--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:55:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1155/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -927.26 -930.72
2 -927.31 -930.61
--------------------------------------
TOTAL -927.29 -930.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888053 0.088642 0.395427 1.529950 0.855536 1501.00 1501.00 1.000
r(A<->C){all} 0.162191 0.019916 0.000052 0.454711 0.120472 219.61 225.79 1.000
r(A<->G){all} 0.178428 0.022504 0.000001 0.488178 0.136048 174.59 187.27 1.000
r(A<->T){all} 0.169518 0.019799 0.000036 0.459523 0.133929 225.35 243.03 1.000
r(C<->G){all} 0.158708 0.018465 0.000310 0.430882 0.121381 188.00 210.43 1.002
r(C<->T){all} 0.165958 0.020156 0.000042 0.451072 0.129132 235.98 313.24 1.000
r(G<->T){all} 0.165198 0.018318 0.000017 0.431842 0.133142 205.35 221.10 1.001
pi(A){all} 0.197044 0.000229 0.168918 0.226847 0.196383 1279.24 1287.91 1.000
pi(C){all} 0.273556 0.000284 0.241833 0.307494 0.272992 1350.35 1391.98 1.000
pi(G){all} 0.322841 0.000313 0.288487 0.357458 0.322225 1251.85 1273.86 1.000
pi(T){all} 0.206558 0.000241 0.177002 0.238004 0.206558 808.80 1031.07 1.001
alpha{1,2} 0.429191 0.228381 0.000261 1.436906 0.260787 1304.64 1327.06 1.000
alpha{3} 0.442424 0.217974 0.000120 1.357014 0.284774 959.23 1147.80 1.001
pinvar{all} 0.997715 0.000008 0.992518 1.000000 0.998596 1305.65 1351.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -867.301119
Model 2: PositiveSelection -867.301119
Model 0: one-ratio -867.301536
Model 7: beta -867.301119
Model 8: beta&w>1 -867.301119
Model 0 vs 1 8.340000001680892E-4
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWM
SPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVK
DGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAV
EIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDR
GIRCVTLDYDKMRGMDSDEYRLFooo
>C2
VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPP
CWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVKDGV
EAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAVEIK
RRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDRGIR
CVTLDYDKMRGMDSDEYRLFoooooo
>C3
VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWM
SPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVK
DGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAV
EIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDR
GIRCVTLDYDKMRGMDSDEYRLFooo
>C4
VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWM
SPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVK
DGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAV
EIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDR
GIRCVTLDYDKMRGMDSDEYRLFooo
>C5
VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
TDRGIRCVTLDYDKMRGMDSDEYRLF
>C6
VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
TDRGIRCVTLDYDKMRGMDSDEYRLF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232
C1 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
C2 ------VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
C3 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
C4 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
C5 VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
C6 VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
********************************************
C1 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
C2 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
C3 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
C4 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
C5 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
C6 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
**************************************************
C1 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
C2 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
C3 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
C4 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
C5 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
C6 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
**************************************************
C1 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
C2 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
C3 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
C4 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
C5 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
C6 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
**************************************************
C1 TDRGIRCVTLDYDKMRGMDSDEYRLFooo---
C2 TDRGIRCVTLDYDKMRGMDSDEYRLFoooooo
C3 TDRGIRCVTLDYDKMRGMDSDEYRLFooo---
C4 TDRGIRCVTLDYDKMRGMDSDEYRLFooo---
C5 TDRGIRCVTLDYDKMRGMDSDEYRLF------
C6 TDRGIRCVTLDYDKMRGMDSDEYRLF------
**************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 226 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 226 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6974]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6974]--->[6882]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.488 Mb, Max= 30.778 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPP
C2 VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPP
C3 VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPP
C4 VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPP
C5 VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPP
C6 VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPP
**************************************************
C1 CWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVKDGV
C2 CWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVKDGV
C3 CWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVKDGV
C4 CWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVKDGV
C5 CWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVKDGV
C6 CWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPGLVKDGV
**************************************************
C1 EAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAVEIK
C2 EAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAVEIK
C3 EAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAVEIK
C4 EAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAVEIK
C5 EAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAVEIK
C6 EAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGSVAVEIK
**************************************************
C1 RRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDRGIR
C2 RRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDRGIR
C3 RRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDRGIR
C4 RRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDRGIR
C5 RRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDRGIR
C6 RRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLATDRGIR
**************************************************
C1 CVTLDYDKMRGMDSDEYRLF
C2 CVTLDYDKMRGMDSDEYRLF
C3 CVTLDYDKMRGMDSDEYRLF
C4 CVTLDYDKMRGMDSDEYRLF
C5 CVTLDYDKMRGMDSDEYRLF
C6 CVTLDYDKMRGMDSDEYRLF
********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:98 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
C2 ------------------GTGATTGCCCAGTGCACCGTAGACTACCTTGG
C3 ---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
C4 ---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
C5 GTGAGTTGGGTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
C6 GTGAGTTGGGTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
********************************
C1 CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
C2 CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
C3 CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
C4 CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
C5 CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
C6 CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
**************************************************
C1 CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
C2 CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
C3 CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
C4 CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
C5 CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
C6 CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
**************************************************
C1 AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
C2 AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
C3 AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
C4 AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
C5 AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
C6 AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
**************************************************
C1 GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
C2 GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
C3 GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
C4 GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
C5 GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
C6 GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
**************************************************
C1 TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
C2 TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
C3 TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
C4 TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
C5 TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
C6 TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
**************************************************
C1 CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
C2 CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
C3 CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
C4 CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
C5 CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
C6 CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
**************************************************
C1 AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
C2 AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
C3 AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
C4 AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
C5 AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
C6 AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
**************************************************
C1 CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
C2 CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
C3 CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
C4 CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
C5 CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
C6 CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
**************************************************
C1 GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
C2 GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
C3 GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
C4 GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
C5 GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
C6 GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
**************************************************
C1 CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
C2 CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
C3 CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
C4 CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
C5 CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
C6 CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
**************************************************
C1 GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
C2 GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
C3 GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
C4 GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
C5 GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
C6 GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
**************************************************
C1 ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
C2 ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
C3 ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
C4 ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
C5 ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
C6 ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
**************************************************
C1 CATGGACAGCGATGAGTACCGGTTGTTC------------------
C2 CATGGACAGCGATGAGTACCGGTTGTTC------------------
C3 CATGGACAGCGATGAGTACCGGTTGTTC------------------
C4 CATGGACAGCGATGAGTACCGGTTGTTC------------------
C5 CATGGACAGCGATGAGTACCGGTTGTTC------------------
C6 CATGGACAGCGATGAGTACCGGTTGTTC------------------
****************************
>C1
---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
CATGGACAGCGATGAGTACCGGTTGTTC------------------
>C2
------------------GTGATTGCCCAGTGCACCGTAGACTACCTTGG
CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
CATGGACAGCGATGAGTACCGGTTGTTC------------------
>C3
---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
CATGGACAGCGATGAGTACCGGTTGTTC------------------
>C4
---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
CATGGACAGCGATGAGTACCGGTTGTTC------------------
>C5
GTGAGTTGGGTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
CATGGACAGCGATGAGTACCGGTTGTTC------------------
>C6
GTGAGTTGGGTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG
CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG
CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG
AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC
GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG
TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG
CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA
AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA
CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG
GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT
CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA
GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC
ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG
CATGGACAGCGATGAGTACCGGTTGTTC------------------
>C1
oooVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
TDRGIRCVTLDYDKMRGMDSDEYRLF
>C2
ooooooVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
TDRGIRCVTLDYDKMRGMDSDEYRLF
>C3
oooVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
TDRGIRCVTLDYDKMRGMDSDEYRLF
>C4
oooVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
TDRGIRCVTLDYDKMRGMDSDEYRLF
>C5
VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
TDRGIRCVTLDYDKMRGMDSDEYRLF
>C6
VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
TDRGIRCVTLDYDKMRGMDSDEYRLF
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 696 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579856009
Setting output file names to "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 405115924
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5079426262
Seed = 522151097
Swapseed = 1579856009
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 10 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 10 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1512.145814 -- -24.965149
Chain 2 -- -1512.858350 -- -24.965149
Chain 3 -- -1511.390232 -- -24.965149
