.235) [-1141.924] -- 0:01:40 513000 -- (-1140.112) [-1149.006] (-1149.906) (-1138.952) * (-1139.760) [-1141.492] (-1139.643) (-1151.900) -- 0:01:39 514000 -- [-1137.743] (-1145.887) (-1150.418) (-1141.605) * [-1138.639] (-1143.519) (-1147.836) (-1151.007) -- 0:01:39 515000 -- (-1137.113) (-1152.759) [-1138.269] (-1146.060) * (-1140.337) [-1140.880] (-1144.031) (-1140.333) -- 0:01:38 Average standard deviation of split frequencies: 0.008292 516000 -- (-1143.856) (-1144.164) (-1139.147) [-1147.796] * (-1141.971) (-1144.908) [-1138.616] (-1145.228) -- 0:01:38 517000 -- (-1143.984) [-1144.335] (-1143.345) (-1148.851) * (-1139.228) (-1145.454) [-1139.413] (-1142.265) -- 0:01:39 518000 -- (-1160.628) [-1152.753] (-1149.263) (-1152.109) * (-1148.060) (-1141.571) [-1148.902] (-1141.983) -- 0:01:38 519000 -- [-1141.182] (-1152.514) (-1142.499) (-1145.553) * (-1141.980) [-1139.733] (-1144.661) (-1152.306) -- 0:01:38 520000 -- [-1141.945] (-1148.584) (-1141.286) (-1148.093) * (-1139.576) (-1146.428) (-1136.225) [-1156.600] -- 0:01:37 Average standard deviation of split frequencies: 0.007313 521000 -- (-1144.994) (-1147.541) (-1147.990) [-1140.643] * (-1142.742) (-1139.382) (-1146.252) [-1137.942] -- 0:01:37 522000 -- [-1140.564] (-1150.760) (-1140.274) (-1142.805) * (-1148.446) (-1139.991) [-1138.601] (-1158.117) -- 0:01:37 523000 -- (-1142.067) (-1144.892) [-1143.181] (-1141.421) * (-1154.532) [-1139.050] (-1144.344) (-1136.088) -- 0:01:37 524000 -- (-1143.457) (-1144.437) (-1140.152) [-1147.679] * [-1144.839] (-1138.796) (-1141.059) (-1142.703) -- 0:01:37 525000 -- (-1140.724) (-1148.689) [-1142.846] (-1143.319) * (-1141.374) (-1138.266) [-1136.160] (-1146.120) -- 0:01:36 Average standard deviation of split frequencies: 0.007514 526000 -- [-1147.238] (-1144.446) (-1150.176) (-1140.845) * (-1142.642) (-1147.139) [-1134.710] (-1143.675) -- 0:01:36 527000 -- (-1149.829) [-1142.048] (-1147.328) (-1146.386) * [-1144.759] (-1135.044) (-1140.750) (-1145.688) -- 0:01:36 528000 -- (-1140.687) (-1138.970) (-1144.610) [-1141.728] * [-1150.598] (-1141.107) (-1144.688) (-1143.915) -- 0:01:36 529000 -- (-1139.367) (-1144.944) [-1144.215] (-1144.699) * (-1144.930) [-1144.412] (-1151.861) (-1145.983) -- 0:01:36 530000 -- (-1139.826) (-1144.922) (-1143.387) [-1136.728] * (-1146.167) (-1141.906) (-1142.469) [-1142.078] -- 0:01:35 Average standard deviation of split frequencies: 0.007995 531000 -- [-1144.999] (-1146.037) (-1153.790) (-1142.612) * [-1137.064] (-1142.254) (-1145.948) (-1134.363) -- 0:01:35 532000 -- (-1148.338) [-1144.155] (-1144.826) (-1139.050) * (-1146.866) (-1152.657) [-1146.796] (-1147.294) -- 0:01:35 533000 -- [-1144.910] (-1136.473) (-1148.459) (-1142.872) * (-1144.792) [-1144.283] (-1151.884) (-1135.734) -- 0:01:35 534000 -- [-1139.362] (-1142.958) (-1145.386) (-1151.926) * [-1136.709] (-1142.041) (-1145.815) (-1147.314) -- 0:01:35 535000 -- (-1142.645) (-1142.764) (-1143.810) [-1143.584] * (-1136.604) (-1144.736) [-1139.428] (-1145.457) -- 0:01:34 Average standard deviation of split frequencies: 0.007780 536000 -- [-1142.045] (-1143.872) (-1143.394) (-1149.595) * (-1149.766) [-1145.262] (-1139.237) (-1142.819) -- 0:01:35 537000 -- [-1137.167] (-1138.986) (-1143.176) (-1137.172) * (-1147.897) (-1149.696) [-1136.057] (-1147.866) -- 0:01:34 538000 -- (-1141.031) (-1152.111) [-1138.058] (-1147.770) * (-1146.773) (-1143.830) [-1141.481] (-1140.398) -- 0:01:34 539000 -- (-1146.070) (-1139.593) [-1137.942] (-1142.554) * (-1137.128) (-1154.479) [-1143.869] (-1139.202) -- 0:01:34 540000 -- [-1142.628] (-1144.075) (-1142.675) (-1143.566) * (-1146.143) (-1143.258) (-1150.012) [-1139.438] -- 0:01:33 Average standard deviation of split frequencies: 0.007780 541000 -- (-1140.285) [-1137.440] (-1145.551) (-1141.751) * (-1144.310) [-1141.615] (-1142.106) (-1141.135) -- 0:01:34 542000 -- (-1142.807) (-1139.834) (-1143.710) [-1146.196] * (-1146.121) [-1139.272] (-1140.043) (-1153.026) -- 0:01:33 543000 -- (-1138.023) [-1137.117] (-1147.795) (-1144.748) * (-1139.832) (-1138.054) [-1137.185] (-1144.797) -- 0:01:33 544000 -- (-1148.721) [-1140.557] (-1140.820) (-1147.730) * [-1143.512] (-1149.427) (-1141.593) (-1143.349) -- 0:01:33 545000 -- (-1147.113) [-1135.963] (-1134.893) (-1136.178) * (-1145.730) (-1145.689) [-1141.535] (-1140.062) -- 0:01:32 Average standard deviation of split frequencies: 0.007438 546000 -- (-1149.740) (-1142.378) (-1146.724) [-1139.174] * (-1143.102) (-1149.736) [-1141.435] (-1149.188) -- 0:01:33 547000 -- (-1136.568) (-1143.191) [-1141.000] (-1144.703) * (-1143.594) [-1140.135] (-1140.460) (-1146.213) -- 0:01:32 548000 -- (-1140.557) [-1139.849] (-1143.311) (-1141.707) * (-1144.375) (-1143.545) [-1137.532] (-1144.771) -- 0:01:32 549000 -- (-1147.951) [-1141.015] (-1144.618) (-1140.866) * (-1142.757) [-1141.374] (-1144.081) (-1140.220) -- 0:01:32 550000 -- (-1148.963) [-1143.218] (-1142.157) (-1147.559) * (-1144.399) (-1142.698) [-1143.370] (-1134.560) -- 0:01:31 Average standard deviation of split frequencies: 0.007375 551000 -- (-1148.408) (-1141.336) [-1142.137] (-1142.766) * (-1147.719) (-1148.159) (-1147.254) [-1139.749] -- 0:01:32 552000 -- [-1139.014] (-1150.862) (-1139.462) (-1142.071) * (-1145.315) (-1141.714) (-1146.921) [-1143.181] -- 0:01:31 553000 -- (-1139.576) (-1140.242) (-1142.172) [-1138.634] * (-1146.419) [-1145.773] (-1139.262) (-1147.981) -- 0:01:31 554000 -- [-1146.173] (-1146.488) (-1147.863) (-1143.846) * (-1143.566) [-1141.847] (-1144.514) (-1143.884) -- 0:01:30 555000 -- (-1144.115) (-1139.280) (-1142.424) [-1138.395] * (-1138.815) [-1138.438] (-1144.544) (-1151.385) -- 0:01:30 Average standard deviation of split frequencies: 0.007305 556000 -- (-1141.469) (-1147.310) (-1148.028) [-1138.361] * (-1143.482) (-1142.137) (-1146.376) [-1137.491] -- 0:01:31 557000 -- (-1150.209) [-1142.690] (-1141.848) (-1137.434) * [-1140.334] (-1146.737) (-1155.937) (-1141.980) -- 0:01:30 558000 -- (-1139.436) (-1143.347) (-1151.162) [-1138.175] * [-1144.342] (-1139.045) (-1144.685) (-1155.580) -- 0:01:30 559000 -- (-1143.830) [-1139.574] (-1136.895) (-1146.246) * (-1140.904) [-1144.772] (-1151.332) (-1138.683) -- 0:01:29 560000 -- [-1137.858] (-1144.537) (-1144.917) (-1142.027) * (-1141.971) (-1157.585) (-1144.869) [-1142.390] -- 0:01:29 Average standard deviation of split frequencies: 0.007826 561000 -- (-1146.993) (-1144.731) [-1143.690] (-1152.828) * [-1141.085] (-1146.993) (-1142.786) (-1145.021) -- 0:01:29 562000 -- (-1142.903) (-1141.356) [-1144.806] (-1150.975) * (-1144.679) [-1143.737] (-1143.495) (-1146.951) -- 0:01:29 563000 -- (-1136.442) [-1142.000] (-1137.969) (-1150.971) * (-1142.795) (-1141.160) (-1138.900) [-1140.442] -- 0:01:29 564000 -- (-1140.227) (-1146.039) (-1141.656) [-1142.309] * (-1140.082) (-1147.067) (-1148.819) [-1143.460] -- 0:01:28 565000 -- [-1137.349] (-1148.204) (-1144.970) (-1144.738) * (-1142.383) (-1145.434) [-1139.727] (-1144.426) -- 0:01:28 Average standard deviation of split frequencies: 0.007175 566000 -- [-1138.797] (-1142.554) (-1144.372) (-1136.223) * (-1146.167) (-1139.627) [-1141.872] (-1147.084) -- 0:01:28 567000 -- [-1146.084] (-1144.155) (-1142.810) (-1153.727) * (-1139.854) [-1143.057] (-1146.129) (-1148.879) -- 0:01:28 568000 -- (-1143.544) (-1143.413) [-1141.797] (-1146.408) * [-1140.174] (-1146.253) (-1147.023) (-1141.814) -- 0:01:28 569000 -- (-1145.948) (-1144.681) (-1139.066) [-1137.275] * [-1139.011] (-1139.295) (-1142.699) (-1146.749) -- 0:01:27 570000 -- (-1137.734) [-1139.592] (-1146.194) (-1155.225) * (-1141.180) (-1147.996) [-1139.108] (-1146.735) -- 0:01:27 Average standard deviation of split frequencies: 0.007371 571000 -- (-1144.389) (-1142.281) [-1141.592] (-1138.011) * (-1149.692) [-1138.122] (-1145.377) (-1144.119) -- 0:01:27 572000 -- (-1139.570) [-1141.381] (-1141.487) (-1148.602) * (-1141.265) (-1142.185) (-1151.858) [-1141.570] -- 0:01:27 573000 -- (-1137.430) (-1144.951) (-1138.514) [-1140.715] * [-1140.517] (-1138.326) (-1144.419) (-1140.988) -- 0:01:27 574000 -- (-1143.133) (-1147.367) [-1146.064] (-1147.674) * (-1139.361) [-1139.196] (-1147.968) (-1142.104) -- 0:01:26 575000 -- (-1146.211) (-1144.455) (-1144.115) [-1140.999] * [-1146.648] (-1141.651) (-1135.491) (-1138.828) -- 0:01:26 Average standard deviation of split frequencies: 0.007743 576000 -- [-1145.068] (-1143.575) (-1142.620) (-1144.824) * (-1141.443) (-1137.181) [-1136.924] (-1154.347) -- 0:01:26 577000 -- [-1141.421] (-1144.107) (-1139.596) (-1140.020) * [-1138.921] (-1138.147) (-1140.242) (-1146.313) -- 0:01:26 578000 -- [-1136.920] (-1144.193) (-1141.448) (-1141.853) * [-1138.871] (-1150.655) (-1139.128) (-1146.984) -- 0:01:26 579000 -- [-1142.569] (-1143.031) (-1141.011) (-1140.341) * (-1145.383) (-1154.157) [-1139.959] (-1146.243) -- 0:01:25 580000 -- (-1142.996) (-1145.163) [-1143.154] (-1143.770) * (-1139.142) [-1139.887] (-1150.527) (-1150.450) -- 0:01:26 Average standard deviation of split frequencies: 0.007619 581000 -- (-1137.606) [-1141.850] (-1143.853) (-1137.873) * (-1135.829) [-1139.307] (-1143.891) (-1136.538) -- 0:01:25 582000 -- (-1147.980) [-1136.863] (-1143.756) (-1150.591) * (-1139.004) [-1143.562] (-1155.280) (-1139.901) -- 0:01:25 583000 -- (-1140.322) [-1143.633] (-1145.707) (-1147.051) * (-1143.174) (-1143.684) [-1138.023] (-1163.250) -- 0:01:25 584000 -- [-1145.479] (-1134.845) (-1141.540) (-1140.570) * (-1146.876) (-1141.365) [-1140.665] (-1147.302) -- 0:01:24 585000 -- [-1138.074] (-1136.219) (-1149.267) (-1138.447) * (-1144.372) (-1136.641) (-1143.094) [-1139.352] -- 0:01:25 Average standard deviation of split frequencies: 0.007549 586000 -- (-1144.223) [-1138.985] (-1148.136) (-1147.214) * [-1136.638] (-1143.517) (-1145.737) (-1153.554) -- 0:01:24 587000 -- (-1146.488) (-1138.875) (-1152.364) [-1142.169] * (-1144.039) (-1140.652) [-1143.221] (-1146.900) -- 0:01:24 588000 -- [-1141.146] (-1140.755) (-1139.435) (-1139.167) * [-1142.341] (-1139.712) (-1143.869) (-1144.942) -- 0:01:24 589000 -- (-1142.197) (-1140.966) (-1140.173) [-1143.446] * (-1146.299) [-1135.306] (-1144.672) (-1150.283) -- 0:01:24 590000 -- (-1148.494) [-1141.200] (-1148.608) (-1143.013) * [-1152.101] (-1148.459) (-1144.060) (-1142.853) -- 0:01:24 Average standard deviation of split frequencies: 0.007244 591000 -- (-1141.691) [-1143.345] (-1147.662) (-1151.273) * (-1151.335) (-1144.448) [-1147.053] (-1149.452) -- 0:01:23 592000 -- [-1135.865] (-1137.883) (-1145.456) (-1141.532) * (-1140.471) (-1141.495) (-1138.978) [-1146.054] -- 0:01:23 593000 -- (-1147.332) (-1144.317) (-1140.314) [-1148.593] * [-1136.659] (-1142.613) (-1143.465) (-1149.657) -- 0:01:23 594000 -- (-1146.295) (-1141.674) [-1134.849] (-1144.644) * (-1138.041) (-1147.048) (-1142.082) [-1135.690] -- 0:01:23 595000 -- (-1147.123) (-1152.923) [-1140.220] (-1151.171) * (-1143.983) [-1139.891] (-1141.220) (-1148.002) -- 0:01:23 Average standard deviation of split frequencies: 0.007423 596000 -- [-1143.372] (-1141.218) (-1139.768) (-1136.716) * (-1141.845) (-1139.672) (-1137.631) [-1137.155] -- 0:01:22 597000 -- [-1140.607] (-1136.318) (-1145.774) (-1147.307) * (-1147.468) (-1143.302) (-1159.865) [-1141.261] -- 0:01:22 598000 -- [-1141.923] (-1144.948) (-1144.781) (-1145.373) * [-1144.500] (-1146.561) (-1135.980) (-1139.998) -- 