Chain 4 -- -1510.591673 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1511.389054 -- -24.965149
Chain 2 -- -1512.858349 -- -24.965149
Chain 3 -- -1512.145619 -- -24.965149
Chain 4 -- -1511.389052 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1512.146] (-1512.858) (-1511.390) (-1510.592) * [-1511.389] (-1512.858) (-1512.146) (-1511.389)
500 -- (-947.974) [-934.951] (-937.281) (-949.551) * (-941.252) (-938.002) (-939.474) [-933.949] -- 0:00:00
1000 -- (-934.074) (-937.348) [-935.537] (-957.997) * (-934.745) (-938.630) (-943.869) [-939.183] -- 0:00:00
1500 -- (-943.495) (-939.664) [-935.165] (-932.901) * (-935.153) (-941.869) (-942.924) [-940.780] -- 0:00:00
2000 -- [-929.516] (-932.360) (-937.384) (-935.994) * [-939.550] (-939.978) (-949.786) (-937.174) -- 0:00:00
2500 -- (-932.145) (-938.510) [-935.468] (-942.780) * (-936.940) (-945.821) [-934.476] (-935.327) -- 0:00:00
3000 -- (-934.177) [-932.513] (-935.464) (-931.551) * (-932.110) (-936.788) (-935.399) [-937.528] -- 0:00:00
3500 -- [-937.262] (-938.653) (-943.710) (-936.798) * (-943.254) (-939.334) (-936.002) [-931.842] -- 0:00:00
4000 -- (-934.991) (-937.348) (-933.598) [-931.156] * (-937.295) (-944.282) (-936.251) [-930.119] -- 0:00:00
4500 -- [-932.462] (-942.155) (-931.583) (-937.012) * (-943.274) [-936.349] (-935.258) (-931.883) -- 0:00:00
5000 -- (-933.179) (-949.299) (-929.366) [-939.457] * (-936.876) (-934.508) (-938.766) [-932.905] -- 0:00:00
Average standard deviation of split frequencies: 0.078567
5500 -- (-934.203) [-929.502] (-928.086) (-940.973) * (-936.202) [-933.076] (-940.955) (-934.969) -- 0:00:00
6000 -- (-940.952) (-937.531) (-932.531) [-933.349] * (-939.321) (-944.825) (-941.335) [-938.558] -- 0:00:00
6500 -- (-937.892) [-941.625] (-927.943) (-941.902) * (-942.954) (-944.098) [-932.362] (-934.585) -- 0:00:00
7000 -- (-937.803) (-934.620) [-928.774] (-941.423) * (-936.550) (-943.880) [-936.208] (-939.177) -- 0:00:00
7500 -- [-933.591] (-938.384) (-930.081) (-948.107) * [-940.483] (-937.080) (-935.419) (-936.294) -- 0:00:00
8000 -- (-931.879) (-932.805) [-929.953] (-937.257) * [-935.129] (-938.499) (-938.998) (-934.442) -- 0:00:00
8500 -- (-935.897) [-941.584] (-928.255) (-938.415) * (-943.599) (-939.083) [-929.091] (-934.235) -- 0:00:00
9000 -- [-931.709] (-949.847) (-932.238) (-933.236) * (-942.045) [-935.097] (-937.524) (-941.105) -- 0:01:50
9500 -- (-941.103) (-946.731) [-930.628] (-935.876) * (-935.618) (-938.359) [-939.818] (-931.747) -- 0:01:44
10000 -- [-933.950] (-934.784) (-928.799) (-939.414) * (-938.672) (-946.472) (-935.879) [-938.321] -- 0:01:39
Average standard deviation of split frequencies: 0.078567
10500 -- (-934.752) (-941.740) (-931.408) [-933.019] * (-939.071) (-947.045) (-939.715) [-934.806] -- 0:01:34
11000 -- (-937.839) (-933.416) [-928.565] (-937.184) * (-939.896) (-938.554) (-939.226) [-943.264] -- 0:01:29
11500 -- (-942.001) [-938.212] (-928.853) (-935.435) * (-934.512) (-935.893) [-939.309] (-942.122) -- 0:01:25
12000 -- (-937.175) [-936.008] (-928.770) (-934.010) * [-934.253] (-931.129) (-942.627) (-941.973) -- 0:01:22
12500 -- (-934.399) (-934.392) (-934.220) [-934.573] * (-932.507) (-937.994) (-945.058) [-933.514] -- 0:01:19
13000 -- (-937.410) (-938.054) [-931.512] (-941.044) * [-939.849] (-938.519) (-936.022) (-934.629) -- 0:01:15
13500 -- (-933.732) (-947.971) (-929.525) [-935.369] * (-935.973) (-937.294) (-947.095) [-933.796] -- 0:01:13
14000 -- (-941.550) (-945.776) (-933.612) [-932.256] * [-935.493] (-935.913) (-948.212) (-936.132) -- 0:01:10
14500 -- (-933.793) [-935.332] (-928.170) (-936.341) * (-935.870) [-937.161] (-932.305) (-937.407) -- 0:01:07
15000 -- (-933.387) (-939.662) (-929.833) [-937.349] * [-939.602] (-948.103) (-934.483) (-937.206) -- 0:01:05
Average standard deviation of split frequencies: 0.057375
15500 -- (-938.666) [-932.693] (-925.765) (-947.100) * [-934.981] (-940.793) (-939.629) (-939.871) -- 0:01:03
16000 -- (-935.077) (-943.600) [-926.285] (-943.885) * (-939.580) (-939.455) (-939.453) [-936.453] -- 0:01:01
16500 -- (-938.757) [-938.306] (-926.629) (-935.938) * (-937.527) [-937.379] (-938.294) (-936.665) -- 0:00:59
17000 -- (-939.313) [-942.888] (-932.572) (-944.698) * (-933.263) (-938.679) [-938.518] (-935.085) -- 0:00:57
17500 -- (-941.747) [-937.116] (-927.647) (-934.023) * [-936.403] (-937.874) (-943.857) (-944.797) -- 0:00:56
18000 -- [-927.042] (-935.669) (-926.116) (-937.849) * [-933.017] (-931.980) (-940.673) (-933.220) -- 0:00:54
18500 -- (-926.617) (-939.814) (-928.215) [-941.209] * (-934.324) (-936.934) [-931.057] (-936.388) -- 0:00:53
19000 -- [-927.073] (-934.920) (-926.812) (-932.506) * [-938.306] (-932.020) (-939.066) (-941.283) -- 0:01:43
19500 -- (-928.408) (-942.348) [-926.691] (-935.196) * [-935.186] (-937.077) (-942.730) (-936.398) -- 0:01:40
20000 -- [-928.772] (-940.111) (-926.360) (-937.930) * (-933.254) [-935.735] (-945.084) (-940.817) -- 0:01:38
Average standard deviation of split frequencies: 0.045620
20500 -- (-927.303) (-936.309) [-926.450] (-939.022) * (-928.560) (-936.662) [-934.970] (-941.656) -- 0:01:35
21000 -- [-929.545] (-934.319) (-930.887) (-937.090) * [-932.825] (-937.400) (-939.106) (-938.752) -- 0:01:33
21500 -- (-929.917) [-931.172] (-929.535) (-938.455) * [-934.930] (-934.047) (-935.972) (-942.417) -- 0:01:31
22000 -- (-929.854) [-933.583] (-926.914) (-939.369) * (-934.224) (-937.768) [-934.007] (-939.217) -- 0:01:28
22500 -- (-930.079) (-933.771) (-927.059) [-949.625] * (-940.837) [-937.304] (-933.248) (-935.939) -- 0:01:26
23000 -- (-930.530) (-934.087) [-926.520] (-932.539) * [-942.863] (-934.213) (-940.874) (-939.440) -- 0:01:24
23500 -- (-926.897) [-934.852] (-928.626) (-935.046) * [-935.941] (-941.513) (-934.691) (-940.389) -- 0:01:23
24000 -- (-927.911) (-929.920) [-927.880] (-932.115) * [-932.198] (-934.035) (-936.930) (-938.973) -- 0:01:21
24500 -- (-926.999) [-934.442] (-927.754) (-936.103) * (-935.075) (-934.518) [-935.100] (-939.175) -- 0:01:19
25000 -- (-926.745) (-938.747) (-926.661) [-933.784] * (-928.405) [-939.428] (-938.910) (-938.603) -- 0:01:18
Average standard deviation of split frequencies: 0.043514
25500 -- [-926.054] (-938.707) (-930.834) (-940.537) * (-929.495) (-939.923) (-945.677) [-937.560] -- 0:01:16
26000 -- [-928.914] (-932.580) (-930.079) (-937.929) * [-926.990] (-934.576) (-944.408) (-945.958) -- 0:01:14
26500 -- (-932.659) (-945.376) [-930.515] (-933.286) * (-927.039) (-932.427) [-934.541] (-936.602) -- 0:01:13
27000 -- (-927.073) [-938.948] (-928.350) (-936.172) * (-928.329) (-941.893) [-935.104] (-933.110) -- 0:01:12
27500 -- [-927.410] (-928.988) (-929.064) (-943.523) * (-927.761) [-933.890] (-940.868) (-931.278) -- 0:01:10
28000 -- (-926.558) (-926.384) [-926.689] (-933.937) * [-926.707] (-944.763) (-936.859) (-935.987) -- 0:01:09
28500 -- (-926.361) (-926.812) [-927.063] (-932.184) * (-929.482) [-931.721] (-936.279) (-937.688) -- 0:01:08
29000 -- (-927.182) (-928.939) (-926.545) [-937.879] * (-927.130) [-938.090] (-929.130) (-936.614) -- 0:01:40
29500 -- [-927.469] (-928.385) (-929.574) (-936.061) * [-927.399] (-934.329) (-939.578) (-947.762) -- 0:01:38
30000 -- (-928.957) (-927.393) (-928.818) [-935.388] * (-926.603) (-933.682) [-936.134] (-941.163) -- 0:01:37
Average standard deviation of split frequencies: 0.045347
30500 -- [-927.385] (-926.903) (-926.212) (-936.327) * (-929.598) [-932.540] (-935.016) (-938.103) -- 0:01:35
31000 -- [-927.137] (-926.795) (-928.431) (-935.646) * (-929.663) (-942.803) (-937.719) [-932.422] -- 0:01:33
31500 -- [-926.518] (-927.400) (-927.530) (-933.751) * (-929.663) (-933.374) (-937.351) [-934.633] -- 0:01:32
32000 -- (-931.413) [-928.292] (-927.764) (-937.507) * (-926.786) [-933.593] (-934.540) (-939.997) -- 0:01:30
32500 -- [-928.073] (-926.858) (-931.879) (-938.530) * (-926.317) [-930.118] (-943.704) (-931.060) -- 0:01:29
33000 -- (-927.616) (-927.010) [-928.570] (-933.343) * (-926.739) (-941.430) [-939.734] (-929.817) -- 0:01:27
33500 -- (-927.033) (-929.739) (-928.205) [-933.371] * (-928.528) (-948.804) (-935.085) [-930.873] -- 0:01:26
34000 -- [-927.574] (-932.751) (-927.417) (-950.573) * (-929.214) (-931.917) [-934.539] (-929.183) -- 0:01:25
34500 -- (-928.171) (-927.836) (-926.593) [-944.420] * (-930.033) [-939.329] (-944.467) (-929.313) -- 0:01:23
35000 -- (-928.691) [-929.827] (-926.556) (-941.469) * (-930.270) [-932.544] (-942.457) (-929.493) -- 0:01:22
Average standard deviation of split frequencies: 0.045176
35500 -- (-927.223) [-928.168] (-927.341) (-942.773) * (-927.643) [-931.346] (-940.924) (-928.055) -- 0:01:21
36000 -- (-926.508) (-928.057) (-930.351) [-941.427] * [-927.207] (-930.454) (-935.072) (-928.385) -- 0:01:20
36500 -- [-926.308] (-929.232) (-931.306) (-938.750) * [-926.787] (-927.891) (-932.994) (-928.359) -- 0:01:19
37000 -- [-929.921] (-926.735) (-931.129) (-939.286) * (-928.193) (-930.877) (-929.727) [-926.822] -- 0:01:18
37500 -- (-936.873) (-926.875) [-927.290] (-937.280) * (-929.892) [-928.246] (-944.270) (-929.777) -- 0:01:17
38000 -- (-930.784) (-928.038) [-927.792] (-939.087) * (-929.766) [-930.826] (-941.960) (-932.121) -- 0:01:15
38500 -- (-930.033) [-929.810] (-929.210) (-934.772) * (-927.279) (-928.913) [-934.146] (-932.704) -- 0:01:14
39000 -- (-927.842) (-930.296) (-933.758) [-937.085] * (-928.845) (-927.450) (-933.368) [-927.140] -- 0:01:38
39500 -- (-926.004) (-926.911) [-928.338] (-933.496) * (-927.480) [-926.725] (-938.675) (-927.762) -- 0:01:37
40000 -- [-926.772] (-926.787) (-926.798) (-936.129) * (-928.721) (-927.684) (-939.486) [-926.808] -- 0:01:36
Average standard deviation of split frequencies: 0.043608
40500 -- [-928.171] (-927.891) (-930.692) (-938.272) * [-929.393] (-927.606) (-933.459) (-928.280) -- 0:01:34
41000 -- [-929.504] (-927.557) (-927.797) (-942.180) * [-928.084] (-932.473) (-936.922) (-927.444) -- 0:01:33
41500 -- (-927.964) (-928.403) [-927.196] (-948.072) * [-927.056] (-928.290) (-936.512) (-927.268) -- 0:01:32
42000 -- (-926.398) (-926.335) (-932.735) [-939.088] * [-926.722] (-930.354) (-936.410) (-926.826) -- 0:01:31
42500 -- (-927.738) (-928.131) [-929.653] (-934.167) * [-928.331] (-926.383) (-947.772) (-926.638) -- 0:01:30
43000 -- (-927.649) [-927.338] (-927.393) (-936.416) * [-928.427] (-930.693) (-944.913) (-928.240) -- 0:01:29
43500 -- [-926.713] (-928.479) (-927.507) (-946.208) * (-929.451) (-929.035) (-936.185) [-927.918] -- 0:01:27
44000 -- [-928.011] (-926.796) (-927.225) (-941.232) * (-928.501) [-929.401] (-936.247) (-927.708) -- 0:01:26
44500 -- (-928.728) [-926.467] (-926.294) (-945.471) * [-926.526] (-930.600) (-948.135) (-930.652) -- 0:01:25
45000 -- (-925.992) [-928.428] (-929.916) (-938.597) * (-926.238) (-931.393) [-934.777] (-928.220) -- 0:01:24
Average standard deviation of split frequencies: 0.040101
45500 -- [-926.103] (-926.974) (-928.141) (-940.254) * (-927.018) (-926.324) (-942.989) [-928.886] -- 0:01:23
46000 -- (-932.811) (-932.360) [-927.076] (-936.717) * (-926.513) [-927.308] (-935.264) (-931.310) -- 0:01:22
46500 -- (-929.426) (-928.609) (-927.464) [-936.494] * [-931.360] (-928.357) (-938.317) (-931.187) -- 0:01:22
47000 -- (-929.745) (-927.110) [-928.122] (-939.318) * (-928.152) (-927.926) [-936.686] (-932.416) -- 0:01:21
47500 -- (-928.754) [-926.988] (-931.871) (-936.060) * (-926.736) (-926.765) [-941.200] (-928.229) -- 0:01:20
48000 -- (-926.903) [-926.058] (-927.852) (-935.624) * (-930.015) [-926.337] (-934.457) (-927.381) -- 0:01:19
48500 -- (-931.139) [-925.869] (-929.156) (-935.344) * (-936.625) (-930.685) (-926.959) [-927.847] -- 0:01:18
49000 -- [-928.788] (-927.499) (-929.670) (-937.317) * (-928.515) (-934.169) (-927.655) [-931.485] -- 0:01:17
49500 -- (-930.784) (-927.467) [-930.188] (-941.042) * [-926.050] (-931.648) (-932.603) (-931.945) -- 0:01:16
50000 -- (-928.439) [-928.265] (-926.178) (-938.721) * (-926.219) [-930.072] (-932.334) (-931.799) -- 0:01:16
Average standard deviation of split frequencies: 0.044748
50500 -- [-926.086] (-927.810) (-926.745) (-942.358) * [-927.634] (-926.999) (-928.824) (-931.054) -- 0:01:15
51000 -- (-928.510) (-929.858) (-928.565) [-937.154] * [-928.214] (-929.024) (-928.205) (-934.751) -- 0:01:33
51500 -- (-928.427) (-931.180) (-932.492) [-941.344] * (-927.242) [-926.372] (-929.008) (-927.369) -- 0:01:32
52000 -- (-928.133) [-929.885] (-931.401) (-939.112) * [-926.502] (-930.820) (-929.190) (-927.498) -- 0:01:31
52500 -- [-929.212] (-929.394) (-932.410) (-937.147) * [-928.675] (-929.665) (-927.924) (-927.471) -- 0:01:30
53000 -- (-927.147) (-927.463) [-932.045] (-935.976) * (-927.585) [-926.316] (-930.358) (-932.314) -- 0:01:29
53500 -- (-929.770) (-927.421) (-928.722) [-937.884] * [-926.633] (-926.545) (-927.645) (-929.477) -- 0:01:28
54000 -- (-929.806) [-927.087] (-926.815) (-942.353) * (-929.982) (-927.557) [-927.152] (-927.207) -- 0:01:27
54500 -- (-929.402) (-930.406) [-926.735] (-935.753) * (-927.895) (-926.505) [-927.026] (-929.252) -- 0:01:26
55000 -- (-928.925) (-928.039) (-925.919) [-939.547] * [-927.974] (-927.770) (-926.915) (-929.017) -- 0:01:25
Average standard deviation of split frequencies: 0.039874
55500 -- (-929.766) (-929.462) [-928.833] (-937.902) * (-927.764) (-931.609) [-926.250] (-930.337) -- 0:01:25
56000 -- [-928.356] (-927.960) (-929.574) (-954.312) * (-930.124) [-929.269] (-926.889) (-927.364) -- 0:01:24
56500 -- (-929.453) [-928.034] (-930.785) (-941.621) * (-929.104) (-928.001) (-925.892) [-927.077] -- 0:01:23
57000 -- [-928.245] (-926.931) (-927.939) (-928.278) * (-931.167) [-927.426] (-927.644) (-928.148) -- 0:01:22
57500 -- [-927.266] (-926.518) (-928.258) (-928.677) * (-927.720) (-928.358) [-927.664] (-928.638) -- 0:01:21
58000 -- (-927.388) [-927.728] (-929.870) (-926.435) * (-930.573) [-927.726] (-927.676) (-927.877) -- 0:01:21
58500 -- (-928.242) [-927.858] (-927.151) (-927.338) * [-926.642] (-927.965) (-928.532) (-931.885) -- 0:01:20
59000 -- (-929.676) (-928.513) (-928.697) [-929.273] * [-927.789] (-928.504) (-927.972) (-928.362) -- 0:01:19
59500 -- [-927.382] (-929.336) (-928.400) (-928.345) * (-926.347) [-926.664] (-929.197) (-927.214) -- 0:01:19
60000 -- (-927.944) (-928.029) (-930.654) [-926.328] * (-927.264) [-926.405] (-930.449) (-925.630) -- 0:01:18
Average standard deviation of split frequencies: 0.035989
60500 -- [-928.443] (-928.756) (-927.347) (-927.193) * (-928.036) (-925.945) [-926.746] (-926.838) -- 0:01:17
61000 -- (-928.928) (-929.023) (-926.375) [-929.149] * [-927.199] (-926.554) (-926.912) (-929.427) -- 0:01:16
61500 -- (-928.339) (-927.001) (-925.893) [-928.273] * (-926.831) (-927.386) (-927.283) [-930.316] -- 0:01:16
62000 -- (-926.500) (-930.011) (-927.722) [-928.890] * (-929.368) (-927.072) [-927.520] (-933.342) -- 0:01:15
62500 -- (-932.721) [-927.777] (-928.235) (-927.663) * (-929.048) (-928.249) [-931.445] (-929.563) -- 0:01:15
63000 -- [-929.010] (-929.617) (-927.458) (-928.068) * (-929.967) (-933.081) (-936.046) [-929.746] -- 0:01:29
63500 -- (-931.353) [-929.980] (-927.589) (-933.005) * [-927.668] (-928.042) (-929.933) (-929.887) -- 0:01:28
64000 -- (-929.926) (-926.333) [-927.616] (-928.937) * (-928.131) (-928.466) [-926.935] (-927.834) -- 0:01:27
64500 -- [-926.299] (-925.786) (-927.411) (-928.339) * (-926.987) [-927.148] (-929.219) (-927.480) -- 0:01:27
65000 -- (-927.938) (-926.668) (-928.011) [-928.926] * (-929.726) [-927.916] (-927.880) (-930.181) -- 0:01:26
Average standard deviation of split frequencies: 0.038433
65500 -- (-929.666) (-929.251) [-926.386] (-929.783) * (-930.015) [-930.602] (-926.990) (-930.845) -- 0:01:25
66000 -- (-929.602) [-929.156] (-929.141) (-928.971) * (-933.419) [-928.554] (-927.375) (-930.623) -- 0:01:24
66500 -- (-927.090) [-928.511] (-928.493) (-927.414) * (-927.853) [-928.737] (-930.039) (-927.701) -- 0:01:24
67000 -- [-926.630] (-927.254) (-928.374) (-930.363) * (-926.742) (-936.366) (-929.162) [-927.946] -- 0:01:23
67500 -- (-929.146) (-930.837) [-929.560] (-930.091) * [-926.473] (-929.783) (-928.813) (-927.994) -- 0:01:22
68000 -- (-927.493) (-930.107) (-928.375) [-928.311] * (-929.896) (-927.890) (-927.991) [-926.120] -- 0:01:22
68500 -- (-928.864) (-932.178) [-929.250] (-926.664) * [-928.472] (-928.458) (-929.462) (-926.203) -- 0:01:21
69000 -- (-929.398) (-928.654) [-929.941] (-927.220) * (-926.807) (-929.015) [-926.488] (-926.676) -- 0:01:20
69500 -- (-926.340) (-929.280) (-929.134) [-928.612] * [-929.267] (-929.175) (-928.504) (-926.761) -- 0:01:20
70000 -- (-928.083) (-929.396) [-927.474] (-928.541) * [-927.060] (-931.526) (-929.032) (-928.718) -- 0:01:19
Average standard deviation of split frequencies: 0.034307
70500 -- (-926.609) (-932.781) [-931.172] (-928.291) * [-926.975] (-932.629) (-928.969) (-928.056) -- 0:01:19
71000 -- (-926.668) (-928.303) (-925.931) [-927.958] * (-926.079) (-930.970) [-927.077] (-926.761) -- 0:01:18
71500 -- (-927.927) (-929.298) (-925.890) [-927.583] * (-926.091) (-929.892) (-928.355) [-927.555] -- 0:01:17
72000 -- [-926.065] (-928.905) (-926.871) (-928.664) * [-932.795] (-932.924) (-931.114) (-930.830) -- 0:01:17
72500 -- [-927.192] (-928.338) (-925.937) (-927.286) * (-938.886) [-927.368] (-929.623) (-930.668) -- 0:01:16
73000 -- (-926.139) (-929.529) [-926.393] (-930.167) * (-930.377) [-927.132] (-927.806) (-928.174) -- 0:01:16
73500 -- (-927.658) [-928.093] (-928.978) (-930.542) * [-927.218] (-930.960) (-928.724) (-927.352) -- 0:01:15
74000 -- [-926.992] (-927.029) (-927.239) (-929.298) * [-927.481] (-929.827) (-929.352) (-929.507) -- 0:01:15
74500 -- [-926.646] (-926.751) (-926.493) (-927.628) * (-927.481) [-926.373] (-929.220) (-926.829) -- 0:01:14
75000 -- (-927.960) [-927.636] (-926.984) (-927.745) * [-927.531] (-927.214) (-925.857) (-932.573) -- 0:01:26
Average standard deviation of split frequencies: 0.036921
75500 -- (-927.255) (-928.048) (-928.079) [-926.178] * [-927.319] (-927.206) (-926.210) (-934.802) -- 0:01:25
76000 -- (-926.282) [-927.889] (-932.156) (-927.495) * (-926.967) (-926.463) [-927.711] (-935.475) -- 0:01:25
76500 -- (-929.241) [-928.375] (-934.262) (-927.096) * (-928.618) [-928.527] (-927.375) (-930.908) -- 0:01:24
77000 -- (-928.368) [-929.824] (-933.114) (-930.718) * (-927.254) (-926.843) [-928.293] (-929.250) -- 0:01:23
77500 -- (-928.800) (-928.375) (-929.799) [-930.075] * (-927.658) (-925.950) [-929.031] (-931.528) -- 0:01:23
78000 -- (-929.975) (-935.732) [-927.870] (-929.701) * [-927.397] (-929.527) (-929.431) (-933.635) -- 0:01:22
78500 -- (-927.915) (-931.325) [-927.826] (-929.502) * (-927.614) (-928.025) (-928.432) [-929.978] -- 0:01:22
79000 -- [-926.782] (-930.780) (-927.540) (-928.462) * [-932.217] (-929.894) (-928.151) (-928.067) -- 0:01:21
79500 -- (-926.660) (-930.887) (-927.880) [-928.267] * (-932.214) (-927.491) [-928.340] (-929.788) -- 0:01:21
80000 -- [-927.168] (-930.193) (-927.391) (-927.375) * (-928.590) (-934.958) [-929.347] (-926.535) -- 0:01:20
Average standard deviation of split frequencies: 0.039738
80500 -- (-927.171) (-931.673) (-927.394) [-926.524] * [-927.241] (-928.752) (-932.993) (-930.282) -- 0:01:19
81000 -- (-926.867) (-930.545) (-928.932) [-926.827] * [-930.676] (-931.781) (-928.670) (-927.033) -- 0:01:19
81500 -- [-927.075] (-928.432) (-927.486) (-927.894) * [-929.150] (-928.767) (-928.462) (-927.923) -- 0:01:18
82000 -- (-931.194) (-927.450) (-930.354) [-927.424] * [-928.266] (-927.611) (-929.450) (-928.290) -- 0:01:18
82500 -- (-933.584) (-927.190) (-933.072) [-927.712] * (-925.882) [-926.916] (-928.514) (-928.591) -- 0:01:17
83000 -- [-929.392] (-927.280) (-930.617) (-926.540) * (-928.454) (-930.541) [-928.062] (-928.215) -- 0:01:17
83500 -- (-929.607) [-925.937] (-930.317) (-929.625) * [-932.095] (-930.742) (-932.067) (-927.702) -- 0:01:16
84000 -- [-929.666] (-927.345) (-928.856) (-934.691) * (-926.901) (-927.947) [-926.771] (-927.499) -- 0:01:16
84500 -- (-927.712) (-928.304) [-927.918] (-929.371) * (-926.824) [-926.803] (-927.465) (-929.099) -- 0:01:15
85000 -- (-926.874) (-929.494) [-926.035] (-930.098) * [-928.055] (-927.879) (-928.688) (-936.180) -- 0:01:15
Average standard deviation of split frequencies: 0.034134
85500 -- (-926.250) (-927.566) (-927.650) [-930.024] * (-927.818) [-926.601] (-926.886) (-930.655) -- 0:01:14
86000 -- (-928.773) [-927.523] (-926.591) (-928.534) * [-929.210] (-926.718) (-926.952) (-930.380) -- 0:01:14
86500 -- (-934.103) (-928.802) [-929.233] (-929.322) * [-928.943] (-926.235) (-926.823) (-926.796) -- 0:01:24
87000 -- (-929.741) (-928.869) [-927.517] (-929.212) * (-932.731) [-926.567] (-932.239) (-926.271) -- 0:01:23
87500 -- [-928.686] (-929.296) (-927.138) (-928.891) * (-927.582) (-926.948) [-929.052] (-929.180) -- 0:01:23
88000 -- (-928.912) (-928.631) (-928.131) [-932.507] * (-929.927) [-927.482] (-928.764) (-931.619) -- 0:01:22
88500 -- (-927.517) (-926.763) [-926.438] (-926.869) * (-928.756) [-927.486] (-927.677) (-935.420) -- 0:01:22
89000 -- (-927.370) (-928.208) [-927.293] (-928.687) * [-927.637] (-928.965) (-928.520) (-932.424) -- 0:01:21
89500 -- (-926.992) (-926.888) (-927.131) [-926.440] * (-930.586) (-928.692) [-930.317] (-929.506) -- 0:01:21
90000 -- (-927.925) (-929.768) [-926.314] (-927.393) * (-927.820) (-928.819) (-929.630) [-927.237] -- 0:01:20
Average standard deviation of split frequencies: 0.033087
90500 -- (-927.002) [-927.343] (-926.809) (-926.811) * (-929.934) [-930.228] (-927.267) (-926.381) -- 0:01:20
91000 -- [-927.325] (-927.608) (-926.396) (-927.301) * (-929.484) (-929.601) (-926.581) [-926.068] -- 0:01:19
91500 -- (-926.113) [-928.078] (-930.894) (-926.492) * (-929.323) (-928.082) (-926.582) [-926.098] -- 0:01:19
92000 -- (-930.575) (-927.476) (-929.237) [-928.650] * (-927.100) (-930.049) (-926.262) [-927.002] -- 0:01:18
92500 -- (-927.918) (-927.925) [-929.931] (-929.673) * [-927.201] (-929.782) (-925.934) (-927.784) -- 0:01:18
93000 -- (-926.272) [-928.604] (-926.517) (-927.465) * (-927.908) [-927.746] (-927.889) (-928.343) -- 0:01:18
93500 -- (-926.271) (-927.786) (-928.398) [-928.722] * (-926.117) (-927.742) (-927.114) [-928.707] -- 0:01:17
94000 -- (-926.606) (-927.491) (-928.214) [-927.385] * (-927.255) (-930.093) (-927.374) [-930.128] -- 0:01:17
94500 -- (-928.605) [-927.355] (-926.710) (-927.981) * (-930.824) (-927.224) [-929.313] (-928.365) -- 0:01:16
95000 -- (-925.994) (-931.596) [-930.370] (-927.557) * (-928.311) (-926.560) [-928.701] (-927.849) -- 0:01:16
Average standard deviation of split frequencies: 0.029708
95500 -- [-931.875] (-928.861) (-927.707) (-927.010) * (-928.871) (-928.973) (-926.221) [-929.970] -- 0:01:15
96000 -- (-927.446) (-930.186) (-927.577) [-928.716] * (-925.989) [-926.399] (-926.252) (-930.001) -- 0:01:15
96500 -- [-932.412] (-931.325) (-928.252) (-927.137) * [-928.795] (-926.444) (-926.250) (-929.012) -- 0:01:14
97000 -- (-928.195) (-930.091) (-930.169) [-927.075] * (-934.066) [-928.688] (-926.237) (-928.684) -- 0:01:14
97500 -- (-929.243) (-931.933) [-930.527] (-926.141) * (-935.939) (-930.861) [-928.441] (-930.583) -- 0:01:14
98000 -- [-930.451] (-929.619) (-930.357) (-926.733) * (-930.170) (-930.853) (-928.090) [-927.506] -- 0:01:13
98500 -- (-935.013) (-929.497) [-928.308] (-927.827) * (-927.304) [-926.451] (-931.848) (-927.513) -- 0:01:22
99000 -- (-928.401) (-927.343) (-929.915) [-927.006] * [-926.782] (-925.837) (-926.650) (-928.749) -- 0:01:21
99500 -- [-929.185] (-926.257) (-929.696) (-932.850) * [-927.839] (-926.373) (-926.612) (-928.605) -- 0:01:21
100000 -- (-926.581) [-926.308] (-928.935) (-929.989) * (-927.417) [-925.940] (-928.949) (-927.201) -- 0:01:21
Average standard deviation of split frequencies: 0.029138
100500 -- (-927.257) (-926.408) [-929.301] (-927.192) * (-928.812) (-927.049) [-926.470] (-927.614) -- 0:01:20
101000 -- (-928.982) (-926.667) [-927.636] (-929.584) * (-930.585) [-926.878] (-927.755) (-928.087) -- 0:01:20
101500 -- (-926.885) [-927.202] (-928.092) (-928.718) * [-927.300] (-933.071) (-928.931) (-930.858) -- 0:01:19
102000 -- (-927.289) (-927.969) [-929.007] (-927.040) * (-928.275) (-934.001) [-926.741] (-931.064) -- 0:01:19
102500 -- [-929.142] (-927.551) (-927.429) (-926.730) * (-927.751) (-930.459) [-926.675] (-930.455) -- 0:01:18
103000 -- (-931.309) (-926.446) (-926.646) [-927.170] * (-927.282) (-930.183) [-926.370] (-931.987) -- 0:01:18
103500 -- (-931.943) (-929.602) (-927.723) [-927.151] * (-926.928) (-933.543) [-926.553] (-930.811) -- 0:01:17
104000 -- (-929.559) [-928.137] (-930.714) (-937.478) * (-926.085) (-929.184) [-928.122] (-929.461) -- 0:01:17
104500 -- (-929.997) (-929.240) [-926.352] (-937.823) * [-927.757] (-929.923) (-927.160) (-927.874) -- 0:01:17
105000 -- (-929.219) [-927.666] (-926.087) (-933.059) * (-926.254) [-929.819] (-928.086) (-927.781) -- 0:01:16
Average standard deviation of split frequencies: 0.029258
105500 -- (-928.977) (-927.307) (-926.487) [-930.401] * [-926.301] (-926.782) (-927.016) (-928.166) -- 0:01:16
106000 -- (-931.877) (-929.559) (-926.281) [-928.295] * (-926.078) (-927.183) (-931.989) [-929.510] -- 0:01:15
106500 -- (-929.895) (-930.668) (-929.156) [-926.900] * [-927.665] (-930.273) (-928.308) (-932.527) -- 0:01:15
107000 -- (-931.701) (-930.835) (-928.483) [-927.763] * (-927.058) (-926.999) (-933.356) [-927.351] -- 0:01:15
107500 -- (-928.229) (-934.021) (-927.075) [-927.997] * [-927.206] (-928.019) (-926.467) (-927.042) -- 0:01:14
108000 -- (-927.638) (-928.484) (-929.717) [-928.293] * (-927.328) (-926.757) [-927.601] (-926.650) -- 0:01:14
108500 -- (-929.307) [-928.372] (-927.357) (-930.123) * (-928.858) (-926.132) [-927.442] (-930.814) -- 0:01:13
109000 -- (-927.411) [-926.426] (-928.806) (-930.230) * (-929.407) (-926.260) (-927.790) [-930.953] -- 0:01:13
109500 -- (-928.413) (-928.227) [-927.849] (-932.428) * (-927.790) [-927.153] (-927.667) (-930.417) -- 0:01:13
110000 -- (-928.762) (-930.566) [-927.745] (-929.676) * (-929.827) [-927.118] (-927.526) (-927.348) -- 0:01:12
Average standard deviation of split frequencies: 0.027451
110500 -- (-927.002) [-928.445] (-926.729) (-929.101) * (-933.312) (-927.718) [-925.684] (-931.594) -- 0:01:20
111000 -- [-928.532] (-926.693) (-928.745) (-930.586) * (-927.771) (-928.471) [-926.273] (-928.151) -- 0:01:20
111500 -- (-928.423) [-927.210] (-930.443) (-929.452) * [-928.904] (-928.409) (-928.429) (-928.351) -- 0:01:19
112000 -- (-929.711) (-928.319) (-926.906) [-927.941] * (-929.115) (-928.249) [-926.353] (-929.786) -- 0:01:19
112500 -- [-930.245] (-928.602) (-927.759) (-928.780) * (-926.341) (-926.801) (-928.142) [-926.968] -- 0:01:18
113000 -- (-930.761) (-927.480) (-929.267) [-926.739] * (-927.181) (-929.000) (-927.920) [-928.592] -- 0:01:18
113500 -- [-927.702] (-930.012) (-926.023) (-926.071) * (-931.174) [-927.479] (-928.730) (-926.924) -- 0:01:18
114000 -- (-926.549) (-927.878) [-927.518] (-926.050) * (-927.231) (-927.496) (-929.958) [-927.005] -- 0:01:17
114500 -- [-928.135] (-927.243) (-929.453) (-927.429) * (-926.852) [-927.608] (-928.237) (-929.146) -- 0:01:17
115000 -- (-928.335) [-928.615] (-927.817) (-928.444) * (-929.269) [-928.658] (-927.757) (-926.043) -- 0:01:16
Average standard deviation of split frequencies: 0.020771
115500 -- [-927.719] (-929.243) (-927.648) (-927.547) * (-927.838) (-929.376) [-926.146] (-926.594) -- 0:01:16
116000 -- [-927.924] (-927.439) (-937.581) (-930.893) * [-926.920] (-926.946) (-927.787) (-926.145) -- 0:01:16
116500 -- (-926.783) (-925.890) (-933.813) [-929.953] * (-927.939) [-932.178] (-927.532) (-927.164) -- 0:01:15
117000 -- (-927.504) (-931.159) [-927.975] (-927.718) * (-927.729) [-929.626] (-934.353) (-926.263) -- 0:01:15
117500 -- (-926.104) (-926.539) (-928.183) [-926.553] * (-927.635) (-928.642) (-929.666) [-928.184] -- 0:01:15
118000 -- (-927.417) [-926.911] (-929.348) (-930.957) * [-927.770] (-929.165) (-931.450) (-926.927) -- 0:01:14
118500 -- (-930.086) (-926.452) [-929.105] (-932.287) * (-926.646) (-929.253) (-929.565) [-926.317] -- 0:01:14
119000 -- (-926.892) (-926.848) [-926.480] (-932.451) * (-930.969) (-928.735) (-927.542) [-928.315] -- 0:01:14
119500 -- [-927.470] (-927.365) (-927.928) (-932.186) * (-929.738) (-926.912) [-927.912] (-926.126) -- 0:01:13
120000 -- (-929.827) (-927.423) (-926.942) [-928.301] * [-928.358] (-927.784) (-929.099) (-927.284) -- 0:01:13
Average standard deviation of split frequencies: 0.020401
120500 -- (-926.629) (-928.228) (-927.930) [-928.320] * (-928.189) [-929.824] (-926.735) (-927.432) -- 0:01:12
121000 -- (-927.685) (-928.072) (-926.895) [-930.318] * (-929.028) (-930.149) [-928.496] (-927.503) -- 0:01:12
121500 -- (-928.480) [-928.641] (-927.997) (-927.552) * (-928.796) (-926.226) (-932.846) [-928.364] -- 0:01:12
122000 -- (-928.994) (-932.503) (-928.136) [-928.180] * (-929.046) [-926.287] (-927.705) (-927.031) -- 0:01:11
122500 -- (-932.062) [-930.550] (-929.341) (-928.832) * (-929.829) [-927.565] (-927.964) (-926.884) -- 0:01:11
123000 -- (-932.344) [-928.396] (-926.561) (-928.912) * (-927.606) [-926.401] (-929.353) (-925.619) -- 0:01:18
123500 -- (-933.151) (-928.370) [-926.027] (-927.999) * (-926.365) (-927.107) (-929.053) [-930.070] -- 0:01:18
124000 -- (-929.996) (-926.240) (-926.083) [-927.410] * [-927.268] (-927.854) (-928.528) (-927.774) -- 0:01:17
124500 -- (-928.946) (-927.398) [-925.899] (-927.062) * (-926.413) [-928.932] (-927.736) (-926.747) -- 0:01:17
125000 -- (-928.142) (-927.475) [-927.698] (-928.589) * (-927.640) (-929.116) [-926.929] (-928.071) -- 0:01:17
Average standard deviation of split frequencies: 0.022032
125500 -- (-928.457) (-926.373) (-926.153) [-928.650] * (-926.249) (-928.049) (-928.305) [-927.260] -- 0:01:16
126000 -- [-926.845] (-926.042) (-926.570) (-926.779) * (-926.996) (-929.520) (-928.117) [-926.586] -- 0:01:16
126500 -- (-929.014) [-931.022] (-929.466) (-927.268) * (-927.573) (-928.264) [-928.665] (-926.206) -- 0:01:15
127000 -- (-931.551) (-930.755) [-931.596] (-929.294) * (-926.613) (-926.972) (-930.414) [-928.987] -- 0:01:15
127500 -- (-929.116) (-927.097) (-931.889) [-929.548] * (-929.581) (-929.827) [-928.470] (-926.390) -- 0:01:15