0:01:22 599000 -- [-1144.336] (-1141.289) (-1147.960) (-1147.712) * (-1138.801) [-1143.623] (-1144.468) (-1141.041) -- 0:01:22 600000 -- (-1143.076) (-1144.211) [-1138.550] (-1137.985) * [-1143.368] (-1142.449) (-1144.815) (-1144.844) -- 0:01:22 Average standard deviation of split frequencies: 0.007425 601000 -- [-1138.983] (-1141.562) (-1140.578) (-1141.948) * (-1141.694) (-1146.196) [-1144.069] (-1144.287) -- 0:01:21 602000 -- (-1144.094) (-1140.868) [-1138.318] (-1142.783) * (-1143.876) [-1136.886] (-1145.109) (-1135.370) -- 0:01:21 603000 -- (-1152.851) [-1146.025] (-1150.072) (-1143.797) * [-1138.767] (-1144.076) (-1142.076) (-1145.113) -- 0:01:20 604000 -- (-1147.746) (-1147.780) [-1138.355] (-1144.085) * [-1147.821] (-1150.926) (-1139.576) (-1144.793) -- 0:01:21 605000 -- (-1144.208) [-1138.611] (-1141.131) (-1142.048) * [-1142.650] (-1146.670) (-1139.953) (-1141.150) -- 0:01:20 Average standard deviation of split frequencies: 0.007240 606000 -- (-1138.371) (-1144.000) [-1138.752] (-1146.885) * (-1136.952) [-1145.115] (-1143.259) (-1153.369) -- 0:01:20 607000 -- (-1141.467) (-1150.806) [-1143.469] (-1139.237) * (-1144.862) (-1143.912) (-1141.302) [-1142.011] -- 0:01:20 608000 -- (-1144.876) [-1135.380] (-1140.465) (-1146.014) * (-1140.535) (-1144.124) (-1147.392) [-1139.724] -- 0:01:19 609000 -- [-1140.521] (-1139.798) (-1146.138) (-1143.275) * (-1140.674) [-1149.892] (-1136.889) (-1149.343) -- 0:01:20 610000 -- (-1143.026) (-1142.880) [-1139.570] (-1142.400) * (-1137.219) (-1145.364) (-1136.156) [-1143.831] -- 0:01:19 Average standard deviation of split frequencies: 0.007957 611000 -- (-1142.379) [-1142.989] (-1138.045) (-1145.019) * (-1141.706) (-1138.582) [-1137.602] (-1151.478) -- 0:01:19 612000 -- (-1145.502) (-1139.911) (-1138.927) [-1142.151] * (-1152.415) [-1145.026] (-1138.662) (-1153.181) -- 0:01:19 613000 -- (-1152.208) (-1138.670) [-1134.972] (-1143.943) * (-1147.939) (-1141.513) [-1134.187] (-1148.608) -- 0:01:18 614000 -- (-1147.350) (-1141.169) (-1149.380) [-1137.028] * (-1145.245) (-1148.682) [-1137.049] (-1143.082) -- 0:01:19 615000 -- (-1147.642) (-1149.160) [-1139.620] (-1142.535) * (-1160.502) (-1138.018) (-1143.231) [-1136.548] -- 0:01:18 Average standard deviation of split frequencies: 0.007476 616000 -- [-1142.351] (-1145.186) (-1144.598) (-1140.439) * [-1141.907] (-1146.642) (-1143.109) (-1146.436) -- 0:01:18 617000 -- [-1142.427] (-1148.394) (-1156.223) (-1141.811) * (-1138.839) (-1149.477) (-1151.218) [-1143.160] -- 0:01:18 618000 -- (-1139.890) [-1137.361] (-1146.583) (-1149.901) * (-1144.955) (-1147.189) (-1144.973) [-1140.443] -- 0:01:17 619000 -- [-1142.172] (-1142.451) (-1141.606) (-1148.410) * (-1150.811) (-1142.424) (-1145.923) [-1139.868] -- 0:01:18 620000 -- (-1142.311) (-1141.549) (-1141.846) [-1145.242] * [-1139.869] (-1147.591) (-1141.578) (-1148.395) -- 0:01:17 Average standard deviation of split frequencies: 0.007420 621000 -- (-1155.108) (-1145.656) [-1148.406] (-1143.841) * (-1147.561) [-1146.314] (-1141.190) (-1146.601) -- 0:01:17 622000 -- [-1150.474] (-1139.750) (-1145.664) (-1142.387) * (-1148.390) [-1152.295] (-1149.955) (-1141.984) -- 0:01:17 623000 -- (-1141.608) [-1141.004] (-1154.570) (-1151.209) * (-1148.198) [-1141.817] (-1148.289) (-1142.753) -- 0:01:16 624000 -- [-1146.363] (-1146.589) (-1137.831) (-1141.464) * [-1137.381] (-1139.655) (-1147.593) (-1143.111) -- 0:01:17 625000 -- (-1148.898) (-1160.927) [-1141.881] (-1141.984) * (-1147.160) (-1148.167) [-1140.655] (-1145.979) -- 0:01:16 Average standard deviation of split frequencies: 0.007588 626000 -- [-1140.124] (-1150.669) (-1144.618) (-1150.745) * (-1145.789) [-1135.997] (-1140.125) (-1143.459) -- 0:01:16 627000 -- [-1138.060] (-1145.661) (-1142.243) (-1150.152) * [-1138.453] (-1147.186) (-1144.383) (-1139.779) -- 0:01:16 628000 -- (-1139.425) (-1137.069) (-1154.702) [-1136.326] * (-1144.808) (-1138.103) (-1140.778) [-1139.006] -- 0:01:15 629000 -- [-1145.836] (-1142.344) (-1146.978) (-1144.829) * [-1143.502] (-1146.046) (-1147.725) (-1142.394) -- 0:01:16 630000 -- [-1147.472] (-1144.729) (-1150.955) (-1140.863) * (-1141.873) [-1142.370] (-1154.699) (-1138.597) -- 0:01:15 Average standard deviation of split frequencies: 0.007245 631000 -- (-1140.395) (-1138.506) (-1161.212) [-1142.733] * [-1144.770] (-1149.135) (-1145.464) (-1137.163) -- 0:01:15 632000 -- (-1141.674) (-1146.942) (-1141.151) [-1140.616] * (-1140.315) (-1141.805) [-1142.686] (-1144.540) -- 0:01:15 633000 -- (-1136.251) [-1144.890] (-1141.700) (-1147.583) * (-1143.241) [-1135.419] (-1150.497) (-1142.068) -- 0:01:14 634000 -- (-1137.098) (-1146.952) (-1144.882) [-1137.919] * [-1135.456] (-1140.225) (-1145.467) (-1145.653) -- 0:01:15 635000 -- (-1143.384) (-1146.676) [-1139.756] (-1141.557) * (-1147.164) (-1139.118) (-1139.561) [-1143.620] -- 0:01:14 Average standard deviation of split frequencies: 0.007412 636000 -- (-1143.344) (-1140.620) (-1140.352) [-1139.202] * (-1136.538) [-1142.261] (-1145.276) (-1144.408) -- 0:01:14 637000 -- (-1139.742) (-1139.193) (-1141.880) [-1151.578] * (-1143.508) (-1138.887) [-1142.051] (-1144.824) -- 0:01:14 638000 -- (-1143.070) [-1142.294] (-1140.627) (-1142.191) * (-1151.720) (-1138.129) (-1138.632) [-1146.045] -- 0:01:13 639000 -- (-1144.975) (-1142.543) [-1145.213] (-1147.372) * (-1140.892) (-1144.290) (-1143.969) [-1145.347] -- 0:01:14 640000 -- [-1140.816] (-1148.537) (-1147.123) (-1137.782) * (-1141.764) (-1139.707) [-1145.390] (-1142.386) -- 0:01:13 Average standard deviation of split frequencies: 0.007132 641000 -- (-1143.520) (-1150.130) (-1142.707) [-1143.542] * (-1147.841) (-1151.895) [-1141.309] (-1146.264) -- 0:01:13 642000 -- (-1149.968) (-1144.474) (-1139.991) [-1144.709] * [-1142.249] (-1150.253) (-1141.845) (-1149.278) -- 0:01:13 643000 -- (-1141.771) (-1141.749) (-1150.433) [-1142.218] * [-1138.675] (-1147.385) (-1138.032) (-1140.473) -- 0:01:12 644000 -- [-1138.195] (-1145.300) (-1144.494) (-1143.735) * [-1140.449] (-1142.558) (-1145.073) (-1145.438) -- 0:01:12 645000 -- (-1141.748) (-1145.898) (-1141.517) [-1137.120] * (-1140.981) (-1137.953) [-1149.908] (-1148.390) -- 0:01:12 Average standard deviation of split frequencies: 0.007129 646000 -- (-1142.796) (-1145.017) (-1145.814) [-1144.607] * (-1147.293) (-1141.588) (-1142.517) [-1140.100] -- 0:01:12 647000 -- (-1141.639) (-1143.205) (-1146.954) [-1135.237] * (-1143.673) (-1140.855) [-1144.136] (-1150.116) -- 0:01:12 648000 -- [-1140.754] (-1144.632) (-1149.757) (-1143.976) * (-1139.369) (-1140.538) (-1150.501) [-1147.410] -- 0:01:11 649000 -- (-1159.842) (-1145.653) [-1141.913] (-1143.784) * [-1145.432] (-1141.468) (-1145.506) (-1149.113) -- 0:01:11 650000 -- [-1137.136] (-1139.221) (-1152.798) (-1141.082) * [-1136.729] (-1146.836) (-1139.410) (-1142.980) -- 0:01:11 Average standard deviation of split frequencies: 0.006966 651000 -- [-1136.298] (-1140.846) (-1143.069) (-1142.946) * [-1134.475] (-1150.822) (-1139.830) (-1142.524) -- 0:01:11 652000 -- (-1147.215) (-1141.779) [-1140.662] (-1144.203) * (-1145.087) (-1143.400) [-1134.901] (-1148.776) -- 0:01:10 653000 -- (-1137.977) [-1145.904] (-1135.869) (-1152.254) * (-1139.084) (-1150.026) [-1141.444] (-1141.275) -- 0:01:10 654000 -- [-1135.179] (-1144.361) (-1145.029) (-1141.462) * (-1141.661) (-1145.957) [-1137.539] (-1143.140) -- 0:01:10 655000 -- [-1139.799] (-1145.434) (-1145.438) (-1146.550) * (-1148.513) [-1141.886] (-1142.593) (-1150.867) -- 0:01:10 Average standard deviation of split frequencies: 0.007241 656000 -- (-1149.827) (-1144.535) [-1142.118] (-1145.648) * (-1140.332) [-1147.629] (-1138.715) (-1146.008) -- 0:01:10 657000 -- (-1139.666) [-1139.161] (-1142.495) (-1148.886) * [-1139.138] (-1142.364) (-1143.363) (-1142.188) -- 0:01:09 658000 -- (-1143.866) (-1139.233) [-1141.762] (-1140.747) * (-1141.388) [-1147.034] (-1147.458) (-1143.883) -- 0:01:09 659000 -- (-1144.936) [-1137.722] (-1143.233) (-1141.914) * (-1144.942) (-1143.578) [-1146.905] (-1148.218) -- 0:01:09 660000 -- (-1146.401) [-1142.843] (-1139.347) (-1141.536) * (-1140.166) [-1141.415] (-1140.669) (-1140.689) -- 0:01:09 Average standard deviation of split frequencies: 0.006751 661000 -- (-1147.878) (-1155.391) (-1138.563) [-1144.768] * (-1139.659) (-1144.515) (-1147.505) [-1141.450] -- 0:01:09 662000 -- (-1143.210) (-1144.650) (-1138.317) [-1140.122] * (-1148.887) (-1145.324) (-1140.614) [-1140.460] -- 0:01:08 663000 -- [-1141.488] (-1143.447) (-1139.909) (-1145.500) * (-1150.327) [-1139.031] (-1140.098) (-1149.778) -- 0:01:08 664000 -- (-1143.659) (-1137.716) (-1139.754) [-1143.705] * (-1146.809) (-1145.311) [-1142.251] (-1147.261) -- 0:01:08 665000 -- (-1148.224) (-1133.616) (-1146.607) [-1140.781] * (-1145.667) (-1149.165) (-1138.481) [-1143.428] -- 0:01:08 Average standard deviation of split frequencies: 0.006915 666000 -- (-1144.227) (-1140.087) (-1141.538) [-1141.641] * (-1140.417) (-1148.917) [-1141.836] (-1151.197) -- 0:01:08 667000 -- (-1146.044) (-1137.654) (-1145.169) [-1138.786] * (-1149.506) (-1141.307) (-1143.805) [-1141.746] -- 0:01:07 668000 -- (-1148.404) (-1143.394) [-1138.857] (-1147.098) * [-1147.448] (-1144.166) (-1145.808) (-1142.084) -- 0:01:07 669000 -- (-1140.892) (-1147.796) [-1139.760] (-1155.597) * (-1149.453) (-1142.633) [-1137.463] (-1146.936) -- 0:01:07 670000 -- (-1148.353) [-1139.467] (-1141.249) (-1143.072) * [-1139.943] (-1141.474) (-1143.625) (-1140.950) -- 0:01:07 Average standard deviation of split frequencies: 0.006704 671000 -- (-1143.169) [-1138.017] (-1137.954) (-1138.899) * [-1142.510] (-1148.316) (-1145.712) (-1136.589) -- 0:01:07 672000 -- (-1144.657) (-1139.370) [-1140.560] (-1145.885) * (-1141.976) (-1143.975) [-1136.638] (-1145.102) -- 0:01:06 673000 -- [-1145.023] (-1144.261) (-1147.855) (-1158.031) * [-1141.191] (-1150.341) (-1140.008) (-1152.807) -- 0:01:06 674000 -- (-1145.192) [-1141.870] (-1150.421) (-1140.635) * (-1145.153) (-1148.167) (-1147.206) [-1138.569] -- 0:01:06 675000 -- (-1151.931) [-1140.907] (-1143.421) (-1149.750) * (-1143.332) (-1148.295) (-1144.834) [-1136.616] -- 0:01:06 Average standard deviation of split frequencies: 0.006705 676000 -- (-1146.314) (-1143.048) [-1137.650] (-1148.091) * (-1141.006) (-1149.827) [-1142.510] (-1140.936) -- 0:01:06 677000 -- [-1145.479] (-1140.736) (-1151.486) (-1143.524) * (-1138.591) (-1142.928) (-1144.816) [-1142.177] -- 0:01:05 678000 -- (-1141.441) [-1144.996] (-1143.128) (-1137.834) * [-1136.558] (-1145.567) (-1141.930) (-1139.309) -- 0:01:05 679000 -- (-1156.107) (-1138.422) (-1149.219) [-1141.569] * (-1141.209) (-1141.672) [-1143.062] (-1145.340) -- 0:01:05 680000 -- [-1138.223] (-1149.607) (-1137.577) (-1152.672) * (-1146.413) [-1139.971] (-1141.264) (-1151.599) -- 0:01:05 Average standard deviation of split frequencies: 0.006766 681000 -- (-1140.266) (-1144.903) [-1144.407] (-1142.851) * (-1143.152) [-1140.401] (-1141.598) (-1142.575) -- 0:01:05 682000 -- (-1143.101) (-1139.280) (-1147.394) [-1135.640] * [-1143.450] (-1136.376) (-1141.530) (-1144.962) -- 0:01:04 683000 -- (-1150.684) [-1145.127] (-1144.927) (-1137.872) * [-1139.589] (-1143.801) (-1142.764) (-1142.453) -- 0:01:04 684000 -- (-1142.869) (-1141.129) [-1141.316] (-1142.702) * (-1136.417) (-1144.637) (-1139.253) [-1140.290] -- 0:01:04 685000 -- (-1145.560) (-1137.216) [-1146.883] (-1143.286) * (-1144.488) [-1135.894] (-1147.195) (-1140.492) -- 0:01:04 Average standard deviation of split frequencies: 0.007189 686000 -- (-1145.589) [-1146.333] (-1145.775) (-1142.304) * (-1138.157) [-1136.745] (-1141.269) (-1137.116) -- 0:01:04 687000 -- (-1148.026) (-1138.251) [-1137.371] (-1137.790) * [-1140.250] (-1142.595) (-1142.340) (-1149.284) -- 0:01:03 688000 -- (-1149.148) (-1138.130) (-1142.099) [-1153.009] * (-1145.872) (-1143.955) [-1139.322] (-1150.416) -- 0:01:03 689000 -- (-1155.278) [-1148.123] (-1137.694) (-1140.898) * (-1153.379) [-1142.104] (-1140.846) (-1147.148) -- 0:01:03 690000 -- (-1143.040) [-1141.149] (-1149.541) (-1146.599) * (-1143.760) (-1142.113) [-1131.982] (-1148.464) -- 0:01:03 Average standard deviation of split frequencies: 0.007298 691000 -- (-1150.643) [-1147.186] (-1144.621) (-1141.999) * (-1142.138) [-1141.716] (-1138.807) (-1146.851) -- 0:01:03 692000 -- (-1148.205) (-1144.425) [-1143.048] (-1143.946) * (-1148.201) (-1138.626) [-1144.881] (-1149.055) -- 0:01:02 693000 -- (-1139.750) [-1136.738] (-1140.765) (-1152.898) * (-1141.774) [-1145.797] (-1139.428) (-1147.027) -- 0:01:02 694000 -- [-1138.508] (-1140.557) (-1144.466) (-1147.625) * (-1143.882) (-1143.950) (-1146.490) [-1140.588] -- 0:01:02 695000 -- (-1142.588) [-1143.337] (-1142.197) (-1141.056) * [-1147.609] (-1143.873) (-1146.976) (-1139.974) -- 0:01:02 Average standard deviation of split frequencies: 0.007138 696000 -- [-1143.766] (-1138.893) (-1143.427) (-1145.401) * (-1145.803) (-1140.106) (-1143.408) [-1138.594] -- 0:01:02 697000 -- [-1139.586] (-1141.343) (-1148.173) (-1146.903) * (-1149.127) (-1140.759) (-1145.917) [-1141.548] -- 0:01:01 698000 -- (-1154.879) (-1148.210) (-1151.131) [-1137.044] * (-1146.066) [-1140.269] (-1142.904) (-1150.248) -- 0:01:01 699000 -- [-1139.951] (-1146.709) (-1148.199) (-1148.601) * (-1153.353) [-1142.589] (-1142.602) (-1146.440) -- 0:01:01 700000 -- (-1142.406) (-1139.890) [-1139.444] (-1143.421) * [-1141.342] (-1145.430) (-1142.401) (-1141.883) -- 0:01:01 Average standard deviation of split frequencies: 0.007401 701000 -- (-1147.888) (-1147.262) [-1136.965] (-1151.566) * [-1139.172] (-1148.124) (-1148.736) (-1142.629) -- 0:01:00 702000 -- (-1139.981) (-1149.736) [-1141.845] (-1144.274) * [-1145.799] (-1142.256) (-1142.818) (-1147.834) -- 0:01:00 703000 -- [-1141.956] (-1147.553) (-1149.393) (-1142.047) * [-1139.194] (-1153.488) (-1144.455) (-1150.340) -- 0:01:00 704000 -- [-1142.696] (-1147.359) (-1141.502) (-1144.815) * [-1141.642] (-1143.747) (-1143.721) (-1146.349) -- 0:01:00 705000 -- [-1144.148] (-1138.721) (-1143.114) (-1143.990) * [-1142.876] (-1151.884) (-1148.140) (-1143.152) -- 0:01:00 Average standard deviation of split frequencies: 0.007602 706000 -- (-1153.627) [-1143.729] (-1147.647) (-1139.948) * (-1145.672) [-1136.845] (-1138.611) (-1141.150) -- 0:00:59 707000 -- (-1135.462) (-1145.595) (-1141.453) [-1139.184] * (-1142.111) (-1139.312) [-1141.406] (-1136.292) -- 0:00:59 708000 -- (-1149.264) (-1144.710) (-1138.961) [-1142.483] * (-1139.472) (-1152.032) [-1139.226] (-1146.183) -- 0:00:59 709000 -- (-1140.265) (-1143.561) (-1143.300) [-1148.040] * (-1141.128) (-1152.242) [-1139.552] (-1146.231) -- 0:00:59 710000 -- (-1143.891) (-1150.047) [-1146.171] (-1140.794) * (-1153.217) [-1139.570] (-1138.185) (-1140.821) -- 0:00:59 Average standard deviation of split frequencies: 0.007144 711000 -- (-1143.397) (-1144.686) (-1139.130) [-1138.679] * (-1149.855) (-1145.254) (-1146.772) [-1144.393] -- 0:00:58 712000 -- (-1145.499) [-1144.122] (-1142.132) (-1157.683) * [-1144.287] (-1149.126) (-1145.996) (-1138.722) -- 0:00:58 713000 -- (-1149.455) (-1143.906) [-1148.428] (-1146.138) * (-1145.769) (-1145.514) [-1144.930] (-1139.991) -- 0:00:58 714000 -- (-1140.444) (-1142.283) (-1146.393) [-1134.727] * (-1140.946) (-1150.428) (-1142.416) [-1142.789] -- 0:00:58 715000 -- (-1147.456) (-1144.657) [-1138.535] (-1143.444) * (-1150.368) (-1141.205) [-1142.500] (-1142.853) -- 0:00:58 Average standard deviation of split frequencies: 0.006888 716000 -- (-1145.225) (-1146.323) [-1140.363] (-1144.746) * (-1145.360) (-1136.432) (-1147.114) [-1139.913] -- 0:00:57 717000 -- [-1144.996] (-1143.398) (-1145.299) (-1142.180) * (-1138.590) (-1139.540) (-1142.728) [-1150.951] -- 0:00:57 718000 -- (-1142.107) (-1145.873) [-1141.322] (-1144.364) * (-1149.372) (-1140.032) [-1142.040] (-1143.682) -- 0:00:57 719000 -- (-1140.331) [-1143.038] (-1149.739) (-1148.092) * (-1140.734) [-1144.540] (-1149.992) (-1151.110) -- 0:00:57 720000 -- (-1154.162) (-1142.717) (-1141.123) [-1146.606] * [-1142.768] (-1149.847) (-1140.382) (-1141.205) -- 0:00:57 Average standard deviation of split frequencies: 0.007296 721000 -- (-1144.870) (-1147.989) (-1143.593) [-1142.609] * (-1138.098) [-1144.566] (-1149.002) (-1141.247) -- 0:00:56 722000 -- (-1139.077) [-1138.998] (-1143.861) (-1139.116) * (-1143.342) [-1144.755] (-1149.853) (-1143.719) -- 0:00:56 723000 -- (-1142.194) [-1142.907] (-1141.333) (-1139.546) * [-1145.344] (-1139.296) (-1146.430) (-1144.217) -- 0:00:56 724000 -- (-1140.815) (-1146.392) (-1146.322) [-1140.820] * (-1151.988) (-1153.274) [-1147.579] (-1139.265) -- 0:00:56 725000 -- (-1146.230) [-1141.217] (-1143.615) (-1144.460) * (-1147.835) [-1136.641] (-1140.834) (-1150.875) -- 0:00:56 Average standard deviation of split frequencies: 0.007192 726000 -- (-1143.963) [-1140.978] (-1138.294) (-1151.131) * [-1154.039] (-1141.627) (-1143.846) (-1141.904) -- 0:00:55 727000 -- (-1147.437) [-1136.392] (-1146.947) (-1144.547) * (-1139.917) (-1136.559) (-1143.475) [-1135.720] -- 0:00:55 728000 -- (-1144.074) (-1140.771) [-1140.313] (-1154.721) * (-1146.363) [-1139.298] (-1141.371) (-1146.948) -- 0:00:55 729000 -- (-1146.257) (-1141.209) [-1136.321] (-1145.406) * (-1146.847) (-1142.721) [-1137.703] (-1146.026) -- 0:00:55 730000 -- [-1142.647] (-1137.115) (-1144.428) (-1148.421) * (-1136.960) [-1137.431] (-1144.588) (-1153.041) -- 0:00:55 Average standard deviation of split frequencies: 0.008139 731000 -- (-1155.525) (-1145.964) [-1140.446] (-1140.191) * (-1137.566) [-1139.764] (-1140.714) (-1152.700) -- 0:00:54 732000 -- [-1147.711] (-1142.981) (-1151.750) (-1139.423) * [-1139.464] (-1138.433) (-1143.682) (-1139.011) -- 0:00:54 733000 -- (-1147.150) [-1139.746] (-1145.007) (-1136.369) * (-1153.999) (-1145.395) (-1141.805) [-1147.072] -- 0:00:54 734000 -- [-1137.822] (-1135.720) (-1145.953) (-1150.449) * [-1141.848] (-1140.087) (-1147.444) (-1149.670) -- 0:00:54 735000 -- (-1142.322) (-1145.948) (-1151.013) [-1140.335] * [-1143.746] (-1140.484) (-1148.091) (-1145.625) -- 0:00:54 Average standard deviation of split frequencies: 0.008031 736000 -- (-1140.375) [-1140.867] (-1150.629) (-1140.972) * [-1141.341] (-1146.212) (-1139.970) (-1143.073) -- 0:00:53 737000 -- (-1144.711) (-1142.664) (-1149.959) [-1138.784] * (-1136.157) [-1139.198] (-1150.326) (-1149.619) -- 0:00:53 738000 -- (-1142.187) (-1141.938) (-1144.889) [-1142.550] * (-1141.111) (-1154.159) (-1145.380) [-1137.532] -- 0:00:53 739000 -- (-1139.262) (-1148.983) (-1145.090) [-1137.277] * (-1138.679) (-1138.281) (-1147.452) [-1140.729] -- 0:00:53 740000 -- (-1136.592) [-1143.654] (-1142.230) (-1149.909) * (-1148.897) (-1134.927) [-1141.679] (-1144.524) -- 0:00:53 Average standard deviation of split frequencies: 0.008176 741000 -- [-1140.976] (-1148.124) (-1149.655) (-1140.727) * (-1141.051) (-1143.444) (-1150.828) [-1139.400] -- 0:00:52 742000 -- (-1144.263) (-1143.561) (-1140.848) [-1140.915] * (-1148.154) (-1147.223) (-1141.279) [-1145.524] -- 0:00:52 743000 -- (-1139.912) [-1140.927] (-1141.862) (-1141.302) * (-1152.375) (-1151.538) [-1138.262] (-1142.816) -- 0:00:52 744000 -- (-1141.343) (-1139.916) (-1139.134) [-1143.840] * (-1137.254) [-1135.656] (-1142.928) (-1152.309) -- 0:00:52 745000 -- (-1142.058) [-1138.074] (-1144.382) (-1141.850) * (-1140.472) [-1139.184] (-1144.662) (-1141.453) -- 0:00:52 Average standard deviation of split frequencies: 0.008166 746000 -- (-1138.094) (-1140.934) [-1144.206] (-1137.179) * (-1142.437) [-1141.587] (-1143.758) (-1146.554) -- 0:00:51 747000 -- (-1141.297) [-1143.287] (-1149.372) (-1149.151) * (-1142.835) [-1138.482] (-1142.522) (-1146.163) -- 0:00:51 748000 -- (-1136.347) (-1145.795) (-1146.723) [-1138.821] * (-1159.259) (-1142.384) [-1136.500] (-1144.053) -- 0:00:51 749000 -- (-1142.097) [-1142.060] (-1139.307) (-1141.276) * (-1157.564) [-1141.670] (-1142.908) (-1147.263) -- 0:00:51 750000 -- (-1139.673) [-1140.371] (-1141.577) (-1151.378) * (-1146.676) (-1147.550) (-1143.572) [-1141.761] -- 0:00:51 Average standard deviation of split frequencies: 0.007729 751000 -- (-1141.663) (-1145.928) [-1138.132] (-1144.248) * (-1142.476) (-1156.156) [-1141.091] (-1140.025) -- 0:00:50 752000 -- [-1136.133] (-1144.690) (-1145.179) (-1139.251) * (-1140.568) (-1142.417) (-1151.799) [-1139.799] -- 0:00:50 753000 -- (-1137.354) [-1138.368] (-1141.269) (-1151.858) * (-1141.190) (-1143.470) (-1146.725) [-1137.772] -- 0:00:50 754000 -- (-1141.046) (-1145.751) (-1145.840) [-1144.176] * [-1142.018] (-1141.373) (-1143.614) (-1143.021) -- 0:00:50 755000 -- (-1142.786) (-1138.502) (-1139.305) [-1135.501] * (-1142.337) [-1142.304] (-1148.879) (-1148.427) -- 0:00:49 Average standard deviation of split frequencies: 0.007147 756000 -- (-1143.324) (-1138.275) [-1140.921] (-1144.009) * [-1139.016] (-1149.743) (-1142.879) (-1146.599) -- 0:00:49 757000 -- (-1141.489) (-1154.010) [-1137.660] (-1143.480) * (-1153.399) (-1143.125) (-1136.856) [-1138.227] -- 0:00:49 758000 -- [-1152.645] (-1151.191) (-1153.147) (-1141.330) * [-1145.634] (-1146.856) (-1144.141) (-1139.696) -- 0:00:49 759000 -- (-1146.972) (-1142.407) [-1143.550] (-1144.845) * (-1144.637) (-1145.202) [-1136.406] (-1141.493) -- 0:00:49 760000 -- [-1140.679] (-1143.794) (-1142.417) (-1150.444) * (-1141.794) (-1152.210) [-1138.704] (-1142.966) -- 0:00:48 Average standard deviation of split frequencies: 0.006626 761000 -- (-1149.575) [-1143.208] (-1147.277) (-1147.922) * (-1146.250) (-1144.915) (-1150.446) [-1145.719] -- 0:00:48 762000 -- [-1141.781] (-1147.493) (-1141.547) (-1141.917) * (-1140.985) [-1143.626] (-1143.941) (-1136.683) -- 0:00:48 763000 -- (-1149.169) (-1143.777) (-1138.326) [-1142.439] * (-1141.825) (-1144.750) [-1142.364] (-1145.639) -- 0:00:48 764000 -- (-1147.526) [-1147.933] (-1146.360) (-1140.062) * (-1151.895) [-1140.936] (-1137.893) (-1141.491) -- 0:00:48 765000 -- (-1146.473) (-1141.927) (-1145.178) [-1139.571] * (-1140.058) (-1147.887) [-1146.769] (-1145.554) -- 0:00:47 Average standard deviation of split frequencies: 0.006438 766000 -- (-1138.363) (-1139.651) (-1143.196) [-1148.039] * [-1140.670] (-1143.528) (-1137.440) (-1147.203) -- 0:00:47 767000 -- (-1144.559) (-1141.489) [-1138.155] (-1145.477) * (-1145.233) (-1150.879) [-1144.440] (-1139.934) -- 0:00:47 768000 -- (-1150.758) (-1140.589) [-1142.410] (-1141.877) * (-1140.188) (-1151.914) [-1134.101] (-1146.150) -- 0:00:47 769000 -- (-1143.791) [-1145.001] (-1149.446) (-1138.005) * (-1140.372) [-1146.923] (-1140.625) (-1143.528) -- 0:00:47 770000 -- (-1142.403) (-1142.629) [-1139.176] (-1141.581) * (-1143.666) [-1139.511] (-1143.324) (-1145.572) -- 0:00:46 Average standard deviation of split frequencies: 0.007434 771000 -- [-1142.407] (-1142.538) (-1140.343) (-1144.275) * (-1142.283) [-1141.180] (-1144.655) (-1144.832) -- 0:00:46 772000 -- [-1135.951] (-1144.029) (-1144.307) (-1140.342) * (-1153.498) (-1139.393) (-1141.715) [-1139.697] -- 0:00:46 773000 -- (-1135.081) (-1139.481) [-1140.908] (-1145.848) * [-1145.992] (-1146.553) (-1146.733) (-1144.933) -- 0:00:46 774000 -- (-1142.454) (-1140.710) (-1140.254) [-1138.776] * [-1142.203] (-1149.547) (-1143.788) (-1143.496) -- 0:00:46 775000 -- (-1144.673) (-1151.397) [-1140.990] (-1141.626) * (-1149.850) [-1135.536] (-1143.117) (-1145.470) -- 0:00:45 Average standard deviation of split frequencies: 0.007383 776000 -- (-1140.445) [-1143.809] (-1142.615) (-1141.944) * (-1145.672) (-1138.116) [-1137.781] (-1141.514) -- 0:00:45 777000 -- [-1145.082] (-1156.315) (-1141.024) (-1151.856) * (-1151.440) (-1144.798) [-1140.377] (-1138.913) -- 0:00:45 778000 -- (-1139.766) (-1147.531) [-1141.406] (-1145.726) * (-1145.893) (-1138.515) (-1145.075) [-1140.148] -- 0:00:45 779000 -- (-1137.864) (-1150.637) (-1144.225) [-1143.841] * (-1151.134) (-1139.521) (-1148.695) [-1138.110] -- 0:00:45 780000 -- (-1146.230) (-1152.096) (-1141.792) [-1143.360] * (-1145.646) [-1140.757] (-1154.375) (-1142.429) -- 0:00:44 Average standard deviation of split frequencies: 0.007478 781000 -- (-1151.228) [-1140.079] (-1143.667) (-1142.432) * (-1143.919) (-1141.946) [-1139.376] (-1141.496) -- 0:00:44 782000 -- (-1149.620) (-1139.512) (-1142.167) [-1140.290] * [-1138.932] (-1143.542) (-1142.834) (-1139.405) -- 0:00:44 783000 -- [-1146.482] (-1140.140) (-1140.797) (-1146.967) * (-1142.528) (-1142.317) (-1155.058) [-1145.937] -- 0:00:44 784000 -- [-1133.926] (-1142.674) (-1142.386) (-1150.164) * (-1141.724) (-1143.798) (-1143.880) [-1144.360] -- 0:00:44 785000 -- [-1141.070] (-1137.904) (-1144.390) (-1141.064) * (-1141.459) [-1138.794] (-1137.884) (-1142.835) -- 0:00:43 Average standard deviation of split frequencies: 0.007289 786000 -- [-1144.079] (-1144.166) (-1141.922) (-1143.143) * (-1140.677) (-1139.040) [-1137.833] (-1143.158) -- 0:00:43 787000 -- (-1145.228) [-1142.673] (-1142.280) (-1152.921) * [-1137.440] (-1145.317) (-1143.028) (-1148.424) -- 0:00:43 788000 -- (-1149.166) (-1137.247) (-1143.797) [-1143.997] * (-1144.122) [-1138.481] (-1142.058) (-1147.064) -- 0:00:43 789000 -- [-1142.643] (-1150.220) (-1143.418) (-1146.907) * (-1135.859) (-1154.220) [-1147.052] (-1144.576) -- 0:00:43 790000 -- (-1143.897) (-1134.397) [-1149.729] (-1149.002) * [-1139.551] (-1144.928) (-1142.995) (-1137.978) -- 0:00:42 Average standard deviation of split frequencies: 0.007384 791000 -- (-1141.558) (-1139.916) (-1149.025) [-1143.345] * [-1136.166] (-1148.767) (-1149.397) (-1146.161) -- 0:00:42 792000 -- (-1145.867) (-1139.142) [-1139.199] (-1137.870) * (-1147.338) (-1141.981) (-1140.668) [-1142.970] -- 0:00:42 793000 -- (-1136.792) (-1137.758) [-1142.289] (-1135.377) * (-1143.705) (-1145.781) [-1140.146] (-1137.769) -- 0:00:42 794000 -- (-1143.411) [-1136.920] (-1134.483) (-1151.626) * (-1139.155) [-1142.010] (-1144.695) (-1142.063) -- 0:00:42 795000 -- (-1144.420) (-1140.745) [-1140.697] (-1140.836) * (-1145.610) [-1140.628] (-1143.104) (-1138.620) -- 0:00:41 Average standard deviation of split frequencies: 0.007107 796000 -- (-1143.782) [-1135.434] (-1143.008) (-1146.814) * (-1142.566) (-1140.843) (-1147.827) [-1134.703] -- 0:00:41 797000 -- (-1146.447) [-1142.555] (-1132.532) (-1148.472) * (-1145.092) [-1139.018] (-1138.253) (-1135.657) -- 0:00:41 798000 -- (-1142.314) (-1146.331) (-1143.431) [-1139.759] * (-1144.159) (-1144.153) (-1140.218) [-1138.413] -- 0:00:41 799000 -- (-1139.747) (-1142.964) [-1137.454] (-1151.488) * (-1148.127) (-1138.400) (-1147.477) [-1139.392] -- 0:00:41 800000 -- (-1141.658) (-1148.146) (-1142.930) [-1143.763] * [-1146.687] (-1137.528) (-1144.189) (-1153.065) -- 0:00:40 Average standard deviation of split frequencies: 0.006975 801000 -- (-1142.094) [-1138.219] (-1139.230) (-1144.551) * (-1144.740) [-1144.433] (-1139.514) (-1147.394) -- 0:00:40 802000 -- (-1143.662) (-1145.072) (-1142.967) [-1151.502] * (-1138.057) [-1147.424] (-1143.942) (-1145.027) -- 0:00:40 803000 -- (-1139.419) (-1143.480) [-1144.921] (-1149.626) * (-1142.173) (-1147.412) [-1140.746] (-1146.361) -- 0:00:40 804000 -- (-1138.369) (-1147.765) (-1137.351) [-1138.695] * [-1140.626] (-1143.631) (-1146.475) (-1144.262) -- 0:00:39 805000 -- (-1140.039) (-1149.087) (-1138.774) [-1140.319] * (-1142.097) (-1143.526) [-1137.844] (-1144.097) -- 0:00:39 Average standard deviation of split frequencies: 0.007108 806000 -- [-1140.834] (-1144.513) (-1143.575) (-1136.939) * (-1142.180) (-1144.333) (-1143.678) [-1141.938] -- 0:00:39 807000 -- (-1143.969) [-1143.750] (-1149.402) (-1132.126) * (-1146.346) (-1138.239) (-1140.047) [-1138.669] -- 0:00:39 808000 -- (-1145.588) (-1151.651) [-1142.362] (-1149.723) * (-1153.961) (-1143.288) (-1151.109) [-1140.278] -- 0:00:39 809000 -- (-1144.021) (-1143.431) (-1142.289) [-1142.294] * (-1140.261) (-1146.992) (-1139.300) [-1136.358] -- 0:00:38 810000 -- (-1141.089) (-1146.707) (-1138.844) [-1141.724] * (-1143.166) [-1145.250] (-1156.931) (-1147.164) -- 0:00:38 Average standard deviation of split frequencies: 0.006754 811000 -- [-1145.810] (-1151.577) (-1140.375) (-1141.296) * (-1144.821) [-1144.135] (-1143.690) (-1138.564) -- 0:00:38 812000 -- (-1144.355) [-1142.110] (-1135.339) (-1141.720) * (-1141.105) (-1141.033) [-1141.763] (-1145.719) -- 0:00:38 813000 -- (-1146.774) (-1141.777) (-1139.355) [-1141.194] * [-1137.439] (-1141.486) (-1147.539) (-1149.496) -- 0:00:38 814000 -- (-1146.173) (-1140.636) [-1150.406] (-1146.358) * (-1141.032) [-1150.958] (-1141.771) (-1140.285) -- 0:00:37 815000 -- (-1141.390) (-1142.286) (-1151.790) [-1140.394] * (-1142.022) (-1146.615) [-1150.869] (-1140.587) -- 0:00:37 Average standard deviation of split frequencies: 0.006977 816000 -- (-1142.893) (-1144.250) (-1141.794) [-1137.013] * (-1152.109) (-1151.965) [-1151.081] (-1146.573) -- 0:00:37 817000 -- (-1135.495) (-1142.025) (-1155.312) [-1138.505] * (-1140.839) [-1134.414] (-1143.997) (-1141.852) -- 0:00:37 818000 -- (-1141.006) [-1147.203] (-1147.461) (-1143.635) * [-1138.034] (-1142.497) (-1143.780) (-1141.474) -- 0:00:37 819000 -- [-1135.681] (-1149.817) (-1150.600) (-1140.158) * (-1139.722) (-1140.416) [-1140.110] (-1135.127) -- 0:00:36 820000 -- [-1141.373] (-1141.569) (-1144.078) (-1139.064) * [-1139.785] (-1147.737) (-1141.164) (-1146.271) -- 0:00:36 Average standard deviation of split frequencies: 0.006849 821000 -- [-1142.804] (-1141.617) (-1142.498) (-1146.553) * (-1146.945) [-1139.631] (-1140.961) (-1140.899) -- 0:00:36 822000 -- (-1137.488) (-1157.798) (-1143.181) [-1143.546] * (-1140.599) (-1148.302) [-1137.587] (-1149.911) -- 0:00:36 823000 -- (-1143.636) [-1142.661] (-1135.040) (-1147.607) * (-1146.894) (-1145.440) [-1140.918] (-1141.301) -- 0:00:36 824000 -- (-1147.519) (-1147.565) [-1144.168] (-1142.804) * (-1154.091) (-1147.881) (-1149.034) [-1141.840] -- 0:00:35 825000 -- [-1143.208] (-1138.343) (-1139.630) (-1148.626) * [-1143.638] (-1155.288) (-1153.627) (-1139.420) -- 0:00:35 Average standard deviation of split frequencies: 0.006673 826000 -- (-1138.192) (-1148.760) [-1140.974] (-1158.777) * (-1144.230) (-1138.298) (-1154.707) [-1140.869] -- 0:00:35 827000 -- (-1147.868) (-1140.746) (-1141.361) [-1137.509] * [-1139.622] (-1135.925) (-1139.586) (-1138.677) -- 0:00:35 828000 -- (-1144.533) (-1140.930) [-1141.251] (-1141.503) * (-1140.808) (-1144.614) (-1142.626) [-1136.007] -- 0:00:35 829000 -- (-1147.128) (-1138.282) (-1147.879) [-1135.333] * (-1147.803) (-1149.169) [-1139.865] (-1148.169) -- 0:00:34 830000 -- (-1152.464) (-1141.006) [-1145.729] (-1143.957) * (-1148.606) (-1139.606) (-1146.947) [-1140.078] -- 0:00:34 Average standard deviation of split frequencies: 0.006897 831000 -- (-1152.002) [-1135.800] (-1145.943) (-1150.195) * (-1152.432) (-1146.777) [-1143.164] (-1144.005) -- 0:00:34 832000 -- (-1148.517) (-1145.629) [-1140.484] (-1151.849) * (-1142.485) [-1141.543] (-1146.493) (-1149.066) -- 0:00:34 833000 -- [-1137.725] (-1144.196) (-1142.736) (-1147.848) * (-1140.635) (-1148.395) [-1139.677] (-1137.295) -- 0:00:34 834000 -- (-1141.334) [-1142.007] (-1144.864) (-1143.514) * (-1147.603) [-1143.139] (-1138.009) (-1148.548) -- 0:00:33 835000 -- [-1141.724] (-1138.185) (-1143.663) (-1142.926) * (-1146.132) [-1139.403] (-1146.756) (-1150.322) -- 0:00:33 Average standard deviation of split frequencies: 0.006853 836000 -- (-1148.037) (-1142.082) (-1147.169) [-1145.318] * (-1146.044) (-1140.785) [-1142.301] (-1148.302) -- 0:00:33 837000 -- (-1146.655) [-1139.140] (-1153.198) (-1140.755) * (-1142.115) [-1141.693] (-1140.033) (-1142.272) -- 0:00:33 838000 -- (-1143.859) (-1136.474) [-1136.171] (-1144.404) * (-1144.366) (-1143.290) [-1142.157] (-1144.228) -- 0:00:33 839000 -- (-1139.146) (-1148.654) [-1148.038] (-1145.042) * (-1140.729) (-1137.156) [-1142.570] (-1139.898) -- 0:00:32 840000 -- (-1142.388) [-1141.270] (-1147.850) (-1149.668) * [-1142.808] (-1144.736) (-1152.200) (-1142.227) -- 0:00:32 Average standard deviation of split frequencies: 0.007203 841000 -- (-1146.243) (-1140.862) [-1136.329] (-1155.882) * (-1148.826) [-1147.543] (-1147.371) (-1140.534) -- 0:00:32 842000 -- (-1142.831) [-1139.615] (-1136.813) (-1162.277) * (-1151.602) (-1140.754) (-1141.431) [-1144.001] -- 0:00:32 843000 -- [-1145.951] (-1150.763) (-1139.918) (-1146.512) * [-1143.315] (-1146.370) (-1143.079) (-1139.831) -- 0:00:32 844000 -- (-1137.404) (-1140.132) [-1143.490] (-1135.922) * (-1140.209) [-1139.071] (-1141.857) (-1150.018) -- 0:00:31 845000 -- [-1137.188] (-1142.403) (-1147.846) (-1141.601) * [-1144.984] (-1147.970) (-1138.499) (-1140.598) -- 0:00:31 Average standard deviation of split frequencies: 0.006429 846000 -- [-1141.498] (-1146.451) (-1147.127) (-1146.986) * (-1145.393) (-1140.942) (-1139.123) [-1142.179] -- 0:00:31 847000 -- (-1148.185) (-1141.642) (-1137.233) [-1136.080] * (-1153.738) (-1145.697) [-1143.191] (-1139.609) -- 0:00:31 848000 -- (-1146.735) (-1149.368) (-1145.884) [-1149.900] * (-1137.551) [-1143.412] (-1147.522) (-1136.196) -- 0:00:31 849000 -- (-1145.614) (-1147.262) [-1147.727] (-1138.148) * (-1139.807) (-1144.973) (-1149.482) [-1138.409] -- 0:00:30 850000 -- [-1145.727] (-1145.611) (-1144.065) (-1137.105) * [-1144.666] (-1142.640) (-1141.380) (-1139.882) -- 0:00:30 Average standard deviation of split frequencies: 0.006522 851000 -- (-1144.234) [-1142.043] (-1142.670) (-1137.128) * (-1144.833) (-1149.687) [-1138.637] (-1135.064) -- 0:00:30 852000 -- (-1142.683) (-1149.354) [-1140.474] (-1140.601) * (-1140.540) (-1141.308) [-1139.104] (-1145.488) -- 0:00:30 853000 -- [-1144.557] (-1141.573) (-1143.423) (-1138.285) * [-1142.538] (-1142.466) (-1140.105) (-1151.001) -- 0:00:29 854000 -- (-1137.415) [-1136.712] (-1138.725) (-1156.018) * (-1142.244) [-1150.094] (-1143.807) (-1146.064) -- 0:00:29 855000 -- [-1141.523] (-1140.653) (-1141.768) (-1145.329) * (-1142.735) [-1141.505] (-1141.589) (-1153.036) -- 