128000 -- [-927.407] (-926.734) (-927.845) (-927.642) * (-925.928) [-928.724] (-929.037) (-927.680) -- 0:01:14
128500 -- [-927.643] (-926.034) (-927.043) (-927.876) * [-926.374] (-927.045) (-927.197) (-928.380) -- 0:01:14
129000 -- (-928.205) (-927.891) (-927.213) [-928.590] * (-929.380) (-929.813) (-927.122) [-926.427] -- 0:01:14
129500 -- (-929.749) [-926.672] (-927.674) (-929.280) * [-928.455] (-928.604) (-925.755) (-927.391) -- 0:01:13
130000 -- (-926.541) [-927.189] (-927.426) (-928.208) * (-927.844) (-929.157) (-925.740) [-925.970] -- 0:01:13
Average standard deviation of split frequencies: 0.022648
130500 -- (-926.700) [-926.478] (-926.629) (-930.540) * (-928.162) (-929.010) (-927.272) [-927.557] -- 0:01:13
131000 -- (-929.123) [-928.262] (-927.189) (-927.650) * (-928.903) (-928.497) [-927.205] (-927.527) -- 0:01:12
131500 -- [-926.503] (-926.598) (-926.858) (-927.896) * (-926.733) (-929.071) [-928.896] (-929.381) -- 0:01:12
132000 -- (-930.203) (-927.494) [-927.466] (-928.727) * [-926.205] (-928.679) (-931.323) (-928.132) -- 0:01:12
132500 -- (-928.432) (-928.901) (-927.043) [-926.985] * [-928.156] (-927.768) (-931.311) (-930.246) -- 0:01:12
133000 -- [-928.595] (-927.146) (-928.604) (-927.888) * [-926.169] (-927.202) (-927.535) (-929.990) -- 0:01:11
133500 -- (-927.528) (-932.033) (-932.230) [-930.999] * [-926.783] (-929.575) (-926.426) (-928.389) -- 0:01:11
134000 -- (-928.364) [-930.420] (-927.824) (-927.090) * (-927.866) (-926.869) (-927.277) [-926.406] -- 0:01:11
134500 -- [-926.588] (-927.408) (-927.035) (-928.292) * (-928.947) (-931.896) [-927.126] (-926.969) -- 0:01:10
135000 -- [-926.732] (-928.235) (-928.046) (-928.658) * (-929.135) [-928.376] (-927.313) (-929.842) -- 0:01:16
Average standard deviation of split frequencies: 0.020250
135500 -- (-929.141) (-927.163) (-928.728) [-925.840] * (-930.260) [-928.315] (-930.608) (-932.084) -- 0:01:16
136000 -- [-927.580] (-928.327) (-927.003) (-925.955) * [-931.514] (-928.220) (-927.028) (-932.660) -- 0:01:16
136500 -- (-928.044) (-927.793) (-927.956) [-927.514] * (-928.378) [-927.832] (-928.826) (-927.784) -- 0:01:15
137000 -- [-926.431] (-930.481) (-927.230) (-928.012) * (-927.161) [-927.661] (-929.727) (-927.456) -- 0:01:15
137500 -- (-927.225) (-930.128) [-930.532] (-929.702) * (-932.502) (-926.369) (-927.134) [-926.652] -- 0:01:15
138000 -- [-926.786] (-927.443) (-931.813) (-930.552) * [-928.479] (-927.322) (-929.109) (-927.746) -- 0:01:14
138500 -- [-926.578] (-931.995) (-934.093) (-932.184) * (-931.334) (-926.979) (-929.828) [-926.587] -- 0:01:14
139000 -- (-926.899) [-929.205] (-933.901) (-930.894) * [-927.133] (-927.518) (-932.010) (-926.235) -- 0:01:14
139500 -- (-926.258) [-929.130] (-927.984) (-929.639) * (-926.153) (-929.656) [-928.117] (-926.166) -- 0:01:14
140000 -- (-928.191) [-927.162] (-928.682) (-927.858) * (-925.922) (-928.026) [-929.765] (-927.005) -- 0:01:13
Average standard deviation of split frequencies: 0.016227
140500 -- (-926.783) (-926.864) (-929.370) [-926.350] * (-929.875) (-929.637) [-928.350] (-927.056) -- 0:01:13
141000 -- (-928.083) (-928.509) [-929.402] (-928.623) * (-926.551) [-928.243] (-929.387) (-928.325) -- 0:01:13
141500 -- (-926.726) (-928.619) (-925.732) [-927.519] * [-929.634] (-925.781) (-927.111) (-930.749) -- 0:01:12
142000 -- (-929.593) [-927.386] (-926.641) (-929.076) * (-930.984) (-927.491) (-932.249) [-928.308] -- 0:01:12
142500 -- (-927.558) (-929.194) [-933.269] (-927.747) * (-929.295) [-927.298] (-927.856) (-930.240) -- 0:01:12
143000 -- [-926.888] (-927.284) (-927.171) (-929.075) * (-926.623) [-928.685] (-927.483) (-935.504) -- 0:01:11
143500 -- [-926.923] (-928.646) (-928.421) (-927.668) * (-926.871) (-929.280) [-926.856] (-933.987) -- 0:01:11
144000 -- (-929.114) [-928.411] (-928.313) (-928.651) * (-928.728) [-927.362] (-926.038) (-930.265) -- 0:01:11
144500 -- [-927.326] (-931.116) (-927.012) (-928.387) * (-926.642) (-928.388) (-935.911) [-929.586] -- 0:01:11
145000 -- [-928.762] (-928.038) (-927.247) (-928.130) * [-926.535] (-926.951) (-927.426) (-930.611) -- 0:01:10
Average standard deviation of split frequencies: 0.014045
145500 -- (-928.351) (-930.143) (-926.534) [-928.056] * (-934.050) [-927.615] (-927.297) (-931.853) -- 0:01:10
146000 -- (-930.329) (-926.749) [-926.542] (-932.654) * (-931.523) [-928.963] (-929.156) (-927.231) -- 0:01:10
146500 -- (-928.552) (-927.627) (-926.950) [-926.553] * (-928.127) (-931.038) [-929.664] (-931.564) -- 0:01:09
147000 -- (-930.409) (-930.790) (-929.345) [-926.463] * [-927.750] (-929.972) (-930.872) (-927.880) -- 0:01:15
147500 -- (-928.309) (-930.625) (-928.653) [-925.998] * (-930.112) (-928.331) (-927.168) [-929.022] -- 0:01:15
148000 -- (-929.309) (-929.515) [-927.112] (-927.716) * (-928.157) (-926.777) (-926.306) [-929.579] -- 0:01:14
148500 -- (-933.241) (-926.615) [-925.874] (-925.704) * [-925.917] (-926.347) (-927.849) (-930.221) -- 0:01:14
149000 -- (-929.920) [-927.597] (-926.262) (-928.730) * (-928.722) (-926.145) (-930.126) [-927.381] -- 0:01:14
149500 -- (-929.948) (-927.217) [-929.276] (-931.111) * (-929.542) [-926.569] (-927.686) (-928.683) -- 0:01:13
150000 -- [-926.956] (-927.244) (-927.651) (-931.564) * [-926.600] (-929.982) (-926.819) (-927.453) -- 0:01:13
Average standard deviation of split frequencies: 0.012845
150500 -- (-928.658) (-928.030) (-930.365) [-928.510] * (-927.974) (-929.079) (-927.444) [-927.105] -- 0:01:13
151000 -- (-928.122) (-927.956) (-927.224) [-927.811] * [-930.340] (-926.003) (-927.532) (-933.228) -- 0:01:13
151500 -- [-926.784] (-927.000) (-927.017) (-927.636) * [-928.233] (-927.146) (-929.868) (-931.215) -- 0:01:12
152000 -- (-929.824) [-929.161] (-928.066) (-931.250) * (-934.070) [-927.143] (-933.047) (-931.492) -- 0:01:12
152500 -- (-925.910) (-927.335) [-927.843] (-933.109) * (-934.875) (-926.001) (-930.021) [-929.949] -- 0:01:12
153000 -- (-930.202) (-926.273) (-929.994) [-928.897] * (-929.613) [-926.564] (-926.297) (-926.327) -- 0:01:11
153500 -- (-931.741) (-926.953) [-928.029] (-929.355) * [-926.094] (-927.240) (-927.476) (-931.615) -- 0:01:11
154000 -- (-930.400) [-929.204] (-927.962) (-929.893) * [-925.969] (-926.150) (-931.816) (-928.866) -- 0:01:11
154500 -- (-939.591) (-928.024) [-931.347] (-929.202) * (-926.033) [-927.058] (-929.180) (-928.889) -- 0:01:11
155000 -- (-935.236) [-926.996] (-928.631) (-929.184) * (-926.481) (-927.150) [-926.364] (-928.213) -- 0:01:10
Average standard deviation of split frequencies: 0.013837
155500 -- (-926.596) [-929.430] (-927.510) (-926.891) * [-927.513] (-933.264) (-927.114) (-926.032) -- 0:01:10
156000 -- (-926.685) [-929.923] (-926.256) (-928.322) * [-927.077] (-925.894) (-929.189) (-926.855) -- 0:01:10
156500 -- (-927.300) (-928.743) [-925.988] (-928.985) * [-927.669] (-926.254) (-931.477) (-927.253) -- 0:01:10
157000 -- (-929.653) (-930.132) (-929.178) [-930.094] * (-926.636) [-928.902] (-929.234) (-926.434) -- 0:01:09
157500 -- (-926.274) [-929.430] (-928.230) (-929.015) * (-931.235) (-929.158) [-929.389] (-927.256) -- 0:01:09
158000 -- (-929.637) (-928.086) (-926.806) [-929.522] * (-926.304) [-929.857] (-929.401) (-926.609) -- 0:01:09
158500 -- (-927.665) [-927.915] (-928.988) (-929.129) * (-931.288) (-929.122) (-930.941) [-930.991] -- 0:01:09
159000 -- (-928.271) (-932.679) [-928.808] (-932.372) * (-930.202) (-930.085) [-929.104] (-930.032) -- 0:01:14
159500 -- [-927.958] (-927.406) (-926.369) (-932.792) * [-927.107] (-930.847) (-933.204) (-930.799) -- 0:01:13
160000 -- (-933.003) [-928.970] (-926.370) (-933.704) * (-928.669) (-930.774) (-929.970) [-928.309] -- 0:01:13
Average standard deviation of split frequencies: 0.011427
160500 -- (-933.347) (-930.257) [-926.917] (-929.084) * [-928.494] (-929.029) (-932.708) (-927.973) -- 0:01:13
161000 -- [-926.260] (-926.223) (-926.398) (-929.523) * (-932.743) [-929.283] (-929.191) (-927.960) -- 0:01:12
161500 -- [-928.361] (-926.880) (-928.394) (-930.623) * (-930.787) (-927.184) (-931.198) [-930.294] -- 0:01:12
162000 -- (-926.779) [-926.880] (-932.778) (-929.963) * (-930.331) [-927.783] (-928.103) (-929.291) -- 0:01:12
162500 -- [-929.329] (-927.705) (-927.266) (-927.866) * (-927.740) (-926.571) (-927.745) [-926.848] -- 0:01:12
163000 -- [-927.466] (-927.878) (-926.263) (-926.536) * (-926.670) [-929.866] (-926.516) (-926.866) -- 0:01:11
163500 -- (-930.415) (-926.314) (-926.675) [-927.321] * [-927.556] (-930.319) (-926.202) (-929.847) -- 0:01:11
164000 -- (-930.307) (-927.005) (-934.319) [-926.734] * (-929.299) (-930.430) [-925.860] (-928.062) -- 0:01:11
164500 -- (-927.408) [-928.649] (-928.627) (-929.672) * (-929.744) [-926.500] (-928.102) (-930.427) -- 0:01:11
165000 -- (-928.348) (-926.912) [-926.432] (-928.028) * [-926.875] (-929.027) (-926.260) (-927.205) -- 0:01:10
Average standard deviation of split frequencies: 0.010163
165500 -- (-930.237) (-926.399) [-926.982] (-927.608) * (-927.365) [-927.258] (-928.335) (-929.192) -- 0:01:10
166000 -- (-928.154) [-929.337] (-927.021) (-927.143) * (-930.578) [-926.280] (-927.350) (-929.591) -- 0:01:10
166500 -- (-925.985) (-927.425) [-927.128] (-929.052) * (-927.754) (-929.964) [-930.812] (-927.535) -- 0:01:10
167000 -- [-927.379] (-928.429) (-926.584) (-928.994) * (-928.264) [-927.954] (-927.483) (-929.743) -- 0:01:09
167500 -- (-930.437) (-928.088) [-928.372] (-928.287) * (-928.334) [-926.586] (-926.755) (-929.430) -- 0:01:09
168000 -- [-933.023] (-926.369) (-928.188) (-931.145) * (-929.406) (-926.024) (-929.702) [-928.556] -- 0:01:09
168500 -- (-931.182) (-926.947) [-928.728] (-927.912) * (-929.656) (-927.648) (-929.309) [-927.486] -- 0:01:09
169000 -- (-934.395) [-926.416] (-931.964) (-926.015) * (-930.158) (-926.367) (-929.260) [-927.702] -- 0:01:08
169500 -- [-930.136] (-929.017) (-929.313) (-929.976) * (-928.577) (-926.598) (-928.853) [-932.174] -- 0:01:08
170000 -- (-929.322) (-926.828) (-931.623) [-928.015] * (-927.740) (-932.732) [-927.350] (-928.300) -- 0:01:08
Average standard deviation of split frequencies: 0.011775
170500 -- [-928.783] (-928.919) (-927.908) (-929.137) * [-927.005] (-926.062) (-928.444) (-928.416) -- 0:01:08
171000 -- (-927.763) [-930.140] (-929.262) (-931.460) * [-925.832] (-926.633) (-926.704) (-931.426) -- 0:01:12
171500 -- (-929.581) [-927.714] (-929.450) (-931.327) * (-926.863) (-926.754) (-926.184) [-928.660] -- 0:01:12
172000 -- (-929.449) (-927.962) [-927.146] (-927.595) * [-926.057] (-926.499) (-927.244) (-928.686) -- 0:01:12
172500 -- (-929.155) (-927.239) [-927.074] (-927.605) * (-926.252) (-925.711) [-927.814] (-928.003) -- 0:01:11
173000 -- (-927.215) (-928.021) [-929.180] (-929.616) * (-928.306) [-930.379] (-932.305) (-926.685) -- 0:01:11
173500 -- [-928.406] (-927.816) (-927.494) (-934.930) * [-928.936] (-931.443) (-927.251) (-927.595) -- 0:01:11
174000 -- [-928.190] (-928.186) (-928.577) (-931.533) * [-928.719] (-926.301) (-926.292) (-927.290) -- 0:01:11
174500 -- [-932.185] (-931.978) (-926.230) (-931.067) * (-928.526) (-926.200) [-926.722] (-933.766) -- 0:01:10
175000 -- [-926.872] (-928.025) (-925.875) (-932.217) * (-928.389) (-927.356) [-926.867] (-932.062) -- 0:01:10
Average standard deviation of split frequencies: 0.013815
175500 -- (-927.225) [-927.461] (-929.720) (-927.496) * (-927.858) (-927.091) (-927.058) [-930.067] -- 0:01:10
176000 -- (-928.005) [-927.499] (-926.944) (-929.890) * (-933.230) (-926.209) [-926.470] (-927.191) -- 0:01:10
176500 -- [-929.633] (-927.431) (-926.434) (-926.656) * (-928.943) [-925.798] (-930.732) (-927.338) -- 0:01:09
177000 -- (-930.002) (-926.711) [-926.360] (-928.002) * (-929.118) (-926.370) (-930.388) [-927.381] -- 0:01:09
177500 -- (-927.031) (-926.711) (-926.969) [-927.471] * [-927.641] (-934.815) (-927.106) (-927.631) -- 0:01:09
178000 -- (-928.107) (-927.819) [-931.089] (-925.846) * (-929.280) [-928.943] (-926.699) (-937.012) -- 0:01:09
178500 -- (-929.148) (-928.041) [-927.381] (-928.994) * [-928.261] (-929.016) (-926.902) (-931.789) -- 0:01:09
179000 -- (-929.421) (-926.822) (-931.387) [-927.165] * [-927.100] (-926.972) (-929.527) (-929.069) -- 0:01:08
179500 -- [-928.339] (-928.151) (-928.181) (-926.151) * [-928.894] (-926.877) (-932.497) (-933.493) -- 0:01:08
180000 -- (-926.842) (-928.959) (-928.180) [-927.394] * [-926.627] (-928.512) (-928.916) (-931.197) -- 0:01:08
Average standard deviation of split frequencies: 0.011017
180500 -- [-929.203] (-927.069) (-931.541) (-927.414) * (-927.382) (-926.046) [-928.127] (-926.404) -- 0:01:08
181000 -- (-928.855) (-926.559) [-929.747] (-926.823) * (-928.648) (-928.097) [-928.036] (-926.267) -- 0:01:07
181500 -- (-928.962) [-926.887] (-927.692) (-927.616) * (-930.406) (-927.382) [-930.263] (-927.345) -- 0:01:07
182000 -- (-926.392) (-931.496) [-927.174] (-930.702) * (-927.968) [-929.151] (-929.373) (-927.274) -- 0:01:07
182500 -- (-929.806) [-929.811] (-927.407) (-930.585) * [-930.596] (-928.021) (-927.917) (-929.072) -- 0:01:07
183000 -- (-926.341) (-929.049) [-929.816] (-931.008) * (-927.702) (-929.074) (-928.855) [-927.985] -- 0:01:11
183500 -- [-927.997] (-929.049) (-934.112) (-929.165) * (-929.583) [-930.174] (-932.352) (-930.460) -- 0:01:11
184000 -- (-934.265) (-928.667) [-931.089] (-929.826) * [-926.597] (-930.003) (-940.095) (-928.581) -- 0:01:10
184500 -- (-926.526) [-927.548] (-928.071) (-930.253) * (-926.536) [-929.439] (-938.757) (-929.365) -- 0:01:10
185000 -- (-930.334) [-927.718] (-931.697) (-925.721) * (-928.225) [-927.909] (-933.667) (-929.094) -- 0:01:10
Average standard deviation of split frequencies: 0.012250
185500 -- [-929.572] (-927.119) (-927.465) (-926.622) * (-926.550) (-929.611) [-928.831] (-927.829) -- 0:01:10
186000 -- (-927.465) (-927.477) (-931.430) [-929.423] * (-926.521) (-932.703) [-928.521] (-928.692) -- 0:01:10
186500 -- (-927.201) [-927.806] (-929.886) (-927.107) * (-931.203) [-927.299] (-928.255) (-931.019) -- 0:01:09
187000 -- (-930.041) [-927.845] (-928.663) (-929.153) * [-928.720] (-930.106) (-926.332) (-926.339) -- 0:01:09
187500 -- (-926.923) (-930.531) (-928.349) [-927.999] * [-927.055] (-929.586) (-926.376) (-926.510) -- 0:01:09
188000 -- (-926.420) [-928.122] (-926.645) (-928.423) * (-927.005) (-928.024) [-928.713] (-932.188) -- 0:01:09
188500 -- (-927.027) (-928.863) (-928.526) [-929.505] * (-927.321) [-925.727] (-931.154) (-933.564) -- 0:01:08
189000 -- (-929.236) (-928.801) (-928.913) [-928.904] * (-928.803) (-926.863) (-927.837) [-929.619] -- 0:01:08
189500 -- (-928.374) (-928.800) (-927.703) [-925.913] * (-929.955) [-927.234] (-929.056) (-927.459) -- 0:01:08
190000 -- (-931.230) (-928.932) [-927.651] (-926.123) * (-927.713) [-927.542] (-929.296) (-927.362) -- 0:01:08
Average standard deviation of split frequencies: 0.014834
190500 -- (-930.831) (-928.814) (-928.903) [-926.546] * (-930.746) [-930.513] (-927.100) (-931.301) -- 0:01:07
191000 -- (-927.912) (-928.263) (-930.386) [-927.459] * (-931.548) (-928.283) (-930.220) [-930.578] -- 0:01:07
191500 -- (-929.411) (-932.708) (-929.590) [-928.604] * (-927.664) (-928.102) (-927.561) [-935.353] -- 0:01:07
192000 -- (-927.112) (-929.865) (-926.704) [-926.534] * [-926.131] (-928.024) (-927.065) (-928.293) -- 0:01:07
192500 -- (-926.639) [-928.210] (-926.239) (-926.465) * (-927.674) (-928.977) (-926.362) [-928.165] -- 0:01:07
193000 -- (-927.007) (-929.849) (-927.933) [-928.239] * (-927.097) [-926.332] (-928.149) (-926.881) -- 0:01:06
193500 -- (-926.993) (-928.679) (-927.856) [-927.756] * [-926.762] (-930.443) (-926.803) (-931.306) -- 0:01:06
194000 -- (-926.544) (-928.040) [-928.283] (-929.994) * (-926.823) (-926.541) [-927.374] (-931.202) -- 0:01:06
194500 -- (-926.929) (-927.327) [-928.366] (-930.160) * (-927.365) (-929.086) (-926.658) [-929.616] -- 0:01:06
195000 -- [-927.517] (-926.539) (-929.500) (-928.091) * (-928.349) (-929.684) (-928.660) [-929.749] -- 0:01:10
Average standard deviation of split frequencies: 0.012961
195500 -- (-927.085) (-926.272) (-927.026) [-928.226] * (-928.349) [-925.809] (-928.748) (-934.471) -- 0:01:09
196000 -- [-927.742] (-928.762) (-926.816) (-928.615) * (-928.152) (-928.343) (-928.124) [-928.310] -- 0:01:09
196500 -- (-926.790) (-926.616) [-927.152] (-933.550) * (-927.280) (-926.321) (-930.448) [-928.835] -- 0:01:09
197000 -- (-927.292) (-927.392) [-926.460] (-928.695) * (-928.170) [-927.635] (-929.083) (-930.354) -- 0:01:09
197500 -- [-929.654] (-926.815) (-926.645) (-930.881) * [-930.400] (-933.823) (-930.337) (-928.924) -- 0:01:09
198000 -- (-926.364) (-926.817) [-926.337] (-929.208) * [-926.912] (-930.790) (-929.251) (-928.020) -- 0:01:08
198500 -- [-928.740] (-927.418) (-930.542) (-927.545) * (-927.532) (-929.242) (-926.951) [-927.981] -- 0:01:08
199000 -- (-928.827) [-927.776] (-931.139) (-937.027) * (-927.305) (-931.224) (-931.354) [-927.342] -- 0:01:08
199500 -- [-926.965] (-928.663) (-928.796) (-930.967) * (-927.404) (-929.888) (-932.334) [-926.669] -- 0:01:08
200000 -- (-928.056) (-928.209) [-928.328] (-927.642) * (-926.734) (-930.528) [-927.511] (-929.938) -- 0:01:08
Average standard deviation of split frequencies: 0.014961
200500 -- (-932.018) (-931.546) [-929.854] (-929.033) * (-927.793) (-926.404) [-929.306] (-929.894) -- 0:01:07
201000 -- (-930.510) [-929.888] (-927.573) (-928.552) * (-929.890) (-931.531) (-929.153) [-926.218] -- 0:01:07
201500 -- (-927.358) (-927.905) (-928.690) [-927.748] * (-926.336) (-929.418) (-926.302) [-926.517] -- 0:01:07
202000 -- (-930.106) (-927.670) [-926.220] (-931.044) * (-926.804) (-926.890) [-934.130] (-927.601) -- 0:01:07
202500 -- (-932.942) (-926.667) [-926.335] (-933.209) * (-926.699) (-927.473) (-926.638) [-930.055] -- 0:01:06
203000 -- (-926.102) [-926.830] (-927.045) (-929.061) * (-927.915) (-926.919) [-926.800] (-932.094) -- 0:01:06
203500 -- (-928.649) (-928.189) [-930.748] (-928.336) * (-928.641) (-927.626) [-927.228] (-926.730) -- 0:01:06
204000 -- (-928.978) [-927.458] (-929.985) (-928.031) * (-932.013) [-927.951] (-926.416) (-927.984) -- 0:01:06
204500 -- [-929.280] (-929.384) (-926.410) (-929.196) * (-929.959) (-929.797) (-926.064) [-926.420] -- 0:01:06
205000 -- [-929.377] (-929.641) (-927.889) (-929.201) * (-931.014) [-929.576] (-926.768) (-930.494) -- 0:01:05
Average standard deviation of split frequencies: 0.017544
205500 -- (-928.459) (-928.563) (-927.979) [-927.544] * (-931.042) (-930.866) [-925.932] (-931.777) -- 0:01:05
206000 -- (-928.338) [-926.745] (-929.506) (-926.824) * (-927.194) (-931.590) [-927.407] (-927.775) -- 0:01:05
206500 -- (-927.400) (-929.489) (-935.123) [-926.832] * (-927.119) (-932.123) (-927.269) [-927.365] -- 0:01:05
207000 -- (-927.887) [-927.797] (-927.102) (-926.686) * (-928.508) (-930.686) (-926.627) [-931.242] -- 0:01:08
207500 -- [-926.818] (-929.014) (-932.172) (-926.698) * (-930.209) (-928.409) [-926.196] (-928.521) -- 0:01:08
208000 -- [-926.808] (-927.232) (-926.482) (-928.658) * (-929.809) [-929.302] (-926.486) (-931.600) -- 0:01:08
208500 -- (-930.194) [-926.289] (-926.646) (-929.925) * (-928.530) (-928.025) [-927.994] (-929.958) -- 0:01:08
209000 -- [-928.117] (-927.683) (-926.897) (-932.813) * (-926.963) [-927.509] (-926.940) (-927.021) -- 0:01:08
209500 -- (-929.298) (-930.389) (-927.914) [-931.122] * (-927.237) [-928.508] (-929.208) (-931.610) -- 0:01:07
210000 -- (-928.483) (-931.005) [-926.470] (-932.220) * (-926.907) (-926.985) (-928.078) [-928.444] -- 0:01:07
Average standard deviation of split frequencies: 0.016135
210500 -- [-928.214] (-928.257) (-927.330) (-935.921) * (-927.477) [-926.789] (-927.055) (-929.388) -- 0:01:07
211000 -- (-927.598) (-927.340) (-927.923) [-930.899] * (-928.918) [-926.670] (-926.554) (-928.121) -- 0:01:07
211500 -- [-926.598] (-930.310) (-926.385) (-927.681) * (-930.099) [-931.444] (-928.431) (-928.044) -- 0:01:07
212000 -- (-928.261) (-929.743) [-926.425] (-928.944) * [-929.048] (-929.380) (-927.466) (-927.762) -- 0:01:06
212500 -- [-926.105] (-928.596) (-927.065) (-928.963) * (-928.629) (-931.205) (-927.808) [-929.337] -- 0:01:06
213000 -- (-926.920) [-928.892] (-927.053) (-929.043) * (-926.797) [-926.994] (-928.557) (-928.463) -- 0:01:06
213500 -- (-927.236) (-928.187) [-925.932] (-926.721) * (-929.045) (-925.882) [-930.049] (-926.776) -- 0:01:06
214000 -- (-932.448) (-932.794) (-927.796) [-930.318] * (-928.622) (-927.747) (-927.402) [-927.144] -- 0:01:06
214500 -- (-929.694) [-930.687] (-931.331) (-928.704) * [-929.454] (-927.250) (-931.011) (-926.706) -- 0:01:05
215000 -- (-926.434) (-928.289) (-928.449) [-926.902] * [-927.979] (-928.026) (-929.838) (-926.967) -- 0:01:05
Average standard deviation of split frequencies: 0.016196
215500 -- [-927.785] (-934.844) (-927.269) (-928.807) * (-929.876) (-927.650) (-928.986) [-926.553] -- 0:01:05
216000 -- [-928.074] (-930.151) (-927.716) (-928.743) * [-933.894] (-927.753) (-927.377) (-930.304) -- 0:01:05
216500 -- (-928.589) (-926.324) (-930.513) [-927.199] * (-927.995) (-930.381) [-928.178] (-930.481) -- 0:01:05
217000 -- (-930.052) (-926.227) (-928.310) [-927.632] * (-929.001) (-927.890) (-929.930) [-928.463] -- 0:01:04
217500 -- (-931.247) (-927.211) (-929.450) [-925.878] * (-929.040) (-928.287) [-927.305] (-931.880) -- 0:01:04
218000 -- (-930.625) (-926.403) (-928.212) [-925.959] * (-928.682) (-927.769) [-927.733] (-929.621) -- 0:01:04
218500 -- (-927.928) [-928.442] (-927.459) (-925.903) * (-930.711) [-928.662] (-927.443) (-927.663) -- 0:01:04
219000 -- (-929.587) [-926.970] (-931.322) (-926.943) * (-928.310) (-927.160) (-931.837) [-927.976] -- 0:01:07
219500 -- (-930.441) [-926.582] (-927.647) (-927.508) * (-926.316) (-927.870) (-930.083) [-927.519] -- 0:01:07
220000 -- (-931.487) (-929.464) (-927.680) [-927.816] * (-927.423) (-927.501) [-927.745] (-929.184) -- 0:01:07
Average standard deviation of split frequencies: 0.015073
220500 -- (-926.977) (-928.645) (-928.640) [-928.003] * (-927.112) [-926.710] (-926.731) (-931.315) -- 0:01:07
221000 -- (-929.183) (-927.316) [-926.975] (-928.342) * (-927.613) [-927.071] (-926.399) (-928.863) -- 0:01:06
221500 -- (-930.744) [-928.678] (-927.821) (-931.555) * (-927.796) [-926.613] (-925.883) (-929.247) -- 0:01:06
222000 -- (-930.320) (-929.896) (-927.286) [-927.706] * (-930.178) (-927.819) [-928.495] (-927.432) -- 0:01:06
222500 -- (-929.450) [-928.687] (-926.967) (-927.185) * (-930.571) (-929.317) [-927.477] (-928.354) -- 0:01:06
223000 -- (-927.237) [-926.971] (-930.306) (-927.073) * [-928.603] (-927.696) (-927.695) (-929.736) -- 0:01:06
223500 -- (-926.823) (-926.606) [-931.291] (-929.422) * (-929.015) (-927.993) (-929.335) [-928.259] -- 0:01:06
224000 -- [-927.025] (-930.007) (-927.866) (-927.318) * [-929.439] (-926.262) (-927.844) (-928.590) -- 0:01:05
224500 -- (-927.105) (-929.274) [-927.258] (-928.860) * [-928.745] (-926.657) (-929.003) (-925.840) -- 0:01:05
225000 -- (-926.078) (-928.031) (-938.958) [-928.170] * (-927.070) (-926.112) (-928.210) [-927.143] -- 0:01:05
Average standard deviation of split frequencies: 0.014711
225500 -- (-926.317) [-927.223] (-929.872) (-929.331) * (-926.828) [-926.597] (-931.900) (-929.782) -- 0:01:05
226000 -- (-926.413) (-929.036) (-927.556) [-929.820] * [-926.511] (-931.346) (-927.675) (-929.103) -- 0:01:05
226500 -- (-926.302) (-927.995) (-927.999) [-930.354] * (-927.344) (-930.270) [-927.191] (-926.031) -- 0:01:04
227000 -- (-931.441) [-933.124] (-931.659) (-928.608) * (-930.078) (-930.551) (-926.938) [-925.806] -- 0:01:04
227500 -- (-929.814) (-931.387) (-931.535) [-928.232] * (-927.152) (-927.860) (-929.305) [-927.834] -- 0:01:04
228000 -- (-928.675) (-926.778) [-927.175] (-928.514) * [-929.415] (-927.854) (-927.347) (-926.531) -- 0:01:04
228500 -- [-927.992] (-928.561) (-928.514) (-930.909) * (-928.977) [-926.509] (-929.079) (-928.906) -- 0:01:04
229000 -- [-928.499] (-933.503) (-933.962) (-929.848) * [-926.665] (-927.125) (-926.412) (-929.154) -- 0:01:03
229500 -- (-928.596) (-929.691) (-930.693) [-928.361] * (-927.838) [-926.809] (-931.383) (-926.423) -- 0:01:03
230000 -- (-927.220) (-928.419) (-930.431) [-928.303] * (-927.356) (-927.792) (-926.784) [-926.473] -- 0:01:03
Average standard deviation of split frequencies: 0.016457
230500 -- (-926.492) [-927.516] (-928.556) (-933.252) * (-927.239) [-928.842] (-929.352) (-926.912) -- 0:01:03
231000 -- (-928.197) [-929.238] (-927.402) (-928.275) * (-928.481) (-928.323) [-930.093] (-926.461) -- 0:01:06
231500 -- (-927.727) [-928.464] (-925.980) (-929.482) * [-928.732] (-927.944) (-930.506) (-927.130) -- 0:01:06
232000 -- (-929.584) (-929.039) [-927.382] (-929.975) * [-928.843] (-926.669) (-926.953) (-927.160) -- 0:01:06
232500 -- (-929.689) [-928.202] (-926.558) (-929.806) * [-929.974] (-927.913) (-927.149) (-928.138) -- 0:01:06
233000 -- (-926.016) (-927.524) (-926.050) [-930.375] * (-929.338) (-932.961) (-927.228) [-927.993] -- 0:01:05
233500 -- (-927.266) (-926.042) (-926.740) [-928.753] * (-930.134) [-927.716] (-931.056) (-930.370) -- 0:01:05
234000 -- (-927.418) (-926.658) (-928.686) [-926.447] * (-927.180) (-926.123) [-930.167] (-932.007) -- 0:01:05
234500 -- (-927.418) (-927.754) (-928.882) [-927.354] * (-928.825) (-926.308) (-927.233) [-926.184] -- 0:01:05
235000 -- (-926.378) [-927.825] (-927.465) (-928.062) * [-926.576] (-930.193) (-931.080) (-926.359) -- 0:01:05
Average standard deviation of split frequencies: 0.015559
235500 -- [-928.899] (-927.853) (-928.100) (-930.923) * [-926.468] (-928.640) (-929.186) (-926.340) -- 0:01:04
236000 -- (-928.059) (-929.231) [-927.093] (-929.796) * (-931.035) (-929.443) [-928.377] (-926.349) -- 0:01:04
236500 -- [-931.736] (-927.638) (-931.487) (-932.651) * (-928.468) (-927.818) (-927.360) [-926.891] -- 0:01:04
237000 -- (-928.718) (-926.678) [-931.308] (-929.743) * (-927.842) (-926.815) [-927.306] (-926.635) -- 0:01:04
237500 -- (-926.425) [-927.883] (-927.993) (-926.768) * (-926.585) (-927.016) (-927.582) [-925.995] -- 0:01:04
238000 -- [-928.118] (-927.158) (-929.753) (-929.574) * (-926.391) [-926.989] (-928.303) (-929.919) -- 0:01:04
238500 -- (-927.135) [-929.807] (-927.426) (-928.693) * (-927.473) [-927.806] (-930.077) (-926.914) -- 0:01:03
239000 -- (-927.565) (-927.951) (-927.140) [-928.229] * (-929.188) (-928.126) [-928.869] (-928.806) -- 0:01:03
239500 -- (-925.966) (-926.301) (-929.194) [-927.811] * (-927.908) (-931.068) (-930.503) [-926.767] -- 0:01:03
240000 -- (-928.721) [-927.059] (-929.947) (-927.085) * (-931.369) (-927.641) [-928.002] (-926.469) -- 0:01:03
Average standard deviation of split frequencies: 0.015876
240500 -- [-926.454] (-927.989) (-926.308) (-928.010) * (-929.273) (-926.578) (-929.503) [-936.684] -- 0:01:03
241000 -- (-930.658) (-927.658) (-925.980) [-927.882] * [-928.090] (-928.850) (-928.918) (-933.231) -- 0:01:02
241500 -- (-928.514) [-928.281] (-927.039) (-927.651) * (-927.028) (-927.075) (-927.377) [-926.128] -- 0:01:02
242000 -- (-928.181) (-929.706) (-928.858) [-927.704] * (-928.151) (-930.328) (-930.207) [-926.362] -- 0:01:02
242500 -- [-930.061] (-927.033) (-930.232) (-927.851) * (-927.122) (-926.558) [-926.484] (-929.615) -- 0:01:02
243000 -- [-927.226] (-927.585) (-928.094) (-929.689) * (-930.109) [-930.207] (-927.344) (-931.396) -- 0:01:05
243500 -- [-930.636] (-929.167) (-926.838) (-931.760) * (-929.125) (-930.106) [-927.807] (-930.565) -- 0:01:05
244000 -- [-930.222] (-926.212) (-926.219) (-933.165) * [-927.322] (-928.795) (-927.406) (-927.411) -- 0:01:05
244500 -- (-927.648) [-926.594] (-927.562) (-931.751) * [-926.084] (-933.026) (-927.869) (-931.762) -- 0:01:04
245000 -- [-926.774] (-927.774) (-926.884) (-927.945) * (-927.677) (-927.021) (-928.957) [-927.645] -- 0:01:04
Average standard deviation of split frequencies: 0.016541
245500 -- (-928.181) [-933.995] (-925.755) (-929.604) * (-928.932) [-927.966] (-927.763) (-928.869) -- 0:01:04
246000 -- (-927.891) [-928.333] (-927.286) (-926.438) * (-927.150) (-928.967) [-927.520] (-927.678) -- 0:01:04
246500 -- (-927.831) (-929.854) (-928.735) [-926.860] * (-927.410) [-929.339] (-928.339) (-929.601) -- 0:01:04
247000 -- (-927.982) [-929.332] (-929.731) (-928.889) * (-926.747) (-927.010) (-928.975) [-929.715] -- 0:01:04
247500 -- (-932.065) (-927.557) [-926.968] (-929.207) * (-928.220) [-928.459] (-928.895) (-929.229) -- 0:01:03
248000 -- (-931.248) [-928.152] (-927.435) (-926.789) * [-926.795] (-927.030) (-930.267) (-925.896) -- 0:01:03
248500 -- (-931.310) (-929.762) (-929.147) [-927.551] * (-926.868) (-928.516) [-926.628] (-925.898) -- 0:01:03
249000 -- (-934.076) [-929.584] (-927.890) (-926.050) * (-926.801) [-926.111] (-928.244) (-926.668) -- 0:01:03
249500 -- (-926.612) (-927.334) (-928.017) [-926.375] * [-928.170] (-929.282) (-927.729) (-926.557) -- 0:01:03
250000 -- [-926.696] (-928.369) (-933.472) (-930.519) * (-930.329) (-927.544) (-929.083) [-925.675] -- 0:01:03
Average standard deviation of split frequencies: 0.016431
250500 -- (-926.507) (-928.848) (-928.810) [-930.898] * [-928.618] (-928.908) (-928.075) (-926.161) -- 0:01:02
251000 -- (-930.122) (-928.009) [-926.272] (-930.359) * (-926.746) (-931.386) (-926.924) [-927.272] -- 0:01:02
251500 -- (-928.917) [-927.645] (-934.175) (-925.996) * [-926.070] (-926.562) (-928.057) (-926.842) -- 0:01:02
252000 -- (-928.636) (-927.518) (-927.107) [-926.306] * [-927.243] (-928.593) (-928.479) (-926.864) -- 0:01:02
252500 -- (-928.418) [-931.870] (-932.474) (-928.559) * (-927.045) (-937.490) (-928.233) [-928.480] -- 0:01:02
253000 -- (-928.150) (-926.917) (-927.182) [-928.931] * (-928.174) (-932.025) (-928.538) [-929.590] -- 0:01:02
253500 -- [-934.302] (-928.321) (-928.215) (-929.905) * [-926.971] (-930.993) (-926.620) (-927.987) -- 0:01:01
254000 -- (-930.533) (-929.085) [-926.235] (-931.588) * (-937.856) [-930.331] (-929.624) (-928.199) -- 0:01:01
254500 -- (-929.469) (-932.817) (-929.882) [-927.776] * [-926.646] (-934.578) (-930.638) (-934.730) -- 0:01:01
255000 -- (-931.332) [-928.272] (-927.339) (-930.360) * (-928.488) [-931.335] (-931.210) (-930.309) -- 0:01:04
Average standard deviation of split frequencies: 0.016282