0:00:29 Average standard deviation of split frequencies: 0.006608 856000 -- [-1143.851] (-1150.850) (-1142.543) (-1144.469) * (-1148.293) (-1141.743) [-1144.111] (-1140.800) -- 0:00:29 857000 -- (-1139.069) (-1145.195) [-1136.008] (-1139.710) * [-1134.685] (-1140.257) (-1144.534) (-1145.798) -- 0:00:29 858000 -- (-1139.257) (-1143.946) [-1147.230] (-1139.389) * (-1139.591) [-1139.714] (-1152.584) (-1142.680) -- 0:00:28 859000 -- (-1145.526) (-1141.789) (-1137.855) [-1141.784] * (-1143.540) (-1148.382) [-1150.452] (-1146.119) -- 0:00:28 860000 -- (-1152.361) [-1143.456] (-1136.733) (-1154.208) * [-1137.791] (-1154.613) (-1152.899) (-1144.264) -- 0:00:28 Average standard deviation of split frequencies: 0.006236 861000 -- (-1147.848) (-1137.282) [-1141.843] (-1143.114) * (-1144.491) (-1139.058) (-1146.844) [-1144.630] -- 0:00:28 862000 -- (-1142.751) [-1145.843] (-1142.177) (-1144.086) * (-1138.742) (-1140.607) (-1142.325) [-1138.763] -- 0:00:28 863000 -- (-1141.416) (-1141.064) (-1148.990) [-1135.812] * (-1141.134) (-1147.174) (-1151.661) [-1149.116] -- 0:00:27 864000 -- (-1142.833) [-1137.802] (-1144.646) (-1136.679) * (-1141.434) (-1142.836) [-1135.924] (-1143.253) -- 0:00:27 865000 -- (-1156.590) (-1143.794) [-1139.443] (-1141.357) * (-1146.866) (-1143.204) (-1143.330) [-1138.676] -- 0:00:27 Average standard deviation of split frequencies: 0.005820 866000 -- (-1142.875) [-1149.568] (-1133.456) (-1139.555) * [-1139.654] (-1148.664) (-1149.121) (-1149.202) -- 0:00:27 867000 -- (-1145.903) (-1141.207) [-1143.470] (-1141.324) * (-1143.029) (-1139.927) (-1146.685) [-1136.753] -- 0:00:27 868000 -- [-1145.033] (-1145.537) (-1139.952) (-1140.199) * (-1141.368) (-1143.682) [-1139.505] (-1148.704) -- 0:00:26 869000 -- (-1138.961) (-1146.696) [-1139.779] (-1138.485) * [-1144.303] (-1138.637) (-1139.943) (-1140.867) -- 0:00:26 870000 -- (-1150.986) (-1142.313) [-1139.655] (-1146.262) * (-1136.203) [-1141.349] (-1140.723) (-1144.934) -- 0:00:26 Average standard deviation of split frequencies: 0.006081 871000 -- (-1150.955) [-1145.318] (-1145.254) (-1146.903) * (-1140.082) (-1143.406) [-1140.126] (-1141.480) -- 0:00:26 872000 -- (-1146.116) (-1142.735) [-1141.065] (-1147.810) * (-1150.178) (-1141.669) [-1141.874] (-1145.281) -- 0:00:26 873000 -- [-1142.276] (-1145.925) (-1158.564) (-1147.261) * [-1142.379] (-1142.743) (-1145.297) (-1145.176) -- 0:00:25 874000 -- [-1142.588] (-1145.061) (-1142.630) (-1145.859) * (-1140.520) [-1142.204] (-1151.883) (-1142.766) -- 0:00:25 875000 -- (-1149.751) (-1138.810) (-1145.975) [-1143.664] * (-1140.748) (-1137.155) (-1152.410) [-1144.793] -- 0:00:25 Average standard deviation of split frequencies: 0.006333 876000 -- (-1150.073) [-1146.391] (-1140.822) (-1141.065) * (-1139.939) (-1149.583) (-1155.857) [-1140.602] -- 0:00:25 877000 -- (-1145.842) [-1143.443] (-1139.734) (-1147.950) * (-1138.415) (-1136.412) [-1140.247] (-1150.354) -- 0:00:25 878000 -- (-1140.836) (-1144.490) [-1139.369] (-1141.964) * (-1137.298) (-1145.204) (-1141.192) [-1138.805] -- 0:00:24 879000 -- (-1146.441) (-1138.340) (-1140.028) [-1143.656] * [-1144.022] (-1139.842) (-1148.757) (-1149.463) -- 0:00:24 880000 -- [-1145.406] (-1139.107) (-1140.625) (-1148.073) * (-1146.202) (-1142.349) (-1144.455) [-1140.620] -- 0:00:24 Average standard deviation of split frequencies: 0.005847 881000 -- [-1145.799] (-1146.275) (-1141.470) (-1144.202) * [-1142.759] (-1139.914) (-1141.882) (-1134.104) -- 0:00:24 882000 -- [-1141.727] (-1139.129) (-1148.766) (-1150.585) * [-1142.266] (-1145.109) (-1151.895) (-1137.002) -- 0:00:24 883000 -- [-1137.829] (-1140.139) (-1144.923) (-1142.599) * (-1145.769) (-1141.229) (-1144.998) [-1140.278] -- 0:00:23 884000 -- (-1142.162) (-1140.128) [-1142.596] (-1144.346) * (-1151.680) (-1139.538) (-1147.543) [-1140.948] -- 0:00:23 885000 -- (-1149.890) [-1140.568] (-1140.077) (-1142.994) * [-1139.774] (-1141.910) (-1154.779) (-1148.134) -- 0:00:23 Average standard deviation of split frequencies: 0.005812 886000 -- (-1143.078) (-1144.162) (-1143.676) [-1141.068] * (-1141.319) [-1141.993] (-1152.488) (-1148.645) -- 0:00:23 887000 -- (-1142.199) (-1142.076) [-1145.950] (-1140.120) * (-1139.732) [-1141.019] (-1148.067) (-1149.248) -- 0:00:23 888000 -- (-1145.441) (-1146.913) (-1146.030) [-1143.818] * (-1135.778) (-1138.982) [-1143.646] (-1140.342) -- 0:00:22 889000 -- (-1147.427) (-1152.965) [-1144.641] (-1142.685) * [-1144.753] (-1150.995) (-1140.551) (-1141.688) -- 0:00:22 890000 -- [-1139.126] (-1142.650) (-1144.136) (-1144.700) * (-1148.985) (-1152.816) (-1139.074) [-1138.636] -- 0:00:22 Average standard deviation of split frequencies: 0.005333 891000 -- (-1143.354) (-1137.155) [-1135.705] (-1146.542) * [-1148.067] (-1140.032) (-1142.620) (-1141.837) -- 0:00:22 892000 -- (-1145.718) (-1143.809) [-1140.008] (-1144.473) * (-1151.626) (-1141.142) (-1149.385) [-1140.301] -- 0:00:22 893000 -- [-1145.889] (-1142.400) (-1144.167) (-1151.445) * (-1142.133) (-1148.960) (-1156.650) [-1140.869] -- 0:00:21 894000 -- [-1138.882] (-1139.965) (-1148.171) (-1142.576) * [-1145.012] (-1140.222) (-1146.886) (-1142.939) -- 0:00:21 895000 -- (-1140.702) (-1147.081) [-1137.604] (-1151.376) * (-1145.239) (-1144.879) [-1147.607] (-1138.789) -- 0:00:21 Average standard deviation of split frequencies: 0.005099 896000 -- [-1139.549] (-1142.936) (-1147.550) (-1148.443) * (-1144.179) (-1137.916) [-1142.737] (-1143.820) -- 0:00:21 897000 -- (-1138.891) (-1146.989) (-1139.314) [-1147.456] * (-1146.888) (-1140.881) (-1141.003) [-1146.432] -- 0:00:21 898000 -- (-1144.756) (-1139.004) [-1138.872] (-1134.427) * [-1141.693] (-1146.024) (-1139.486) (-1139.027) -- 0:00:20 899000 -- [-1134.575] (-1141.579) (-1143.823) (-1138.158) * [-1144.746] (-1142.846) (-1145.478) (-1151.830) -- 0:00:20 900000 -- [-1139.755] (-1141.110) (-1148.218) (-1140.918) * (-1143.446) (-1147.819) (-1142.056) [-1138.429] -- 0:00:20 Average standard deviation of split frequencies: 0.005153 901000 -- [-1137.595] (-1140.607) (-1143.769) (-1147.936) * (-1157.642) [-1135.665] (-1141.861) (-1137.031) -- 0:00:20 902000 -- [-1133.798] (-1144.446) (-1143.651) (-1144.448) * [-1140.144] (-1145.686) (-1151.303) (-1138.257) -- 0:00:19 903000 -- [-1136.396] (-1143.901) (-1140.867) (-1146.875) * (-1143.211) (-1138.753) [-1138.213] (-1140.499) -- 0:00:19 904000 -- (-1141.697) [-1139.149] (-1146.092) (-1143.875) * (-1148.432) (-1139.777) (-1149.152) [-1146.084] -- 0:00:19 905000 -- (-1142.386) [-1143.742] (-1137.865) (-1147.845) * (-1141.089) [-1139.589] (-1142.566) (-1138.349) -- 0:00:19 Average standard deviation of split frequencies: 0.004923 906000 -- (-1139.633) (-1144.654) [-1143.371] (-1136.112) * [-1141.193] (-1149.277) (-1152.512) (-1147.989) -- 0:00:19 907000 -- (-1146.789) (-1145.226) [-1138.919] (-1139.148) * (-1140.118) (-1139.378) [-1147.702] (-1153.997) -- 0:00:18 908000 -- (-1143.327) (-1141.244) [-1138.172] (-1148.926) * [-1143.142] (-1140.092) (-1142.990) (-1145.727) -- 0:00:18 909000 -- (-1148.241) [-1142.336] (-1148.877) (-1145.511) * (-1146.307) (-1141.333) (-1145.859) [-1140.688] -- 0:00:18 910000 -- (-1138.897) (-1141.193) [-1140.705] (-1144.754) * (-1144.587) (-1145.072) [-1143.319] (-1139.571) -- 0:00:18 Average standard deviation of split frequencies: 0.004738 911000 -- (-1140.610) (-1144.617) [-1141.781] (-1144.835) * (-1141.167) (-1147.350) [-1145.311] (-1145.032) -- 0:00:18 912000 -- [-1143.148] (-1140.839) (-1144.726) (-1141.995) * (-1137.533) (-1142.376) (-1145.628) [-1140.563] -- 0:00:17 913000 -- (-1137.987) (-1143.659) [-1133.296] (-1143.185) * [-1145.018] (-1138.789) (-1153.329) (-1140.239) -- 0:00:17 914000 -- (-1144.561) (-1141.889) (-1136.755) [-1138.585] * (-1147.065) (-1143.104) (-1146.273) [-1146.342] -- 0:00:17 915000 -- [-1148.926] (-1142.353) (-1142.673) (-1148.407) * [-1140.350] (-1147.579) (-1157.753) (-1139.771) -- 0:00:17 Average standard deviation of split frequencies: 0.004790 916000 -- (-1145.677) [-1147.873] (-1145.242) (-1145.178) * (-1135.703) (-1142.229) (-1151.192) [-1140.727] -- 0:00:17 917000 -- [-1137.701] (-1145.063) (-1144.234) (-1146.777) * (-1145.083) [-1140.989] (-1146.678) (-1144.811) -- 0:00:16 918000 -- [-1138.814] (-1147.520) (-1140.658) (-1152.233) * [-1143.942] (-1143.309) (-1141.646) (-1149.376) -- 0:00:16 919000 -- (-1143.895) (-1146.571) [-1142.901] (-1143.123) * (-1148.473) (-1146.664) [-1143.047] (-1145.577) -- 0:00:16 920000 -- (-1139.658) (-1148.513) [-1141.995] (-1149.155) * (-1145.494) [-1139.632] (-1154.124) (-1140.648) -- 0:00:16 Average standard deviation of split frequencies: 0.004608 921000 -- (-1147.416) (-1149.785) [-1140.592] (-1148.941) * (-1141.490) (-1150.404) (-1154.374) [-1142.115] -- 0:00:16 922000 -- (-1146.567) [-1142.183] (-1145.437) (-1147.468) * (-1153.342) (-1146.940) [-1140.895] (-1146.852) -- 0:00:15 923000 -- (-1141.854) [-1142.028] (-1144.516) (-1145.775) * (-1147.943) (-1142.181) [-1143.492] (-1138.199) -- 0:00:15 924000 -- (-1143.021) (-1145.497) (-1143.033) [-1148.400] * (-1145.660) [-1147.013] (-1143.374) (-1151.420) -- 0:00:15 925000 -- (-1152.650) (-1145.747) (-1135.801) [-1138.440] * [-1141.576] (-1148.676) (-1143.111) (-1137.269) -- 0:00:15 Average standard deviation of split frequencies: 0.004699 926000 -- [-1143.457] (-1147.510) (-1140.646) (-1145.133) * [-1142.326] (-1140.900) (-1146.542) (-1138.540) -- 0:00:15 927000 -- [-1142.430] (-1141.375) (-1146.518) (-1150.201) * (-1149.402) (-1150.702) (-1148.007) [-1140.316] -- 0:00:14 928000 -- [-1143.063] (-1143.843) (-1146.217) (-1144.123) * (-1144.467) [-1143.933] (-1142.944) (-1143.213) -- 0:00:14 929000 -- (-1141.911) [-1137.646] (-1147.552) (-1143.279) * (-1141.377) (-1149.473) [-1146.271] (-1140.884) -- 0:00:14 930000 -- (-1148.750) (-1156.267) (-1148.511) [-1140.359] * (-1144.557) (-1146.124) (-1145.769) [-1146.554] -- 0:00:14 Average standard deviation of split frequencies: 0.004286 931000 -- [-1136.470] (-1151.607) (-1147.094) (-1140.433) * (-1144.136) (-1141.960) (-1147.796) [-1139.133] -- 0:00:14 932000 -- (-1144.931) (-1148.857) (-1150.897) [-1141.788] * (-1142.156) (-1155.013) (-1151.249) [-1141.409] -- 0:00:13 933000 -- (-1148.417) [-1137.376] (-1142.729) (-1139.517) * (-1150.966) (-1147.694) [-1143.580] (-1144.302) -- 0:00:13 934000 -- (-1143.996) [-1135.548] (-1141.860) (-1149.124) * (-1138.321) [-1140.731] (-1143.683) (-1150.755) -- 0:00:13 935000 -- (-1144.214) (-1135.450) (-1140.089) [-1142.893] * (-1146.609) (-1140.719) (-1141.282) [-1140.663] -- 0:00:13 Average standard deviation of split frequencies: 0.004223 936000 -- (-1150.135) (-1141.115) (-1147.632) [-1136.786] * [-1142.543] (-1145.275) (-1145.327) (-1145.985) -- 0:00:13 937000 -- (-1154.508) (-1141.204) [-1145.471] (-1138.727) * [-1142.591] (-1149.147) (-1140.057) (-1135.826) -- 0:00:12 938000 -- (-1145.911) [-1140.907] (-1138.735) (-1152.161) * [-1141.074] (-1141.317) (-1139.404) (-1141.326) -- 0:00:12 939000 -- (-1145.404) [-1139.966] (-1140.167) (-1145.224) * [-1138.108] (-1153.975) (-1140.054) (-1140.363) -- 0:00:12 940000 -- (-1147.106) [-1147.687] (-1149.899) (-1139.299) * (-1143.548) (-1149.216) [-1141.379] (-1141.512) -- 0:00:12 Average standard deviation of split frequencies: 0.004510 941000 -- (-1146.812) (-1154.191) [-1143.430] (-1150.420) * (-1136.333) (-1143.680) [-1136.259] (-1146.074) -- 0:00:12 942000 -- (-1146.351) (-1138.884) (-1144.704) [-1135.936] * (-1142.854) (-1146.159) [-1137.416] (-1141.914) -- 0:00:11 943000 -- [-1144.129] (-1139.801) (-1138.598) (-1150.236) * (-1141.618) (-1154.999) [-1146.349] (-1147.993) -- 0:00:11 944000 -- (-1148.039) (-1139.333) [-1141.218] (-1140.249) * (-1139.365) (-1147.632) (-1143.091) [-1149.436] -- 0:00:11 945000 -- (-1142.232) (-1139.827) [-1140.227] (-1146.155) * [-1135.870] (-1144.830) (-1139.045) (-1150.842) -- 0:00:11 Average standard deviation of split frequencies: 0.005328 946000 -- (-1142.167) [-1146.974] (-1146.333) (-1141.857) * (-1140.269) (-1138.692) (-1142.790) [-1142.814] -- 0:00:11 947000 -- (-1134.916) [-1134.698] (-1145.978) (-1156.231) * [-1142.684] (-1144.317) (-1145.086) (-1145.514) -- 0:00:10 948000 -- [-1145.579] (-1142.183) (-1134.671) (-1147.846) * (-1146.428) (-1149.759) [-1145.294] (-1143.007) -- 0:00:10 949000 -- (-1148.124) [-1137.547] (-1145.480) (-1147.679) * (-1152.941) [-1145.989] (-1145.416) (-1146.462) -- 0:00:10 950000 -- (-1145.206) (-1139.321) [-1143.074] (-1150.066) * (-1163.380) (-1144.179) [-1143.493] (-1147.034) -- 0:00:10 Average standard deviation of split frequencies: 0.005188 951000 -- (-1145.689) [-1144.780] (-1146.672) (-1150.019) * (-1145.733) (-1141.824) (-1147.830) [-1139.706] -- 0:00:09 952000 -- [-1146.460] (-1146.944) (-1145.009) (-1143.253) * (-1151.580) [-1140.719] (-1139.424) (-1144.377) -- 0:00:09 953000 -- [-1148.304] (-1142.763) (-1146.012) (-1144.043) * (-1145.221) [-1138.558] (-1138.977) (-1147.106) -- 0:00:09 954000 -- (-1143.719) [-1138.754] (-1147.931) (-1143.821) * (-1151.426) (-1153.400) (-1136.524) [-1135.961] -- 0:00:09 955000 -- (-1143.564) [-1139.894] (-1145.847) (-1140.402) * (-1138.288) (-1148.359) [-1146.188] (-1140.936) -- 0:00:09 Average standard deviation of split frequencies: 0.005386 956000 -- [-1145.268] (-1140.208) (-1149.220) (-1149.943) * [-1136.615] (-1148.966) (-1146.065) (-1150.833) -- 0:00:08 957000 -- [-1142.828] (-1139.094) (-1146.576) (-1154.166) * [-1140.097] (-1142.147) (-1142.326) (-1150.256) -- 0:00:08 958000 -- (-1160.034) (-1148.551) (-1147.373) [-1139.805] * (-1146.032) [-1138.638] (-1138.896) (-1141.798) -- 0:00:08 959000 -- (-1141.500) (-1143.611) (-1142.008) [-1147.492] * (-1138.296) [-1141.336] (-1140.578) (-1149.781) -- 0:00:08 960000 -- (-1144.342) [-1148.212] (-1144.775) (-1148.385) * (-1144.483) (-1145.849) (-1145.739) [-1143.093] -- 0:00:08 Average standard deviation of split frequencies: 0.005360 961000 -- (-1145.869) (-1153.170) [-1146.249] (-1140.812) * (-1146.542) (-1148.610) (-1140.827) [-1144.091] -- 0:00:07 962000 -- (-1143.621) (-1143.046) (-1145.348) [-1138.323] * [-1147.961] (-1143.405) (-1138.988) (-1142.961) -- 0:00:07 963000 -- (-1158.940) (-1148.665) [-1135.751] (-1140.453) * (-1145.001) (-1150.252) [-1150.467] (-1145.181) -- 0:00:07 964000 -- (-1148.092) (-1145.228) [-1137.989] (-1145.693) * (-1151.725) (-1146.788) (-1149.123) [-1137.706] -- 0:00:07 965000 -- (-1140.159) (-1146.402) (-1138.319) [-1150.821] * (-1150.729) [-1136.528] (-1137.845) (-1144.836) -- 0:00:07 Average standard deviation of split frequencies: 0.005218 966000 -- (-1145.463) (-1144.477) (-1150.294) [-1139.196] * (-1139.865) (-1138.631) (-1140.897) [-1146.275] -- 0:00:06 967000 -- (-1141.317) (-1146.691) (-1144.793) [-1143.204] * (-1149.580) (-1139.586) (-1139.370) [-1139.154] -- 0:00:06 968000 -- (-1143.101) (-1140.991) (-1143.570) [-1137.037] * (-1149.238) [-1143.996] (-1151.991) (-1140.938) -- 0:00:06 969000 -- [-1137.463] (-1143.407) (-1153.847) (-1152.161) * (-1152.139) (-1141.566) [-1144.066] (-1147.068) -- 0:00:06 970000 -- (-1149.460) [-1142.648] (-1150.692) (-1149.171) * (-1140.110) (-1145.896) (-1147.203) [-1142.272] -- 0:00:06 Average standard deviation of split frequencies: 0.005529 971000 -- [-1143.902] (-1140.891) (-1143.450) (-1142.266) * (-1145.090) (-1150.241) (-1143.664) [-1138.434] -- 0:00:05 972000 -- (-1141.430) (-1140.206) [-1139.632] (-1158.914) * (-1142.692) (-1143.407) [-1137.672] (-1140.647) -- 0:00:05 973000 -- (-1144.784) (-1149.259) [-1144.282] (-1153.587) * (-1138.632) (-1140.125) [-1138.526] (-1142.291) -- 0:00:05 974000 -- (-1146.436) (-1148.018) [-1139.242] (-1156.595) * (-1150.129) [-1142.611] (-1153.137) (-1148.920) -- 0:00:05 975000 -- (-1140.706) [-1138.244] (-1136.585) (-1142.994) * [-1138.290] (-1144.666) (-1144.833) (-1144.787) -- 0:00:05 Average standard deviation of split frequencies: 0.005499 976000 -- [-1139.653] (-1142.020) (-1140.038) (-1148.837) * [-1140.140] (-1141.756) (-1145.851) (-1140.732) -- 0:00:04 977000 -- [-1141.928] (-1140.229) (-1138.955) (-1151.887) * (-1149.512) [-1148.706] (-1147.134) (-1146.388) -- 0:00:04 978000 -- (-1142.401) (-1146.757) [-1143.346] (-1139.746) * (-1137.545) (-1139.267) (-1143.006) [-1135.480] -- 0:00:04 979000 -- (-1146.672) (-1144.038) [-1151.316] (-1136.549) * (-1137.723) (-1141.726) (-1139.901) [-1141.975] -- 0:00:04 980000 -- [-1136.398] (-1141.250) (-1143.781) (-1151.785) * (-1142.515) (-1142.403) [-1140.353] (-1141.522) -- 0:00:04 Average standard deviation of split frequencies: 0.005620 981000 -- [-1137.352] (-1147.226) (-1143.942) (-1146.611) * [-1139.067] (-1149.220) (-1139.149) (-1147.815) -- 0:00:03 982000 -- (-1154.024) (-1134.974) (-1146.933) [-1143.056] * (-1148.898) (-1150.185) [-1140.316] (-1150.137) -- 0:00:03 983000 -- (-1147.817) (-1142.831) [-1139.922] (-1145.675) * [-1154.707] (-1144.688) (-1146.191) (-1150.602) -- 0:00:03 984000 -- (-1151.199) (-1142.444) (-1147.599) [-1142.775] * (-1142.939) (-1141.836) [-1143.591] (-1150.040) -- 0:00:03 985000 -- (-1145.806) [-1145.597] (-1148.035) (-1142.532) * [-1148.232] (-1147.750) (-1143.801) (-1141.132) -- 0:00:03 Average standard deviation of split frequencies: 0.005664 986000 -- (-1149.954) [-1148.729] (-1141.059) (-1140.624) * (-1145.066) (-1140.680) [-1139.833] (-1138.480) -- 0:00:02 987000 -- [-1141.395] (-1152.355) (-1143.540) (-1140.803) * (-1158.173) (-1142.086) [-1145.749] (-1139.718) -- 0:00:02 988000 -- (-1139.585) (-1142.387) [-1138.428] (-1139.290) * (-1140.657) [-1140.491] (-1134.444) (-1142.723) -- 0:00:02 989000 -- (-1145.106) (-1149.711) (-1141.026) [-1142.387] * (-1145.754) [-1146.959] (-1134.628) (-1143.415) -- 0:00:02 990000 -- [-1143.142] (-1144.683) (-1142.107) (-1139.318) * (-1143.816) [-1146.420] (-1153.066) (-1139.494) -- 0:00:02 Average standard deviation of split frequencies: 0.005783 991000 -- [-1138.078] (-1150.197) (-1142.365) (-1141.489) * (-1147.323) [-1141.255] (-1150.807) (-1143.123) -- 0:00:01 992000 -- (-1141.130) (-1140.640) (-1139.986) [-1137.165] * (-1146.371) [-1142.266] (-1150.903) (-1142.617) -- 0:00:01 993000 -- (-1153.997) (-1150.613) (-1138.909) [-1146.369] * (-1142.411) (-1148.544) (-1142.582) [-1138.627] -- 0:00:01 994000 -- [-1139.569] (-1144.639) (-1141.744) (-1141.148) * (-1157.212) [-1139.908] (-1140.806) (-1140.203) -- 0:00:01 995000 -- (-1141.318) (-1140.723) [-1136.977] (-1139.724) * [-1136.827] (-1152.758) (-1142.541) (-1144.617) -- 0:00:01 Average standard deviation of split frequencies: 0.005789 996000 -- (-1144.640) [-1146.313] (-1147.730) (-1140.641) * [-1144.730] (-1138.943) (-1144.370) (-1136.181) -- 0:00:00 997000 -- (-1137.811) (-1146.698) [-1138.666] (-1140.221) * (-1146.861) (-1138.829) [-1136.640] (-1141.595) -- 0:00:00 998000 -- (-1142.999) [-1139.759] (-1153.095) (-1146.097) * [-1140.026] (-1138.422) (-1145.651) (-1151.648) -- 0:00:00 999000 -- [-1139.768] (-1138.404) (-1145.541) (-1142.602) * (-1135.738) (-1145.939) (-1152.389) [-1144.124] -- 0:00:00 1000000 -- (-1141.592) (-1142.740) (-1137.958) [-1138.338] * (-1142.083) (-1142.239) [-1147.944] (-1143.178) -- 0:00:00 Average standard deviation of split frequencies: 0.005472 Analysis completed in 3 mins 24 seconds Analysis used 203.95 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1131.13 Likelihood of best state for "cold" chain of run 2 was -1131.30 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 70.3 % ( 61 %) Dirichlet(Revmat{all}) 83.9 % ( 76 %) Slider(Revmat{all}) 28.0 % ( 24 %) Dirichlet(Pi{all}) 30.7 % ( 29 %) Slider(Pi{all}) 80.6 % ( 66 %) Multiplier(Alpha{1,2}) 74.5 % ( 56 %) Multiplier(Alpha{3}) 91.8 % ( 84 %) Slider(Pinvar{all}) 39.5 % ( 29 %) ExtSPR(Tau{all},V{all}) 30.7 % ( 31 %) ExtTBR(Tau{all},V{all}) 44.0 % ( 39 %) NNI(Tau{all},V{all}) 30.8 % ( 35 %) ParsSPR(Tau{all},V{all}) 27.5 % ( 30 %) Multiplier(V{all}) 66.0 % ( 59 %) Nodeslider(V{all}) 26.3 % ( 15 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 69.9 % ( 69 %) Dirichlet(Revmat{all}) 83.2 % ( 76 %) Slider(Revmat{all}) 28.3 % ( 23 %) Dirichlet(Pi{all}) 30.6 % ( 26 %) Slider(Pi{all}) 80.5 % ( 57 %) Multiplier(Alpha{1,2}) 73.5 % ( 53 %) Multiplier(Alpha{3}) 92.4 % ( 88 %) Slider(Pinvar{all}) 39.7 % ( 43 %) ExtSPR(Tau{all},V{all}) 30.4 % ( 27 %) ExtTBR(Tau{all},V{all}) 44.2 % ( 45 %) NNI(Tau{all},V{all}) 30.4 % ( 33 %) ParsSPR(Tau{all},V{all}) 27.4 % ( 24 %) Multiplier(V{all}) 66.1 % ( 70 %) Nodeslider(V{all}) 26.4 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.76 0.56 0.40 2 | 166849 0.78 0.59 3 | 166620 166372 0.79 4 | 166340 166804 167015 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.76 0.56 0.40 2 | 166925 0.78 0.59 3 | 166174 166998 0.79 4 | 166609 166563 166731 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/mrbayes_input.nex.run1.p and /data/mrbayes_input.nex.run2.p Writing summary statistics to file /data/mrbayes_input.nex.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1139.85 | 1 | | 2 1 1 2 | |1 2 1 1 2 2 22 | | 2 1 2 2 22 1 1 1 1 | | 2 1 2 111 12 1 2 | | 1 2 ** 2 2 2 12 1 11 2 1| | 2 1 1 2 2 2 11 * | |21 2 1 1 221 2 2 21 1 2 21 2 | | 2 1 2 2 2 1 2 11 2 1 11 2| | 1 2 2 1 1 2 2 2 2 21 1 | | 11 2 2 2 | | 21 1 1 2 2 1 1 | | 1 1 1 | | | | 1 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1143.56 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/mrbayes_input.nex.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1137.57 -1148.79 2 -1137.58 -1149.81 -------------------------------------- TOTAL -1137.57 -1149.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/mrbayes_input.nex.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.055752 0.000133 0.034925 0.078134 0.054568 1143.17 1257.78 1.000 r(A<->C){all} 0.134661 0.003567 0.030913 0.254384 0.127570 469.02 611.46 1.000 r(A<->G){all} 0.176013 0.004119 0.052163 0.293553 0.169420 470.02 561.53 1.001 r(A<->T){all} 0.059485 0.001406 0.000033 0.131165 0.053183 452.37 534.03 1.001 r(C<->G){all} 0.084981 0.002880 0.000173 0.191168 0.075875 491.64 509.57 1.000 r(C<->T){all} 0.344982 0.006469 0.199141 0.502817 0.338709 678.52 681.85 1.001 r(G<->T){all} 0.199877 0.004387 0.075444 0.327170 0.195841 495.83 614.45 1.001 pi(A){all} 0.251697 0.000276 0.219531 0.284867 0.251695 938.93 1164.32 1.000 pi(C){all} 0.225184 0.000243 0.195861 0.256535 0.224815 1150.03 1211.36 1.000 pi(G){all} 0.209728 0.000231 0.181366 0.240873 0.209306 961.35 1159.48 1.000 pi(T){all} 0.313391 0.000313 0.280244 0.347870 0.313146 1067.31 1136.26 1.000 alpha{1,2} 0.879031 0.888504 0.000174 2.826837 0.567818 983.33 1110.22 1.000 alpha{3} 1.396129 1.276684 0.002101 3.552859 1.091005 1302.26 1310.03 1.000 pinvar{all} 0.332767 0.046524 0.000028 0.714439 0.314464 634.58 660.52 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/mrbayes_input.nex.run1.t" and "/data/mrbayes_input.nex.