255500 -- [-926.556] (-925.925) (-928.679) (-932.586) * (-930.891) [-928.307] (-929.265) (-927.657) -- 0:01:04
256000 -- (-926.500) [-925.948] (-928.014) (-930.399) * (-926.347) (-929.055) [-927.461] (-930.616) -- 0:01:03
256500 -- (-927.657) [-927.263] (-926.430) (-932.460) * [-926.190] (-927.479) (-927.852) (-928.070) -- 0:01:03
257000 -- [-926.944] (-927.339) (-926.813) (-929.501) * (-926.514) [-930.385] (-926.415) (-926.110) -- 0:01:03
257500 -- (-932.020) (-928.593) (-928.002) [-929.621] * (-932.131) [-925.837] (-929.290) (-927.910) -- 0:01:03
258000 -- [-927.222] (-927.770) (-927.310) (-928.207) * [-928.482] (-927.379) (-929.600) (-929.286) -- 0:01:03
258500 -- (-929.664) (-929.516) (-926.905) [-927.713] * (-927.908) (-925.874) [-926.159] (-928.090) -- 0:01:03
259000 -- (-928.010) (-928.119) [-927.137] (-928.163) * (-926.185) [-928.161] (-926.545) (-926.946) -- 0:01:02
259500 -- (-927.470) (-926.225) [-926.274] (-931.575) * (-926.058) (-926.810) [-935.892] (-934.019) -- 0:01:02
260000 -- (-926.343) [-929.286] (-927.588) (-931.327) * (-928.532) (-932.956) (-927.791) [-926.521] -- 0:01:02
Average standard deviation of split frequencies: 0.015800
260500 -- [-926.851] (-927.682) (-929.302) (-929.606) * (-926.866) [-929.729] (-927.428) (-926.891) -- 0:01:02
261000 -- (-927.757) [-926.905] (-929.932) (-927.837) * (-929.779) [-927.220] (-927.245) (-926.860) -- 0:01:02
261500 -- (-928.746) (-926.905) (-929.372) [-927.825] * (-928.626) (-927.931) (-927.124) [-926.138] -- 0:01:02
262000 -- (-928.297) (-931.534) [-929.513] (-931.685) * [-927.147] (-930.981) (-927.016) (-926.904) -- 0:01:01
262500 -- (-932.153) [-929.241] (-927.824) (-932.684) * [-929.027] (-926.950) (-926.082) (-927.373) -- 0:01:01
263000 -- (-931.426) [-927.546] (-929.174) (-931.564) * (-927.734) [-931.732] (-929.148) (-926.698) -- 0:01:01
263500 -- (-929.352) [-927.836] (-929.428) (-934.610) * (-927.633) (-928.800) [-928.680] (-926.038) -- 0:01:01
264000 -- (-931.569) [-929.552] (-930.135) (-928.620) * (-927.150) (-931.303) (-931.103) [-927.050] -- 0:01:01
264500 -- (-931.774) [-928.809] (-928.793) (-926.827) * (-929.236) (-928.982) (-929.604) [-926.300] -- 0:01:01
265000 -- [-926.556] (-926.814) (-927.433) (-927.172) * (-933.769) [-926.269] (-927.586) (-926.370) -- 0:01:01
Average standard deviation of split frequencies: 0.015950
265500 -- [-925.866] (-928.865) (-928.503) (-930.545) * [-928.943] (-928.997) (-932.982) (-928.646) -- 0:01:00
266000 -- (-926.611) (-928.220) [-927.445] (-927.309) * [-927.660] (-931.523) (-928.746) (-926.405) -- 0:01:00
266500 -- (-926.708) (-928.782) (-927.482) [-929.410] * (-926.853) (-937.370) (-927.648) [-927.646] -- 0:01:00
267000 -- [-928.303] (-928.346) (-927.164) (-929.290) * (-927.894) (-926.759) (-927.527) [-926.156] -- 0:01:03
267500 -- (-927.723) (-927.778) [-927.664] (-927.860) * (-927.696) (-926.935) [-927.819] (-932.565) -- 0:01:02
268000 -- (-928.677) (-926.926) (-926.867) [-927.886] * (-927.630) [-929.770] (-927.139) (-936.515) -- 0:01:02
268500 -- (-927.909) [-925.759] (-926.562) (-931.624) * (-929.000) (-932.887) (-929.903) [-932.583] -- 0:01:02
269000 -- (-928.028) (-925.875) [-928.247] (-931.042) * (-927.702) (-928.752) [-929.703] (-934.007) -- 0:01:02
269500 -- (-933.702) [-926.377] (-926.392) (-929.471) * (-926.470) (-927.029) [-927.406] (-931.263) -- 0:01:02
270000 -- [-927.144] (-926.788) (-926.301) (-926.652) * [-925.968] (-926.301) (-927.555) (-932.268) -- 0:01:02
Average standard deviation of split frequencies: 0.015491
270500 -- (-926.870) [-926.279] (-927.152) (-926.337) * [-928.360] (-928.595) (-927.476) (-932.001) -- 0:01:02
271000 -- (-935.072) [-928.052] (-928.279) (-932.435) * (-926.324) [-928.599] (-929.752) (-927.485) -- 0:01:01
271500 -- (-926.940) [-926.856] (-930.164) (-926.563) * (-932.715) (-928.133) [-927.973] (-927.072) -- 0:01:01
272000 -- (-928.431) [-926.817] (-926.732) (-928.934) * (-931.201) [-927.182] (-926.540) (-926.745) -- 0:01:01
272500 -- (-929.902) [-928.220] (-927.746) (-929.440) * (-932.866) (-927.216) [-926.444] (-929.181) -- 0:01:01
273000 -- (-930.936) (-927.955) (-935.408) [-927.018] * [-930.223] (-928.218) (-928.756) (-929.560) -- 0:01:01
273500 -- (-929.310) [-927.701] (-930.231) (-927.660) * (-926.481) [-932.044] (-928.937) (-927.026) -- 0:01:01
274000 -- (-927.064) [-926.495] (-927.952) (-930.903) * (-925.735) (-928.854) (-926.941) [-926.216] -- 0:01:00
274500 -- (-926.489) (-925.906) [-926.029] (-933.002) * (-925.735) (-927.009) [-926.763] (-928.907) -- 0:01:00
275000 -- (-929.664) [-928.374] (-928.473) (-928.799) * [-928.196] (-927.911) (-931.275) (-927.774) -- 0:01:00
Average standard deviation of split frequencies: 0.015182
275500 -- (-927.477) (-926.657) [-927.061] (-928.625) * (-928.559) [-927.981] (-926.976) (-927.123) -- 0:01:00
276000 -- (-926.954) (-926.897) (-927.664) [-927.587] * (-926.696) (-927.068) (-932.238) [-927.347] -- 0:01:00
276500 -- (-927.186) (-926.194) (-926.479) [-929.477] * (-931.556) (-932.201) (-927.687) [-927.830] -- 0:01:00
277000 -- (-927.541) (-929.617) (-927.489) [-931.274] * (-928.223) [-930.186] (-927.685) (-930.315) -- 0:01:00
277500 -- (-926.455) (-928.458) [-927.996] (-926.621) * [-927.642] (-927.031) (-930.360) (-929.606) -- 0:00:59
278000 -- [-927.772] (-927.859) (-926.689) (-927.216) * (-928.166) [-926.255] (-929.468) (-928.464) -- 0:00:59
278500 -- [-929.821] (-929.077) (-926.789) (-927.416) * (-929.046) (-925.811) (-929.040) [-926.117] -- 0:00:59
279000 -- (-929.670) (-927.067) [-926.281] (-928.536) * (-927.290) [-927.825] (-925.947) (-926.491) -- 0:01:02
279500 -- (-929.446) (-927.507) [-927.227] (-928.301) * (-926.241) (-929.955) (-926.846) [-927.988] -- 0:01:01
280000 -- (-927.102) (-927.116) [-928.929] (-929.683) * (-926.970) (-928.714) [-928.959] (-929.584) -- 0:01:01
Average standard deviation of split frequencies: 0.015470
280500 -- [-931.061] (-927.061) (-926.514) (-929.529) * [-927.938] (-930.644) (-926.636) (-927.510) -- 0:01:01
281000 -- (-933.269) (-930.984) [-927.617] (-927.669) * [-926.998] (-928.553) (-926.958) (-926.876) -- 0:01:01
281500 -- [-931.312] (-933.150) (-925.894) (-927.073) * (-927.484) [-926.904] (-928.317) (-928.400) -- 0:01:01
282000 -- (-928.243) (-929.897) [-925.858] (-926.565) * (-928.000) (-925.967) [-928.010] (-926.875) -- 0:01:01
282500 -- (-928.275) (-927.080) [-926.924] (-927.297) * (-929.655) [-927.143] (-929.327) (-926.891) -- 0:01:00
283000 -- (-927.945) (-927.920) (-926.926) [-927.849] * (-929.492) (-928.010) [-929.315] (-926.556) -- 0:01:00
283500 -- (-929.633) [-926.255] (-929.523) (-933.537) * (-934.022) (-927.093) [-928.425] (-930.913) -- 0:01:00
284000 -- (-928.075) (-927.513) [-926.998] (-927.789) * (-927.713) [-928.463] (-931.098) (-929.220) -- 0:01:00
284500 -- (-930.337) [-929.050] (-927.863) (-927.278) * (-927.873) [-929.071] (-933.262) (-927.028) -- 0:01:00
285000 -- (-928.354) (-927.187) (-927.423) [-929.232] * (-927.904) (-927.660) [-929.079] (-927.337) -- 0:01:00
Average standard deviation of split frequencies: 0.013707
285500 -- (-934.074) [-928.263] (-929.395) (-928.171) * (-926.867) (-931.006) [-929.545] (-926.891) -- 0:01:00
286000 -- (-929.706) [-927.403] (-931.558) (-928.790) * (-929.992) (-929.790) (-930.358) [-929.546] -- 0:00:59
286500 -- [-928.528] (-927.761) (-927.102) (-929.309) * [-927.329] (-930.247) (-931.345) (-927.924) -- 0:00:59
287000 -- (-926.373) (-929.810) (-929.446) [-927.437] * (-934.262) (-928.665) (-935.538) [-930.038] -- 0:00:59
287500 -- (-926.601) (-928.999) [-930.256] (-927.392) * (-927.504) [-926.852] (-932.116) (-929.594) -- 0:00:59
288000 -- (-927.060) [-928.322] (-929.245) (-930.074) * [-927.073] (-930.610) (-926.992) (-932.509) -- 0:00:59
288500 -- (-928.992) [-931.791] (-927.233) (-928.271) * (-927.413) [-931.094] (-928.031) (-932.510) -- 0:00:59
289000 -- [-930.124] (-929.234) (-927.885) (-928.649) * (-927.911) (-932.384) (-931.478) [-927.948] -- 0:00:59
289500 -- (-934.812) (-927.264) (-929.126) [-930.082] * (-929.065) [-932.054] (-928.975) (-928.195) -- 0:00:58
290000 -- (-930.857) [-930.848] (-927.581) (-928.296) * [-927.983] (-929.182) (-929.671) (-927.476) -- 0:00:58
Average standard deviation of split frequencies: 0.014236
290500 -- (-933.198) (-927.096) (-930.172) [-926.349] * (-927.200) [-928.014] (-928.000) (-928.305) -- 0:00:58
291000 -- [-929.259] (-926.768) (-927.751) (-926.027) * (-928.759) (-926.747) (-926.470) [-927.987] -- 0:01:00
291500 -- (-927.980) (-930.133) (-926.335) [-926.799] * [-926.196] (-927.337) (-928.272) (-927.947) -- 0:01:00
292000 -- (-927.830) (-932.484) (-928.058) [-927.036] * (-926.605) [-926.051] (-926.572) (-928.434) -- 0:01:00
292500 -- (-926.653) (-929.602) (-926.197) [-934.708] * (-927.159) (-927.165) [-927.692] (-927.552) -- 0:01:00
293000 -- [-927.253] (-927.959) (-927.124) (-926.974) * (-928.698) (-927.968) [-926.205] (-935.142) -- 0:01:00
293500 -- (-928.824) (-927.551) [-927.397] (-928.581) * (-935.046) [-929.148] (-925.815) (-928.362) -- 0:01:00
294000 -- (-927.129) (-928.983) [-930.726] (-925.993) * (-928.893) [-929.253] (-925.864) (-928.042) -- 0:01:00
294500 -- [-927.381] (-926.795) (-931.728) (-926.299) * (-929.482) [-930.557] (-926.319) (-928.534) -- 0:00:59
295000 -- (-926.143) [-927.004] (-928.978) (-926.942) * (-930.801) (-929.413) (-928.584) [-929.722] -- 0:00:59
Average standard deviation of split frequencies: 0.013006
295500 -- (-927.210) (-927.282) (-927.401) [-928.140] * [-926.009] (-927.097) (-928.806) (-929.425) -- 0:00:59
296000 -- (-928.707) [-927.497] (-929.681) (-930.357) * (-926.651) (-928.195) [-929.311] (-929.202) -- 0:00:59
296500 -- [-926.273] (-928.364) (-927.348) (-930.772) * [-927.007] (-925.989) (-927.175) (-930.840) -- 0:00:59
297000 -- (-928.877) [-928.421] (-927.134) (-929.852) * (-927.198) [-926.810] (-927.414) (-929.440) -- 0:00:59
297500 -- (-926.966) [-931.843] (-927.361) (-926.643) * (-927.733) (-928.637) (-928.100) [-929.629] -- 0:00:59
298000 -- (-928.600) [-926.085] (-927.698) (-927.790) * (-930.769) [-926.834] (-928.641) (-928.542) -- 0:00:58
298500 -- [-929.633] (-927.567) (-927.837) (-929.108) * (-927.233) (-929.100) [-929.387] (-927.456) -- 0:00:58
299000 -- (-927.552) (-926.808) [-928.404] (-927.428) * (-929.618) (-926.011) (-929.355) [-928.937] -- 0:00:58
299500 -- (-928.278) (-927.509) (-928.410) [-927.807] * (-929.650) (-927.962) [-927.343] (-929.066) -- 0:00:58
300000 -- [-929.203] (-929.358) (-928.675) (-928.658) * (-926.749) (-927.154) (-926.494) [-929.994] -- 0:00:58
Average standard deviation of split frequencies: 0.012891
300500 -- (-927.892) (-928.764) [-928.093] (-927.933) * [-931.430] (-927.420) (-927.900) (-929.434) -- 0:00:58
301000 -- (-926.201) [-929.188] (-928.602) (-928.748) * [-931.012] (-926.588) (-928.260) (-928.522) -- 0:00:58
301500 -- (-926.240) (-928.600) (-927.978) [-928.534] * (-927.387) (-929.086) (-927.669) [-926.547] -- 0:00:57
302000 -- (-930.066) (-927.779) [-928.184] (-926.893) * (-929.188) (-926.744) [-929.685] (-929.802) -- 0:00:57
302500 -- (-927.670) [-927.610] (-927.969) (-926.804) * [-928.382] (-927.996) (-929.799) (-929.876) -- 0:00:57
303000 -- (-929.323) (-928.519) (-928.056) [-930.454] * (-926.175) (-929.067) (-929.602) [-927.493] -- 0:00:59
303500 -- (-927.680) (-929.542) (-927.409) [-927.303] * [-926.208] (-926.927) (-926.039) (-928.984) -- 0:00:59
304000 -- [-927.994] (-933.254) (-927.796) (-926.797) * (-926.216) [-928.912] (-926.426) (-929.986) -- 0:00:59
304500 -- [-930.943] (-927.456) (-928.233) (-928.397) * (-925.874) [-926.268] (-928.514) (-927.738) -- 0:00:59
305000 -- (-927.983) (-929.624) (-928.096) [-926.435] * (-926.370) [-927.581] (-930.635) (-927.643) -- 0:00:59
Average standard deviation of split frequencies: 0.012581
305500 -- (-925.925) (-928.156) [-926.766] (-926.763) * (-928.349) (-929.031) [-929.627] (-928.065) -- 0:00:59
306000 -- (-928.720) (-926.806) (-928.916) [-926.281] * (-927.143) [-928.217] (-933.582) (-935.087) -- 0:00:58
306500 -- (-929.819) (-932.343) (-927.684) [-932.111] * (-927.334) [-926.543] (-931.310) (-927.945) -- 0:00:58
307000 -- (-927.295) (-931.929) [-927.582] (-927.712) * (-928.848) (-928.986) (-933.630) [-928.207] -- 0:00:58
307500 -- [-926.451] (-932.664) (-927.323) (-929.186) * (-927.412) (-927.691) [-930.014] (-927.715) -- 0:00:58
308000 -- (-927.306) (-931.152) (-931.512) [-928.853] * (-926.560) (-929.999) [-927.363] (-929.674) -- 0:00:58
308500 -- (-926.924) [-933.635] (-930.365) (-929.737) * [-927.510] (-932.331) (-929.595) (-928.438) -- 0:00:58
309000 -- [-926.637] (-930.347) (-927.234) (-929.365) * (-930.271) (-928.195) [-929.013] (-927.049) -- 0:00:58
309500 -- (-929.102) [-929.543] (-926.896) (-930.110) * (-927.077) (-928.195) [-929.699] (-929.331) -- 0:00:58
310000 -- (-930.124) (-927.433) [-927.327] (-929.373) * (-927.708) [-927.264] (-929.414) (-926.866) -- 0:00:57
Average standard deviation of split frequencies: 0.012308
310500 -- (-926.728) (-927.231) (-928.699) [-929.344] * (-931.040) (-927.561) [-929.199] (-929.270) -- 0:00:57
311000 -- (-928.879) (-928.393) (-930.711) [-925.847] * [-928.319] (-929.108) (-927.441) (-928.034) -- 0:00:57
311500 -- [-929.263] (-926.528) (-926.689) (-926.958) * [-927.041] (-928.679) (-929.263) (-928.996) -- 0:00:57
312000 -- (-927.225) [-926.584] (-927.012) (-926.527) * (-928.629) [-927.659] (-930.270) (-929.811) -- 0:00:57
312500 -- (-927.180) [-927.628] (-927.618) (-929.615) * [-927.085] (-929.103) (-928.953) (-929.061) -- 0:00:57
313000 -- (-926.920) [-928.629] (-926.605) (-930.085) * [-927.855] (-927.966) (-929.759) (-928.453) -- 0:00:57
313500 -- [-930.440] (-928.954) (-927.432) (-927.823) * (-928.255) [-925.792] (-932.967) (-926.653) -- 0:00:56
314000 -- [-927.702] (-929.542) (-928.507) (-928.125) * [-929.576] (-927.815) (-927.981) (-926.280) -- 0:00:58
314500 -- (-931.071) (-926.775) [-928.950] (-927.950) * (-926.898) (-928.018) (-928.446) [-925.835] -- 0:00:58
315000 -- [-927.436] (-928.951) (-927.127) (-929.589) * (-927.938) (-926.085) [-927.199] (-933.420) -- 0:00:58
Average standard deviation of split frequencies: 0.012248
315500 -- (-925.980) (-928.378) [-927.752] (-927.494) * (-926.750) [-927.753] (-928.485) (-928.153) -- 0:00:58
316000 -- (-926.259) (-927.469) [-928.281] (-927.496) * (-927.579) [-926.683] (-928.207) (-930.310) -- 0:00:58
316500 -- (-926.422) [-927.466] (-927.834) (-928.182) * (-930.459) (-926.224) (-932.070) [-930.199] -- 0:00:58
317000 -- (-929.505) (-927.741) (-929.904) [-929.205] * (-930.111) [-925.804] (-927.653) (-928.171) -- 0:00:58
317500 -- (-928.028) (-929.735) [-930.081] (-927.366) * (-926.648) (-927.878) [-931.303] (-926.494) -- 0:00:58
318000 -- (-926.479) (-927.677) [-926.393] (-927.794) * (-927.642) [-927.635] (-929.192) (-929.471) -- 0:00:57
318500 -- [-927.100] (-930.021) (-929.750) (-927.602) * [-927.493] (-928.252) (-927.541) (-927.564) -- 0:00:57
319000 -- (-928.846) [-928.923] (-929.865) (-925.964) * (-927.517) (-926.961) (-929.777) [-928.596] -- 0:00:57
319500 -- (-927.822) (-926.565) [-926.823] (-930.222) * (-932.069) (-926.572) [-929.208] (-929.007) -- 0:00:57