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/mrbayes_input.nex.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/mrbayes_input.nex.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a parameter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 Key to taxon bipartitions (saved to file "/data/mrbayes_input.nex.parts"): ID -- Partition -------------- 1 -- .******* 2 -- .*...... 3 -- ..*..... 4 -- ...*.... 5 -- ....*... 6 -- .....*.. 7 -- ......*. 8 -- .......* 9 -- ..****** 10 -- .....**. 11 -- ..***..* 12 -- ...**... 13 -- ..*....* 14 -- ..*.*..* 15 -- ...*...* 16 -- ..*.*... 17 -- ..**...* 18 -- ....*..* 19 -- ..**.... 20 -- ...**..* 21 -- ..***... -------------- Summary statistics for informative taxon bipartitions (saved to file "/data/mrbayes_input.nex.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 9 3000 0.999334 0.000942 0.998668 1.000000 2 10 2836 0.944704 0.010364 0.937375 0.952032 2 11 2705 0.901066 0.006124 0.896736 0.905396 2 12 601 0.200200 0.003298 0.197868 0.202532 2 13 591 0.196869 0.007066 0.191872 0.201865 2 14 590 0.196536 0.004711 0.193205 0.199867 2 15 578 0.192538 0.004711 0.189207 0.195869 2 16 577 0.192205 0.004240 0.189207 0.195203 2 17 569 0.189540 0.011777 0.181213 0.197868 2 18 566 0.188541 0.002827 0.186542 0.190540 2 19 558 0.185876 0.006595 0.181213 0.190540 2 20 552 0.183877 0.001884 0.182545 0.185210 2 21 542 0.180546 0.006595 0.175883 0.185210 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/mrbayes_input.nex.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.005611 0.000008 0.001029 0.011488 0.005169 1.000 2 length{all}[2] 0.028002 0.000060 0.014713 0.043326 0.026852 1.000 2 length{all}[3] 0.001142 0.000001 0.000001 0.003456 0.000800 1.000 2 length{all}[4] 0.001162 0.000001 0.000000 0.003487 0.000815 1.000 2 length{all}[5] 0.001127 0.000001 0.000000 0.003372 0.000778 1.000 2 length{all}[6] 0.001137 0.000001 0.000001 0.003477 0.000775 1.000 2 length{all}[7] 0.001109 0.000001 0.000000 0.003322 0.000793 1.001 2 length{all}[8] 0.001112 0.000001 0.000000 0.003391 0.000758 1.000 2 length{all}[9] 0.008590 0.000013 0.002529 0.015786 0.008124 1.000 2 length{all}[10] 0.002357 0.000003 0.000063 0.005795 0.001964 1.000 2 length{all}[11] 0.002313 0.000003 0.000003 0.005656 0.001895 1.001 2 length{all}[12] 0.001136 0.000001 0.000001 0.003414 0.000787 0.998 2 length{all}[13] 0.001207 0.000001 0.000001 0.003640 0.000894 1.000 2 length{all}[14] 0.001053 0.000001 0.000001 0.003209 0.000702 1.000 2 length{all}[15] 0.001134 0.000001 0.000002 0.003392 0.000748 0.998 2 length{all}[16] 0.001072 0.000001 0.000001 0.003312 0.000784 1.000 2 length{all}[17] 0.001227 0.000002 0.000004 0.003596 0.000837 0.999 2 length{all}[18] 0.001119 0.000001 0.000001 0.003506 0.000814 0.998 2 length{all}[19] 0.001171 0.000001 0.000004 0.003496 0.000824 1.000 2 length{all}[20] 0.001117 0.000001 0.000002 0.003204 0.000766 1.000 2 length{all}[21] 0.001147 0.000001 0.000003 0.003484 0.000833 0.999 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.005472 Maximum standard deviation of split frequencies = 0.011777 Average PSRF for parameter values (excluding NA and >10.0) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | | /------------------------ C3 (3) + | | |------------------------ C4 (4) | /-----------90----------+ | | |------------------------ C5 (5) | | | \----------100----------+ \------------------------ C8 (8) | | /------------------------ C6 (6) \-----------94----------+ \------------------------ C7 (7) Phylogram (based on average branch lengths): /-------------- C1 (1) | |------------------------------------------------------------------------ C2 (2) | | /-- C3 (3) + | | |-- C4 (4) | /----+ | | |-- C5 (5) | | | \---------------------+ \-- C8 (8) | | /-- C6 (6) \----+ \-- C7 (7) |------------| 0.005 expected changes per site Calculating tree probabilities... Credible sets of trees (135 trees sampled): 50 % credible set contains 9 trees 90 % credible set contains 39 trees 95 % credible set contains 72 trees 99 % credible set contains 113 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' Running FUBAR... [2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,((C3,C4,C5,C8),(C6,C7)))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **8** sequences, **229** codons, and **1** partitions from `/data//pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1140.51, AIC-c = 2319.16 (19 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.050 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 1.227 * non-synonymous rate = 0.643 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 13 | 1 | 4.436 | 33.520 | Pos. posterior = 0.9256 | ---- ## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.07 are expected to be false positives (95% confidence interval of 0-1 )
CLUSTAL FORMAT for T-COFFEE Version_12.00.7fb08c2 [http://www.tcoffee.org] [MODE: ], CPU=0.07 sec, SCORE=1000, Nseq=8, Len=229 175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL 183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL .*.*** * *::********************************** 175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV 183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV *************************************:************ 175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG 183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG ************************************************** 175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 TLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAF 183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF ********:***************.************************* 175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 YVRSKNGDYSAVTSSADSLTEDEKLLHLV 183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 YVRSKNGDYSAVTSSADSLTEDEKLLHLV SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVRSKNGDYSAVTSSADSLTEDEKLLHLV LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVRSKNGDYSAVTSSADSLTEDEKLLHLV TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVRSKNGDYSAVTSSADSLTEDEKLLHLV TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVRSKNGDYSAVTSSADSLTEDEKLLHLV TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVRSKNGDYSAVTSSADSLTEDEKLLHLV TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 YVRSKNGDYSAVTSSADSLTEDEKLLHLV *****************************
>175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTTCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGTTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGGCTTGCATTACGCTTGTGCTGTGGATAATGTACTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATTACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGATTGCTACTGGTGTGCAGGTAAACCAATTACCTACGTACATCACTGTTGTTAAGCCTAGCACCACAATTGTGTATCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAACACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ATGTCAAACGGTGACAATTCAACGATACCCACAGATGTGGTTATCCAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTTCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGGCTTGCATTACGCTTGTGCTGTGGATAATGTACTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATTACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAACCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTATCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAACACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGTCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGTCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGTCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGGCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGTACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGGCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGTACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC >TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---------ATGTCTAATGAGACAATTCCTCTCGACCAGGTGGTCGAACATCTAAGAAATTGGAATTTCAGTTGGAATGTAATTCTTACAATATTTCTAGTTGTCCTGCAATATGGACACTACAAATATAGTGCTGTGCTTTACATCCTGAAAATGACAATTCTGTGGCTGCTGTGGCCTCTTGTACTTGCCCTGTCAATTTTTGACAGTTGGTCAAGTTTTGGCAACAACTGGACCATGTTTGCTTTTAGCATCTTAATGTCTTGCATTACGCTTGTGCTGTGGATAATGTATTTTGTCAACAGTTTCAGGCTGTACCGCAGAACCAACACTTTCTGGGCCTTTAACCCGGAAACTGATGCCATTATCACACTGTCCGTCTTTGGTCGCCAAGTTTCAATTCCAGCCCTTGTGGCTCCAACTGGCATCACGCTCACTGTGTTAAGTGGTACACTCCTAGTGGAAGGCATTAAGGTTGCTACTGGTGTGCAGGTAAATCAATTACCTACGTACATCACTGTTGCCAAGCCTAGCACCACAATTGTGTACCAACGTGCTGGACGTTCGCTCAACACGCGCTCAAATACAGGTTGGGCGTTTTATGTCAGATCGAAAAATGGCGACTACTCTGCTGTAACGAGTTCTGCTGATTCGCTTACAGAAGACGAGAAACTTTTACATTTAGTC
>175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLLVEGIKIATGVQVNQLPTYITVVKPSTTIVYQRAGRSLNTRSNTGWAF YVRSKNGDYSAVTSSADSLTEDEKLLHLV >183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 MSNGDNSTIPTDVVIQHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF YVRSKNGDYSAVTSSADSLTEDEKLLHLV >SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF YVRSKNGDYSAVTSSADSLTEDEKLLHLV >LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF YVRSKNGDYSAVTSSADSLTEDEKLLHLV >TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF YVRSKNGDYSAVTSSADSLTEDEKLLHLV >TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF YVRSKNGDYSAVTSSADSLTEDEKLLHLV >TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMACITLVLWIMYFV NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF YVRSKNGDYSAVTSSADSLTEDEKLLHLV >TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ---MSNETIPLDQVVEHLRNWNFSWNVILTIFLVVLQYGHYKYSAVLYIL KMTILWLLWPLVLALSIFDSWSSFGNNWTMFAFSILMSCITLVLWIMYFV NSFRLYRRTNTFWAFNPETDAIITLSVFGRQVSIPALVAPTGITLTVLSG TLLVEGIKVATGVQVNQLPTYITVAKPSTTIVYQRAGRSLNTRSNTGWAF YVRSKNGDYSAVTSSADSLTEDEKLLHLV
Reading sequence file /data//pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/fasta/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1 Found 8 sequences of length 687 Alignment looks like a valid DNA alignment. Estimated diversity is (pairwise deletion - ignoring missing/ambig): 1.4% Found 8 informative sites. Writing alignment of informative sites to: Phi.inf.sites Writing list of informative sites to: Phi.inf.list Calculating all pairwise incompatibilities... Done: 0.0%100.0% Using a window size of 80 with k as 1 Calculating analytical mean and variance Doing permutation test for PHI Doing permutation test for NSS Doing Permutation test for MAXCHI Writing alignment of polymorphic unambig sites to: Phi.poly.sites Window size is 22 polymorphic sites **p-Value(s)** ---------- NSS: 1.00e+00 (1000 permutations) Max Chi^2: 0.00e+00 (1000 permutations) PHI (Permutation): 1.00e+00 (1000 permutations) PHI (Normal): 1.00e+00