320000 -- (-927.104) (-931.601) (-926.717) [-928.008] * (-927.781) (-926.299) (-929.310) [-928.244] -- 0:00:57
Average standard deviation of split frequencies: 0.011842
320500 -- [-926.735] (-931.074) (-927.682) (-926.845) * (-929.086) [-930.903] (-930.542) (-929.066) -- 0:00:57
321000 -- [-929.261] (-928.355) (-927.565) (-928.219) * (-926.591) (-927.423) [-927.029] (-928.345) -- 0:00:57
321500 -- [-927.155] (-928.337) (-926.064) (-928.833) * (-927.517) [-929.902] (-927.571) (-929.055) -- 0:00:56
322000 -- (-928.964) (-926.773) [-927.999] (-927.752) * [-929.814] (-928.594) (-931.096) (-930.134) -- 0:00:56
322500 -- [-927.298] (-929.452) (-926.511) (-927.900) * (-928.490) [-926.411] (-931.199) (-926.946) -- 0:00:56
323000 -- (-927.224) [-927.689] (-926.327) (-927.009) * (-926.448) (-927.503) [-929.432] (-927.605) -- 0:00:56
323500 -- (-927.267) (-928.176) (-929.657) [-928.136] * [-928.203] (-926.830) (-932.406) (-928.863) -- 0:00:56
324000 -- (-928.521) (-927.141) [-926.089] (-931.018) * (-927.605) [-927.697] (-930.124) (-927.822) -- 0:00:56
324500 -- (-931.503) (-929.515) (-926.678) [-927.930] * [-928.015] (-929.351) (-930.105) (-926.960) -- 0:00:56
325000 -- (-930.651) (-930.583) [-925.718] (-926.961) * (-928.649) [-926.039] (-928.873) (-927.357) -- 0:00:56
Average standard deviation of split frequencies: 0.012634
325500 -- (-927.507) (-930.914) (-929.822) [-927.347] * (-926.914) [-927.678] (-929.312) (-931.006) -- 0:00:58
326000 -- [-927.627] (-928.286) (-927.781) (-929.820) * (-927.976) (-928.426) [-925.912] (-927.502) -- 0:00:57
326500 -- (-926.795) [-928.968] (-927.755) (-928.674) * [-926.706] (-926.659) (-935.646) (-928.371) -- 0:00:57
327000 -- [-927.871] (-926.423) (-930.290) (-926.535) * (-930.339) (-926.041) (-934.502) [-927.792] -- 0:00:57
327500 -- (-928.635) [-927.275] (-928.906) (-928.721) * (-928.438) (-926.524) [-927.470] (-927.736) -- 0:00:57
328000 -- (-929.574) (-927.101) [-926.867] (-930.021) * (-927.510) (-928.868) [-927.528] (-927.663) -- 0:00:57
328500 -- (-928.115) (-928.740) (-929.556) [-927.416] * [-927.858] (-926.507) (-927.920) (-928.020) -- 0:00:57
329000 -- [-925.965] (-928.280) (-930.027) (-926.426) * (-926.680) (-928.337) [-929.602] (-930.407) -- 0:00:57
329500 -- [-927.357] (-931.125) (-931.020) (-927.526) * (-926.426) (-929.464) (-927.218) [-928.678] -- 0:00:56
330000 -- (-927.706) (-928.861) (-937.676) [-926.321] * [-927.319] (-928.921) (-930.446) (-929.935) -- 0:00:56
Average standard deviation of split frequencies: 0.012080
330500 -- [-925.749] (-928.410) (-933.241) (-927.710) * [-926.734] (-928.996) (-927.442) (-928.970) -- 0:00:56
331000 -- (-927.340) (-927.366) (-930.182) [-927.340] * (-930.498) [-927.802] (-926.936) (-928.594) -- 0:00:56
331500 -- [-927.572] (-930.087) (-928.617) (-930.230) * [-926.940] (-927.779) (-926.865) (-927.417) -- 0:00:56
332000 -- (-927.207) [-926.821] (-927.734) (-932.410) * [-927.567] (-930.500) (-926.903) (-926.834) -- 0:00:56
332500 -- [-926.339] (-928.196) (-929.173) (-934.829) * (-927.611) (-930.980) [-927.596] (-927.070) -- 0:00:56
333000 -- [-928.965] (-930.345) (-928.389) (-928.577) * (-927.934) (-930.848) [-927.581] (-928.466) -- 0:00:56
333500 -- (-928.290) [-927.622] (-927.275) (-927.643) * (-926.958) (-928.144) (-929.848) [-926.661] -- 0:00:55
334000 -- [-931.035] (-928.213) (-929.548) (-926.778) * (-927.677) [-929.185] (-927.007) (-931.178) -- 0:00:55
334500 -- (-926.192) (-927.968) (-928.520) [-927.374] * (-926.939) (-929.286) (-928.958) [-927.223] -- 0:00:55
335000 -- (-925.989) (-927.986) [-930.661] (-927.620) * [-929.245] (-926.917) (-929.080) (-927.588) -- 0:00:55
Average standard deviation of split frequencies: 0.011458
335500 -- (-926.678) (-933.215) [-928.184] (-925.826) * (-927.471) [-929.492] (-928.997) (-930.139) -- 0:00:55
336000 -- (-925.855) (-927.102) [-930.122] (-925.959) * (-928.513) (-927.986) [-927.548] (-929.083) -- 0:00:55
336500 -- (-926.593) (-929.404) (-927.118) [-928.146] * (-927.388) [-928.250] (-931.809) (-927.324) -- 0:00:55
337000 -- (-927.560) [-927.686] (-926.346) (-928.625) * (-930.197) (-928.628) (-927.965) [-928.585] -- 0:00:57
337500 -- (-928.231) [-928.324] (-926.672) (-930.555) * (-926.380) [-928.175] (-929.692) (-928.030) -- 0:00:56
338000 -- [-927.665] (-927.517) (-928.387) (-931.451) * (-927.203) (-929.904) (-926.015) [-929.193] -- 0:00:56
338500 -- (-925.985) (-927.709) [-926.499] (-926.536) * (-935.282) (-926.863) (-932.480) [-928.423] -- 0:00:56
339000 -- [-926.799] (-927.356) (-931.666) (-927.557) * (-928.965) [-929.486] (-931.196) (-931.778) -- 0:00:56
339500 -- [-929.469] (-926.074) (-930.534) (-927.731) * (-934.102) (-930.936) (-927.946) [-925.991] -- 0:00:56
340000 -- (-931.878) (-927.778) [-928.782] (-928.924) * (-929.376) [-935.001] (-926.363) (-927.428) -- 0:00:56
Average standard deviation of split frequencies: 0.010071
340500 -- (-927.452) (-928.291) [-927.002] (-927.601) * [-927.177] (-932.385) (-929.164) (-927.391) -- 0:00:56
341000 -- [-926.409] (-927.113) (-926.573) (-928.528) * [-929.653] (-930.903) (-929.079) (-927.599) -- 0:00:56
341500 -- (-930.801) (-927.137) (-930.478) [-927.358] * (-927.702) (-929.040) [-928.808] (-927.745) -- 0:00:55
342000 -- (-926.356) (-931.519) [-929.819] (-929.484) * (-928.573) (-928.011) [-927.502] (-927.814) -- 0:00:55
342500 -- (-927.625) (-930.461) (-931.143) [-929.820] * (-928.768) (-925.801) (-935.136) [-927.635] -- 0:00:55
343000 -- (-929.397) [-928.111] (-928.430) (-926.922) * (-928.069) (-927.532) (-929.421) [-929.249] -- 0:00:55
343500 -- (-926.538) (-931.336) (-928.211) [-928.230] * (-928.584) [-930.885] (-930.224) (-928.576) -- 0:00:55
344000 -- (-926.812) (-932.264) [-929.849] (-932.484) * (-927.774) [-929.879] (-927.604) (-926.440) -- 0:00:55
344500 -- [-928.258] (-930.711) (-927.861) (-932.929) * (-930.643) [-925.867] (-928.223) (-929.151) -- 0:00:55
345000 -- (-929.266) [-926.400] (-931.207) (-931.602) * (-932.014) [-930.028] (-926.770) (-930.860) -- 0:00:55
Average standard deviation of split frequencies: 0.009764
345500 -- (-929.772) [-926.701] (-933.506) (-930.215) * (-928.990) (-928.412) [-926.711] (-927.173) -- 0:00:54
346000 -- (-930.509) [-929.262] (-936.250) (-926.879) * (-928.527) (-929.172) (-927.142) [-927.304] -- 0:00:54
346500 -- [-928.124] (-927.361) (-929.637) (-926.942) * (-929.799) (-927.420) (-928.400) [-927.427] -- 0:00:54
347000 -- (-929.297) [-927.811] (-926.459) (-928.433) * (-928.701) [-927.660] (-926.896) (-927.056) -- 0:00:54
347500 -- (-927.150) (-927.048) [-931.634] (-929.689) * [-927.889] (-929.841) (-927.477) (-926.969) -- 0:00:54
348000 -- (-926.866) (-927.470) (-928.235) [-928.207] * [-927.024] (-927.728) (-926.890) (-926.277) -- 0:00:56
348500 -- (-927.652) [-927.717] (-930.881) (-927.611) * [-929.401] (-929.220) (-926.767) (-928.375) -- 0:00:56
349000 -- (-926.520) [-927.580] (-930.883) (-927.673) * (-928.762) (-929.688) (-927.383) [-929.555] -- 0:00:55
349500 -- (-925.972) (-927.302) [-929.713] (-930.148) * (-927.372) [-929.162] (-930.780) (-927.147) -- 0:00:55
350000 -- (-926.367) (-930.255) (-928.868) [-930.062] * (-927.440) [-926.460] (-927.071) (-927.548) -- 0:00:55
Average standard deviation of split frequencies: 0.010530
350500 -- (-928.316) (-927.361) [-928.503] (-927.698) * [-925.921] (-926.074) (-929.565) (-927.191) -- 0:00:55
351000 -- [-930.235] (-928.287) (-928.515) (-927.856) * (-926.032) (-927.405) [-928.527] (-929.261) -- 0:00:55
351500 -- (-927.486) (-926.524) (-927.802) [-926.800] * (-927.628) [-927.202] (-931.650) (-929.239) -- 0:00:55
352000 -- [-926.373] (-928.192) (-928.103) (-926.933) * (-926.871) [-928.254] (-926.970) (-930.326) -- 0:00:55
352500 -- (-926.213) (-928.269) [-928.926] (-929.352) * (-930.002) [-926.893] (-929.683) (-930.059) -- 0:00:55
353000 -- (-926.212) (-927.885) [-928.660] (-927.498) * (-931.181) (-927.443) [-928.873] (-928.851) -- 0:00:54
353500 -- (-925.886) (-928.314) (-930.812) [-926.012] * (-926.995) [-927.673] (-927.314) (-926.611) -- 0:00:54
354000 -- (-925.590) (-928.361) (-928.625) [-925.915] * [-926.339] (-927.788) (-927.703) (-929.188) -- 0:00:54
354500 -- [-927.098] (-930.597) (-932.789) (-926.460) * (-929.058) (-929.920) [-927.292] (-928.677) -- 0:00:54
355000 -- (-927.139) (-927.602) [-926.765] (-926.005) * [-928.879] (-928.454) (-932.880) (-927.554) -- 0:00:54
Average standard deviation of split frequencies: 0.010593
355500 -- (-930.653) (-930.052) [-928.453] (-926.112) * [-928.699] (-926.850) (-928.566) (-932.063) -- 0:00:54
356000 -- (-928.590) (-927.004) (-926.775) [-927.119] * (-929.641) [-928.654] (-927.176) (-929.948) -- 0:00:54
356500 -- (-928.460) (-927.039) (-928.733) [-929.233] * (-931.777) (-929.485) [-927.441] (-928.717) -- 0:00:54
357000 -- (-928.681) (-929.408) [-928.319] (-928.337) * (-927.523) (-930.002) [-929.623] (-929.242) -- 0:00:54
357500 -- [-927.911] (-927.046) (-926.333) (-927.719) * (-928.307) (-926.632) (-927.598) [-927.971] -- 0:00:53
358000 -- (-926.745) (-927.641) [-927.342] (-927.448) * (-929.561) (-926.625) [-926.928] (-926.917) -- 0:00:53
358500 -- (-929.385) (-926.234) [-927.457] (-932.463) * [-929.852] (-927.387) (-928.095) (-929.761) -- 0:00:53
359000 -- (-927.236) (-926.084) [-927.856] (-929.020) * (-927.404) (-926.333) (-930.922) [-926.470] -- 0:00:53
359500 -- [-927.334] (-928.801) (-926.784) (-929.618) * [-926.594] (-927.199) (-929.988) (-928.992) -- 0:00:55
360000 -- (-929.650) (-927.508) (-926.509) [-927.233] * (-928.594) [-929.173] (-926.298) (-930.135) -- 0:00:55
Average standard deviation of split frequencies: 0.010687
360500 -- (-931.467) (-926.019) [-926.890] (-926.541) * [-927.545] (-929.038) (-926.680) (-929.495) -- 0:00:54
361000 -- (-925.909) (-927.916) (-926.470) [-928.423] * (-926.063) (-927.602) (-933.214) [-928.052] -- 0:00:54
361500 -- (-926.828) (-927.019) [-928.346] (-927.157) * (-927.899) (-929.534) (-929.679) [-925.949] -- 0:00:54
362000 -- [-926.242] (-928.670) (-929.937) (-926.166) * (-928.275) (-928.303) [-929.062] (-927.680) -- 0:00:54
362500 -- (-929.433) [-930.843] (-929.496) (-929.816) * (-927.488) (-927.655) [-929.554] (-927.139) -- 0:00:54
363000 -- (-930.904) (-926.795) (-929.023) [-930.524] * [-927.053] (-929.052) (-925.924) (-927.781) -- 0:00:54
363500 -- (-925.864) (-930.999) [-928.506] (-929.785) * (-927.096) [-931.532] (-928.197) (-934.656) -- 0:00:54
364000 -- (-926.577) (-930.419) [-926.969] (-927.974) * (-927.481) (-928.521) (-930.957) [-928.468] -- 0:00:54
364500 -- (-926.983) [-927.945] (-930.919) (-934.100) * (-927.421) [-926.230] (-928.529) (-932.988) -- 0:00:54
365000 -- (-927.153) (-927.314) [-933.269] (-930.061) * [-927.237] (-929.712) (-926.871) (-927.186) -- 0:00:53
Average standard deviation of split frequencies: 0.010304
365500 -- (-929.033) (-926.392) (-931.796) [-926.775] * [-928.921] (-928.459) (-927.349) (-928.028) -- 0:00:53
366000 -- [-926.627] (-927.618) (-928.594) (-927.754) * (-928.397) (-928.985) [-927.677] (-927.067) -- 0:00:53
366500 -- [-928.789] (-929.613) (-926.388) (-928.713) * (-928.434) (-927.213) [-926.439] (-927.767) -- 0:00:53
367000 -- (-933.084) (-928.532) [-926.424] (-929.356) * (-932.925) (-927.043) [-926.633] (-928.655) -- 0:00:53
367500 -- (-928.027) [-927.300] (-927.762) (-928.039) * (-926.357) (-927.577) (-930.804) [-929.484] -- 0:00:53
368000 -- (-928.321) (-931.427) [-929.848] (-929.284) * (-926.394) (-929.332) [-928.252] (-931.551) -- 0:00:53
368500 -- (-928.542) (-929.211) (-927.538) [-927.990] * (-927.863) (-927.228) [-928.784] (-926.986) -- 0:00:53
369000 -- (-927.334) (-929.999) [-927.624] (-927.351) * (-927.568) (-927.396) (-927.216) [-930.190] -- 0:00:53
369500 -- [-929.094] (-927.661) (-927.044) (-927.065) * (-939.993) (-930.611) [-928.386] (-930.242) -- 0:00:52
370000 -- [-928.011] (-928.037) (-927.080) (-931.849) * (-926.985) (-929.602) [-925.718] (-928.325) -- 0:00:52
Average standard deviation of split frequencies: 0.010623
370500 -- (-931.700) (-928.407) [-926.385] (-929.489) * (-926.916) [-927.458] (-928.855) (-926.689) -- 0:00:54
371000 -- (-925.818) (-925.926) (-926.788) [-928.153] * (-926.782) (-927.649) [-926.675] (-931.767) -- 0:00:54
371500 -- [-928.400] (-931.282) (-926.294) (-929.579) * [-932.082] (-933.231) (-927.143) (-928.827) -- 0:00:54
372000 -- [-928.429] (-934.827) (-926.739) (-928.287) * [-929.932] (-929.708) (-930.538) (-928.159) -- 0:00:54
372500 -- (-928.590) [-928.782] (-926.709) (-928.786) * (-929.491) (-930.047) [-931.290] (-927.738) -- 0:00:53
373000 -- [-929.868] (-929.012) (-927.436) (-930.474) * (-929.979) [-930.917] (-931.692) (-928.670) -- 0:00:53
373500 -- (-928.901) (-929.933) [-927.797] (-929.989) * (-927.028) (-929.344) (-931.712) [-928.685] -- 0:00:53
374000 -- [-927.335] (-928.708) (-926.407) (-932.798) * [-927.197] (-928.776) (-928.408) (-930.229) -- 0:00:53
374500 -- (-927.439) [-926.782] (-930.812) (-930.512) * (-926.269) (-927.279) (-928.141) [-929.779] -- 0:00:53
375000 -- (-927.201) [-928.484] (-928.335) (-927.451) * [-926.740] (-934.204) (-929.535) (-927.454) -- 0:00:53
Average standard deviation of split frequencies: 0.010767
375500 -- (-932.518) [-928.635] (-927.744) (-928.489) * (-928.676) (-929.937) (-927.266) [-928.898] -- 0:00:53
376000 -- [-932.768] (-925.716) (-931.121) (-928.888) * (-927.759) (-933.894) [-927.573] (-926.648) -- 0:00:53
376500 -- (-925.899) (-931.350) (-926.418) [-928.744] * (-927.815) (-930.263) (-926.872) [-929.618] -- 0:00:52
377000 -- (-926.877) (-934.280) [-928.884] (-926.244) * [-930.760] (-927.007) (-927.675) (-928.887) -- 0:00:52
377500 -- (-929.949) (-927.414) (-927.898) [-926.420] * (-929.296) (-926.856) (-927.815) [-928.556] -- 0:00:52
378000 -- (-928.665) (-926.873) (-928.329) [-927.667] * [-927.664] (-927.543) (-928.551) (-928.402) -- 0:00:52
378500 -- (-930.965) [-926.995] (-927.127) (-927.120) * (-928.948) [-926.974] (-928.701) (-927.882) -- 0:00:52
379000 -- [-929.829] (-928.422) (-929.424) (-928.840) * (-927.781) [-927.407] (-929.272) (-929.187) -- 0:00:52
379500 -- (-929.865) (-928.726) [-926.213] (-928.166) * [-926.963] (-927.910) (-927.630) (-929.591) -- 0:00:52
380000 -- (-927.458) [-928.493] (-930.615) (-928.008) * (-926.344) (-926.329) [-928.058] (-928.520) -- 0:00:52
Average standard deviation of split frequencies: 0.011997
380500 -- (-930.835) [-926.245] (-927.812) (-929.564) * (-928.993) [-926.871] (-928.156) (-930.316) -- 0:00:52
381000 -- (-928.015) (-925.827) [-927.931] (-926.462) * (-926.403) [-929.022] (-926.779) (-929.240) -- 0:00:53
381500 -- [-927.906] (-926.502) (-928.731) (-926.507) * (-926.104) (-927.071) (-928.931) [-929.685] -- 0:00:53
382000 -- (-930.958) [-926.369] (-928.151) (-929.102) * [-926.829] (-928.932) (-927.103) (-929.231) -- 0:00:53
382500 -- [-927.758] (-926.514) (-928.655) (-928.194) * (-928.376) (-930.900) [-926.512] (-927.378) -- 0:00:53
383000 -- (-927.987) (-929.989) [-928.538] (-926.465) * [-928.663] (-931.114) (-930.519) (-927.306) -- 0:00:53
383500 -- (-932.901) (-927.567) [-926.365] (-926.538) * (-926.887) [-929.742] (-931.604) (-929.581) -- 0:00:53