#NEXUS [ID: 5401703558] begin taxa; dimensions ntax=8; taxlabels 175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10 183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10 SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10 TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ; end; begin trees; translate 1 175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10, 2 183A_M_AFU92107_1_2005_10_China_Bat_Bat_coronavirus_HKU10, 3 SL12A_M_AFU92081_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10, 4 LSH5A_M_AFU92098_1_2005_12_Hong_Kong_Bat_Bat_coronavirus_HKU10, 5 TLC1310A_M_AFU92089_1_2006_10_Hong_Kong_Bat_Bat_coronavirus_HKU10, 6 TLC1343A_M_AFU92125_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10, 7 TLC1347A_M_AFU92134_1_2010_08_Hong_Kong_Bat_Bat_coronavirus_HKU10, 8 TT3A_M_AFU92073_1_2006_12_Hong_Kong_Bat_Bat_coronavirus_HKU10 ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:5.169159e-03,2:2.685190e-02,((3:7.995302e-04,4:8.146082e-04,5:7.782939e-04,8:7.581198e-04)0.901:1.895405e-03,(6:7.746902e-04,7:7.930853e-04)0.945:1.964482e-03)0.999:8.124156e-03); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:5.169159e-03,2:2.685190e-02,((3:7.995302e-04,4:8.146082e-04,5:7.782939e-04,8:7.581198e-04):1.895405e-03,(6:7.746902e-04,7:7.930853e-04):1.964482e-03):8.124156e-03); end;
Estimated marginal likelihoods for runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/mrbayes_input.nex.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1137.57 -1148.79 2 -1137.58 -1149.81 -------------------------------------- TOTAL -1137.57 -1149.42 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/mrbayes_input.nex.run1.p" and "/data/mrbayes_input.nex.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/mrbayes_input.nex.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.055752 0.000133 0.034925 0.078134 0.054568 1143.17 1257.78 1.000 r(A<->C){all} 0.134661 0.003567 0.030913 0.254384 0.127570 469.02 611.46 1.000 r(A<->G){all} 0.176013 0.004119 0.052163 0.293553 0.169420 470.02 561.53 1.001 r(A<->T){all} 0.059485 0.001406 0.000033 0.131165 0.053183 452.37 534.03 1.001 r(C<->G){all} 0.084981 0.002880 0.000173 0.191168 0.075875 491.64 509.57 1.000 r(C<->T){all} 0.344982 0.006469 0.199141 0.502817 0.338709 678.52 681.85 1.001 r(G<->T){all} 0.199877 0.004387 0.075444 0.327170 0.195841 495.83 614.45 1.001 pi(A){all} 0.251697 0.000276 0.219531 0.284867 0.251695 938.93 1164.32 1.000 pi(C){all} 0.225184 0.000243 0.195861 0.256535 0.224815 1150.03 1211.36 1.000 pi(G){all} 0.209728 0.000231 0.181366 0.240873 0.209306 961.35 1159.48 1.000 pi(T){all} 0.313391 0.000313 0.280244 0.347870 0.313146 1067.31 1136.26 1.000 alpha{1,2} 0.879031 0.888504 0.000174 2.826837 0.567818 983.33 1110.22 1.000 alpha{3} 1.396129 1.276684 0.002101 3.552859 1.091005 1302.26 1310.03 1.000 pinvar{all} 0.332767 0.046524 0.000028 0.714439 0.314464 634.58 660.52 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge.
[2J[H /HYPHY 2.3.14.20190214beta(MP) for Linux on x86_64\ ***************** TYPES OF STANDARD ANALYSES ***************** (1) Selection Analyses (2) Evolutionary Hypothesis Testing (3) Relative evolutionary rate inference (4) Coevolutionary analysis (5) Basic Analyses (6) Codon Selection Analyses (7) Compartmentalization (8) Data File Tools (9) Miscellaneous (10) Model Comparison (11) Kernel Analysis Tools (12) Molecular Clock (13) Phylogeny Reconstruction (14) Positive Selection (15) Recombination (16) Selection/Recombination (17) Relative Rate (18) Relative Ratio (19) Substitution Rates Please select type of analyses you want to list (or press ENTER to process custom batch file):[2J[H***************** FILES IN 'Selection Analyses' ***************** (1) [MEME] Test for episodic site-level selection using MEME (Mixed Effects Model of Evolution). (2) [FEL] Test for pervasive site-level selection using FEL (Fixed Effects Likelihood). (3) [SLAC] Test for pervasive site-level selection using SLAC (Single Likelihood Ancestor Counting). (4) [FUBAR] Test for pervasive site-level selection using FUBAR (Fast Unconstrained Bayesian AppRoximation for inferring selection). (5) [BUSTED] Test for episodic gene-wide selection using BUSTED (Branch-site Unrestricted Statistical Test of Episodic Diversification). (6) [aBSREL] Test for lineage-specific evolution using the branch-site method aBS-REL (Adaptive Branch-Site Random Effects Likelihood). (7) [RELAX] Test for relaxation of selection pressure along a specified set of test branches using RELAX (a random effects test of selection relaxation). Please select the analysis you would like to perform (or press ENTER to return to the list of analysis types): Analysis Description -------------------- Perform a Fast Unbiased AppRoximate Bayesian (FUBAR) analysis of a coding sequence alignment to determine whether some sites have been subject to pervasive purifying or diversifying selection. v2.1 introduces two more methods for estimating the posterior distribution of grid weights: collapsed Gibbs MCMC (faster) and 0-th order Variation Bayes approximation (fastest). Please note that a FUBAR analysis generates a cache and a results JSON file in the same directory as directory as the original alignment. HyPhy needs to have write privileges to this directory. For example if the original file is in /home/sergei/FUBAR/data/pol.nex then at the end of a FUBAR run, there will also exist FUBAR-generated files /home/sergei/FUBAR/data/pol.nex.FUBAR.json, /home/sergei/FUBAR/data/pol.nex.fubrar.cache. They also provide checkpointing so that a partially completed analysis can be restarted. - __Requirements__: in-frame codon alignment (possibly partitioned) and a phylogenetic tree (one per partition) - __Citation__: FUBAR: a fast, unconstrained bayesian approximation for inferring selection (2013), Mol Biol Evol. 30(5):1196-205 - __Written by__: Sergei L Kosakovsky Pond - __Contact Information__: spond@temple.edu - __Analysis Version__: 2.1 ####Choose Genetic Code 1. [**Universal**] Universal code. (Genebank transl_table=1). 2. [**Vertebrate mtDNA**] Vertebrate mitochondrial DNA code. (Genebank transl_table=2). 3. [**Yeast mtDNA**] Yeast mitochondrial DNA code. (Genebank transl_table=3). 4. [**Mold/Protozoan mtDNA**] Mold, Protozoan and Coelenterate mitochondrial DNA and the Mycloplasma/Spiroplasma code. (Genebank transl_table=4). 5. [**Invertebrate mtDNA**] Invertebrate mitochondrial DNA code. (Genebank transl_table=5). 6. [**Ciliate Nuclear**] Ciliate, Dasycladacean and Hexamita Nuclear code. (Genebank transl_table=6). 7. [**Echinoderm mtDNA**] Echinoderm mitochondrial DNA code. (Genebank transl_table=9). 8. [**Euplotid Nuclear**] Euplotid Nuclear code. (Genebank transl_table=10). 9. [**Alt. Yeast Nuclear**] Alternative Yeast Nuclear code. (Genebank transl_table=12). 10. [**Ascidian mtDNA**] Ascidian mitochondrial DNA code. (Genebank transl_table=13). 11. [**Flatworm mtDNA**] Flatworm mitochondrial DNA code. (Genebank transl_table=14). 12. [**Blepharisma Nuclear**] Blepharisma Nuclear code. (Genebank transl_table=15). 13. [**Chlorophycean mtDNA**] Chlorophycean Mitochondrial Code (transl_table=16). 14. [**Trematode mtDNA**] Trematode Mitochondrial Code (transl_table=21). 15. [**Scenedesmus obliquus mtDNA**] Scenedesmus obliquus mitochondrial Code (transl_table=22). 16. [**Thraustochytrium mtDNA**] Thraustochytrium Mitochondrial Code (transl_table=23). 17. [**Pterobranchia mtDNA**] Pterobranchia Mitochondrial Code (transl_table=24). 18. [**SR1 and Gracilibacteria**] Candidate Division SR1 and Gracilibacteria Code (transl_table=25). 19. [**Pachysolen Nuclear**] Pachysolen tannophilus Nuclear Code (transl_table=26). >Please choose an option (or press q to cancel selection): >Select a coding sequence alignment file (`/usr/local/lib/hyphy/TemplateBatchFiles/SelectionAnalyses/`) >A tree was found in the data file: `(C1,C2,((C3,C4,C5,C8),(C6,C7)))` >Would you like to use it (y/n)? >Loaded a multiple sequence alignment with **8** sequences, **229** codons, and **1** partitions from `/data//pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna` > FUBAR will write cache and result files to _/data//pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.cache_ and _/data//pss_subsets/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result/original_alignment/fubar/results/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1/175A_M_AFU92116_1_2005_10_China_Bat_Bat_coronavirus_HKU10.result.1.fna.FUBAR.json_, respectively > Number of grid points per dimension (total number is D^2) (permissible range = [5,50], default value = 20, integer): ####Posterior estimation method 1. [**Metropolis-Hastings**] Full Metropolis-Hastings MCMC algorithm (slowest, original 2013 paper implementation) 2. [**Collapsed Gibbs**] Collapsed Gibbs sampler (intermediate speed) 3. [**Variational Bayes**] 0-th order Variational Bayes approximations (fastest, recommended default) >Please choose an option (or press q to cancel selection):> The concentration parameter of the Dirichlet prior (permissible range = [0.001,1], default value = 0.5): ### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model * Log(L) = -1140.51, AIC-c = 2319.16 (19 estimated parameters) * Tree length (expected substitutions/site) for partition 1 : 0.050 ### Computing the phylogenetic likelihood function on the grid * Determining appropriate tree scaling based on the best score from a 20 x 20 rate grid * Best scaling achieved for * synonymous rate = 1.227 * non-synonymous rate = 0.643 * Computing conditional site likelihoods on a 20 x 20 rate grid ### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights * Using the following settings * Dirichlet alpha : 0.5 ### Tabulating site-level results | Codon | Partition | alpha | beta |Posterior prob for positive selection| |:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:| | 13 | 1 | 4.436 | 33.520 | Pos. posterior = 0.9256 | ---- ## FUBAR inferred 1 sites subject to diversifying positive selection at posterior probability >= 0.9 Of these, 0.07 are expected to be false positives (95% confidence interval of 0-1 )
Not all of the following information may be relevant for the case being handled, since this project may be part of a much larger auto-PSS-genome project where several methods of detection of positively selected sites have been used. As such the aligned.score_ascii file may have more sequences than the file effectively used to detect positively selected codons, since the content of this file reflects the content of the file used for the master alignment, from which a subsample may have been taken # ### General parameters ### # # The maximum number of sequences to use for the master file sequence_limit=90 # The random seed random_seed=3976763 # ### Alignment ### # # The alignment method: clustalw, muscle, kalign, t_coffee, or amap align_method=muscle # Minimum support value for amino acid positions in the alignment tcoffee_min_score=3 # ### MrBayes ### # # Number of iterations in MrBayes mrbayes_generations=1000000 # MrBayes burnin mrbayes_burnin=2500 # ### FUBAR ### # # The maximum number of sequences to be used by FUBAR. fubar_sequence_limit=90 # The number of FUBAR runs fubar_runs=1 # ### codeML ### # # The maximum number of sequences to be used by CodeML codeml_sequence_limit=30 # The number of CodeML runs codeml_runs=1 # The CodeML models to be run, one or more of: '1', '2', '7', and/or '8'. codeml_models=1 2 7 8 # ### OmegaMap ### # # The maximum number of sequences to use in OmegaMap omegamap_sequence_limit=90 # The number of OmegaMap runs omegamap_runs=1 # The number of OmegaMap iterations omegamap_iterations=2500