384000 -- [-928.781] (-927.546) (-930.648) (-928.755) * (-926.329) (-932.283) (-928.438) [-927.923] -- 0:00:52
384500 -- [-926.503] (-928.681) (-928.488) (-928.261) * (-928.444) (-931.061) [-929.182] (-927.321) -- 0:00:52
385000 -- (-926.901) (-927.047) (-926.671) [-930.290] * (-926.759) [-926.447] (-929.018) (-931.754) -- 0:00:52
Average standard deviation of split frequencies: 0.012747
385500 -- (-927.234) [-928.969] (-927.100) (-929.655) * [-929.783] (-927.144) (-929.281) (-932.654) -- 0:00:52
386000 -- [-926.042] (-932.790) (-927.395) (-928.769) * (-928.919) [-928.883] (-928.580) (-927.411) -- 0:00:52
386500 -- (-927.197) [-929.947] (-929.080) (-929.516) * [-928.815] (-928.612) (-926.584) (-927.774) -- 0:00:52
387000 -- (-927.590) (-932.293) (-927.544) [-930.194] * [-931.241] (-928.065) (-926.646) (-929.363) -- 0:00:52
387500 -- (-930.882) (-931.436) (-927.142) [-927.302] * (-928.162) [-926.575] (-927.482) (-927.226) -- 0:00:52
388000 -- (-926.822) (-927.485) (-929.888) [-928.366] * [-927.971] (-926.817) (-929.986) (-928.101) -- 0:00:52
388500 -- [-927.596] (-927.038) (-929.108) (-936.638) * (-929.066) (-926.138) [-929.616] (-927.322) -- 0:00:51
389000 -- (-931.784) [-927.869] (-928.922) (-928.242) * (-928.032) (-929.663) (-927.577) [-927.264] -- 0:00:51
389500 -- (-930.496) [-927.065] (-929.603) (-927.566) * (-926.500) (-926.276) [-925.971] (-928.526) -- 0:00:51
390000 -- (-931.391) (-930.531) (-930.815) [-926.744] * (-928.891) (-929.334) (-926.232) [-931.179] -- 0:00:51
Average standard deviation of split frequencies: 0.013650
390500 -- (-931.069) (-929.754) [-928.222] (-928.447) * (-927.653) (-927.863) [-927.048] (-931.681) -- 0:00:51
391000 -- (-929.923) (-930.952) [-929.083] (-927.513) * [-928.387] (-927.147) (-928.789) (-929.635) -- 0:00:51
391500 -- (-928.245) (-929.529) (-928.319) [-927.751] * [-929.334] (-926.278) (-927.312) (-927.968) -- 0:00:51
392000 -- (-928.458) (-931.651) [-927.614] (-928.059) * (-929.409) (-926.321) (-927.326) [-928.608] -- 0:00:52
392500 -- (-928.409) [-930.416] (-927.645) (-928.907) * (-928.637) (-927.013) (-927.032) [-926.271] -- 0:00:52
393000 -- [-926.280] (-928.575) (-927.678) (-928.258) * (-926.261) (-928.866) [-927.115] (-928.943) -- 0:00:52
393500 -- (-927.749) [-927.131] (-926.669) (-928.843) * (-928.574) (-926.562) (-927.670) [-926.528] -- 0:00:52
394000 -- [-930.672] (-929.042) (-931.844) (-927.119) * (-927.803) (-926.326) [-927.651] (-928.195) -- 0:00:52
394500 -- (-928.723) (-926.903) [-928.978] (-930.164) * (-929.969) [-927.208] (-927.905) (-931.449) -- 0:00:52
395000 -- (-928.187) (-932.635) [-927.426] (-928.722) * [-929.347] (-929.196) (-927.817) (-931.007) -- 0:00:52
Average standard deviation of split frequencies: 0.013987
395500 -- (-928.442) [-935.079] (-929.274) (-927.451) * (-928.205) (-927.502) [-927.851] (-930.974) -- 0:00:51
396000 -- (-929.126) (-929.027) (-931.059) [-927.731] * (-927.442) (-928.341) [-927.562] (-926.859) -- 0:00:51
396500 -- (-926.300) (-929.829) [-932.562] (-926.404) * (-927.054) (-929.362) [-928.068] (-927.083) -- 0:00:51
397000 -- (-927.342) (-927.265) (-927.969) [-930.652] * (-932.284) (-926.395) [-926.674] (-929.894) -- 0:00:51
397500 -- (-931.448) [-928.306] (-930.499) (-930.271) * (-930.576) [-926.432] (-929.338) (-928.235) -- 0:00:51
398000 -- [-926.527] (-927.129) (-930.545) (-933.167) * [-925.949] (-928.036) (-928.306) (-928.398) -- 0:00:51
398500 -- (-927.578) (-926.670) [-926.940] (-932.026) * (-928.076) (-927.000) [-931.166] (-928.123) -- 0:00:51
399000 -- (-928.793) [-927.871] (-929.902) (-928.353) * (-934.366) [-929.441] (-928.960) (-926.758) -- 0:00:51
399500 -- (-931.393) [-928.235] (-926.761) (-929.559) * [-928.464] (-930.863) (-926.472) (-928.054) -- 0:00:51
400000 -- (-927.343) [-926.926] (-927.241) (-925.846) * (-929.277) (-929.334) (-927.464) [-928.468] -- 0:00:51
Average standard deviation of split frequencies: 0.013972
400500 -- (-931.610) (-930.888) [-929.041] (-926.888) * [-927.576] (-927.813) (-926.722) (-926.452) -- 0:00:50
401000 -- (-927.313) (-929.955) [-926.884] (-926.027) * [-931.046] (-927.274) (-926.214) (-931.318) -- 0:00:50
401500 -- (-930.453) (-927.647) [-926.120] (-929.690) * (-931.342) (-928.475) [-926.569] (-927.309) -- 0:00:50
402000 -- [-928.807] (-926.974) (-927.594) (-928.221) * (-933.459) [-927.286] (-925.961) (-931.953) -- 0:00:50
402500 -- (-931.320) (-927.230) (-931.380) [-929.613] * (-927.407) (-928.160) [-926.974] (-926.895) -- 0:00:50
403000 -- (-932.711) (-930.123) [-930.493] (-930.343) * (-926.171) [-927.192] (-927.933) (-931.566) -- 0:00:50
403500 -- [-926.804] (-930.667) (-930.120) (-932.564) * (-926.652) [-928.486] (-928.933) (-928.998) -- 0:00:51
404000 -- (-930.880) [-927.384] (-926.141) (-927.312) * (-926.785) [-927.164] (-928.914) (-929.336) -- 0:00:51
404500 -- (-931.633) (-931.332) (-931.654) [-928.691] * (-926.179) [-928.763] (-927.187) (-930.630) -- 0:00:51
405000 -- (-931.351) (-926.693) [-926.808] (-926.516) * (-926.277) [-926.684] (-931.198) (-926.852) -- 0:00:51
Average standard deviation of split frequencies: 0.013498
405500 -- [-926.676] (-926.939) (-926.341) (-926.456) * (-928.419) [-928.010] (-930.661) (-927.233) -- 0:00:51
406000 -- (-928.232) (-927.228) [-933.607] (-927.348) * (-930.782) (-929.254) (-926.671) [-926.966] -- 0:00:51
406500 -- (-928.921) [-925.978] (-931.386) (-928.070) * (-927.127) [-928.034] (-926.174) (-926.199) -- 0:00:51
407000 -- [-926.805] (-927.175) (-927.538) (-926.878) * (-928.060) (-929.739) (-926.380) [-926.172] -- 0:00:50
407500 -- (-927.187) (-926.267) (-927.693) [-926.232] * (-930.738) (-927.365) (-926.210) [-926.085] -- 0:00:50
408000 -- (-930.162) (-928.368) (-926.681) [-931.251] * (-928.573) (-930.089) [-929.799] (-932.846) -- 0:00:50
408500 -- (-931.895) [-930.714] (-925.939) (-927.234) * (-928.869) (-929.756) [-931.773] (-929.833) -- 0:00:50
409000 -- (-928.142) [-928.123] (-927.919) (-926.948) * [-926.243] (-929.546) (-931.521) (-930.326) -- 0:00:50
409500 -- (-928.436) (-928.665) [-925.907] (-927.154) * [-926.276] (-928.944) (-930.000) (-928.093) -- 0:00:50
410000 -- (-929.163) (-926.849) [-926.950] (-929.389) * (-927.285) (-930.474) (-926.832) [-927.987] -- 0:00:50
Average standard deviation of split frequencies: 0.013847
410500 -- (-928.792) (-930.082) [-926.114] (-928.401) * (-927.225) (-927.453) (-929.432) [-928.452] -- 0:00:50
411000 -- (-927.114) [-928.767] (-925.825) (-929.581) * (-928.282) [-926.317] (-926.262) (-927.886) -- 0:00:50
411500 -- [-926.972] (-930.426) (-926.229) (-929.659) * (-927.795) (-927.816) [-926.147] (-927.789) -- 0:00:50
412000 -- (-933.073) (-926.713) [-926.232] (-929.312) * (-926.728) [-927.398] (-935.015) (-926.587) -- 0:00:49
412500 -- (-928.141) (-929.701) [-927.352] (-926.093) * [-929.065] (-927.441) (-931.738) (-928.477) -- 0:00:49
413000 -- (-926.822) (-926.145) [-928.893] (-927.537) * (-928.665) [-926.591] (-929.442) (-929.066) -- 0:00:49
413500 -- (-927.384) (-926.359) (-929.900) [-927.414] * [-927.222] (-928.297) (-928.415) (-931.035) -- 0:00:49
414000 -- [-929.737] (-925.943) (-929.234) (-934.268) * (-927.397) [-929.485] (-927.754) (-930.831) -- 0:00:49
414500 -- [-928.123] (-928.490) (-927.224) (-931.384) * (-927.181) (-928.551) (-927.775) [-931.920] -- 0:00:50
415000 -- (-928.125) [-927.024] (-928.553) (-929.608) * (-926.884) [-927.590] (-929.713) (-927.972) -- 0:00:50
Average standard deviation of split frequencies: 0.014661
415500 -- (-926.626) [-926.767] (-926.821) (-929.076) * [-927.417] (-926.627) (-929.167) (-928.140) -- 0:00:50
416000 -- (-928.699) (-927.815) (-927.166) [-927.179] * (-929.934) (-927.595) (-932.670) [-930.550] -- 0:00:50
416500 -- [-927.417] (-930.405) (-928.255) (-928.768) * [-926.673] (-927.757) (-927.260) (-927.335) -- 0:00:50
417000 -- [-928.455] (-927.380) (-927.255) (-928.337) * (-928.120) [-929.598] (-927.225) (-928.712) -- 0:00:50
417500 -- (-928.049) (-928.429) (-927.786) [-926.365] * [-928.506] (-931.847) (-927.380) (-930.783) -- 0:00:50
418000 -- (-931.905) [-927.220] (-929.073) (-927.077) * [-927.626] (-927.552) (-927.275) (-930.243) -- 0:00:50
418500 -- (-930.499) [-927.768] (-928.995) (-928.366) * (-930.326) [-931.532] (-930.936) (-928.660) -- 0:00:50
419000 -- (-933.355) [-930.672] (-926.273) (-932.327) * (-926.875) [-927.477] (-928.375) (-929.602) -- 0:00:49
419500 -- (-929.558) [-928.621] (-926.550) (-929.995) * (-929.444) (-929.555) [-928.297] (-926.968) -- 0:00:49
420000 -- (-926.390) [-926.194] (-928.267) (-930.720) * (-927.503) (-927.551) (-927.124) [-927.278] -- 0:00:49
Average standard deviation of split frequencies: 0.014148
420500 -- [-927.535] (-930.036) (-933.227) (-927.860) * (-927.322) [-930.362] (-928.858) (-928.398) -- 0:00:49
421000 -- (-932.880) [-928.971] (-938.306) (-929.023) * (-926.590) (-927.379) (-927.924) [-927.729] -- 0:00:49
421500 -- (-929.632) (-927.574) [-926.731] (-933.308) * (-927.323) (-928.484) [-925.986] (-926.715) -- 0:00:49
422000 -- (-928.079) (-926.933) (-926.669) [-929.166] * [-926.221] (-929.849) (-926.045) (-927.116) -- 0:00:49
422500 -- (-929.802) [-926.421] (-927.307) (-928.079) * (-926.457) (-926.947) [-926.830] (-926.987) -- 0:00:49
423000 -- (-928.751) [-926.834] (-926.562) (-925.772) * (-927.425) (-927.907) [-928.343] (-928.603) -- 0:00:49
423500 -- (-927.496) [-927.621] (-926.405) (-929.469) * (-927.406) (-933.570) (-931.045) [-928.798] -- 0:00:49
424000 -- [-928.614] (-926.942) (-927.296) (-929.376) * (-926.708) (-934.067) (-931.276) [-931.106] -- 0:00:48
424500 -- (-933.353) (-927.049) [-927.590] (-928.775) * (-926.434) (-930.816) (-930.378) [-927.786] -- 0:00:48
425000 -- (-926.442) [-927.403] (-927.495) (-926.977) * (-927.652) [-928.100] (-928.180) (-931.241) -- 0:00:48
Average standard deviation of split frequencies: 0.013556
425500 -- [-928.017] (-927.359) (-927.480) (-927.071) * (-930.175) (-928.394) [-927.863] (-931.026) -- 0:00:49
426000 -- [-928.552] (-927.840) (-926.110) (-926.970) * (-928.682) (-927.315) [-925.835] (-930.639) -- 0:00:49
426500 -- (-930.487) (-927.618) (-929.953) [-926.157] * (-929.110) [-927.317] (-925.797) (-928.138) -- 0:00:49
427000 -- [-926.538] (-926.834) (-929.026) (-929.678) * (-927.815) [-927.387] (-927.666) (-928.266) -- 0:00:49
427500 -- (-930.228) (-926.208) [-927.500] (-933.042) * (-926.600) [-927.225] (-926.691) (-927.795) -- 0:00:49
428000 -- [-927.552] (-929.109) (-927.130) (-930.867) * [-926.361] (-925.947) (-928.451) (-932.932) -- 0:00:49
428500 -- [-926.892] (-928.915) (-927.733) (-930.331) * (-929.411) [-926.393] (-927.318) (-927.494) -- 0:00:49
429000 -- (-926.691) (-927.950) (-928.873) [-927.391] * (-930.702) (-927.804) (-926.954) [-927.494] -- 0:00:49
429500 -- [-927.363] (-929.005) (-930.562) (-929.488) * (-930.797) (-929.378) (-928.978) [-927.060] -- 0:00:49
430000 -- (-928.549) (-931.920) (-932.449) [-932.358] * (-926.735) (-929.171) [-929.013] (-928.916) -- 0:00:49
Average standard deviation of split frequencies: 0.014230
430500 -- [-928.628] (-930.176) (-927.357) (-928.935) * (-928.743) [-927.897] (-932.546) (-929.720) -- 0:00:48
431000 -- (-926.662) (-929.490) [-927.922] (-929.594) * (-929.331) [-928.456] (-934.751) (-929.938) -- 0:00:48
431500 -- (-931.217) [-928.262] (-928.724) (-929.754) * (-932.395) (-926.651) (-930.010) [-930.603] -- 0:00:48
432000 -- (-930.154) (-928.568) (-929.742) [-925.946] * (-928.842) (-927.698) (-929.823) [-928.668] -- 0:00:48
432500 -- (-927.591) [-927.746] (-931.460) (-926.181) * [-928.825] (-926.124) (-927.911) (-927.661) -- 0:00:48
433000 -- (-930.050) (-927.845) (-928.828) [-926.206] * (-930.130) [-926.028] (-925.933) (-927.642) -- 0:00:48
433500 -- (-928.843) (-928.408) (-927.171) [-926.545] * [-928.468] (-926.109) (-926.887) (-927.063) -- 0:00:48
434000 -- [-926.756] (-926.447) (-927.443) (-927.411) * (-927.310) [-928.503] (-928.511) (-929.024) -- 0:00:48
434500 -- [-926.838] (-928.444) (-934.254) (-927.675) * (-927.232) (-928.091) (-931.964) [-933.187] -- 0:00:48
435000 -- (-927.179) [-929.012] (-931.719) (-928.790) * [-926.999] (-935.283) (-931.247) (-927.936) -- 0:00:48
Average standard deviation of split frequencies: 0.013095
435500 -- [-927.915] (-930.018) (-928.600) (-929.365) * (-928.129) (-928.816) [-927.648] (-927.004) -- 0:00:47
436000 -- (-927.223) (-927.179) [-928.627] (-928.388) * [-928.369] (-927.602) (-927.367) (-927.178) -- 0:00:47
436500 -- (-927.348) (-926.002) [-928.404] (-928.023) * [-927.306] (-934.008) (-927.931) (-929.035) -- 0:00:49
437000 -- (-927.375) (-926.017) [-929.192] (-926.939) * [-927.050] (-930.962) (-929.231) (-928.509) -- 0:00:48
437500 -- (-930.140) [-926.285] (-926.663) (-927.341) * (-927.852) [-928.264] (-926.142) (-930.174) -- 0:00:48
438000 -- (-927.345) (-926.685) [-927.841] (-927.362) * (-931.228) [-928.019] (-926.691) (-931.453) -- 0:00:48
438500 -- (-926.208) [-927.320] (-926.242) (-930.405) * (-928.398) [-928.061] (-928.596) (-927.010) -- 0:00:48
439000 -- [-927.740] (-929.135) (-931.398) (-928.003) * (-930.366) [-930.011] (-926.060) (-929.913) -- 0:00:48
439500 -- [-927.369] (-927.961) (-927.488) (-929.227) * (-926.339) [-927.832] (-926.865) (-927.056) -- 0:00:48
440000 -- (-926.914) [-927.375] (-927.969) (-927.705) * (-928.317) (-927.062) (-927.766) [-927.163] -- 0:00:48
Average standard deviation of split frequencies: 0.013152
440500 -- [-930.916] (-927.486) (-928.673) (-929.226) * [-927.121] (-926.936) (-926.705) (-928.719) -- 0:00:48
441000 -- (-927.350) (-929.300) (-928.548) [-927.583] * (-928.844) (-929.266) [-930.292] (-928.110) -- 0:00:48
441500 -- (-926.450) (-928.123) (-930.976) [-925.950] * (-927.396) (-928.950) [-929.974] (-932.139) -- 0:00:48
442000 -- (-927.133) (-926.920) [-926.688] (-926.289) * (-927.885) [-926.595] (-926.382) (-926.641) -- 0:00:47
442500 -- (-929.436) (-926.512) (-928.185) [-927.490] * (-929.847) (-930.067) [-926.223] (-926.709) -- 0:00:47
443000 -- [-928.791] (-928.577) (-927.543) (-928.191) * (-929.774) [-927.034] (-927.716) (-926.527) -- 0:00:47
443500 -- (-928.563) (-927.241) [-926.903] (-928.532) * [-927.796] (-927.052) (-932.310) (-928.610) -- 0:00:47
444000 -- (-926.615) (-927.999) [-926.775] (-934.583) * [-927.240] (-926.619) (-932.801) (-927.255) -- 0:00:47
444500 -- (-928.592) [-933.826] (-928.626) (-927.568) * (-927.903) (-925.877) [-935.622] (-930.642) -- 0:00:47
445000 -- (-930.243) (-926.868) (-928.939) [-927.229] * (-930.687) [-928.673] (-928.166) (-930.090) -- 0:00:47
Average standard deviation of split frequencies: 0.015046
445500 -- (-929.336) (-927.831) (-927.972) [-926.917] * (-936.377) (-928.432) (-928.030) [-928.706] -- 0:00:47
446000 -- (-938.228) [-930.984] (-926.839) (-931.000) * (-932.967) (-929.635) [-927.971] (-928.829) -- 0:00:47
446500 -- (-928.157) (-927.367) [-926.140] (-928.484) * [-932.019] (-927.245) (-927.751) (-929.200) -- 0:00:47
447000 -- (-928.826) [-928.875] (-931.748) (-925.919) * (-929.729) (-928.016) (-928.130) [-927.446] -- 0:00:47
447500 -- (-926.868) (-926.898) [-925.859] (-926.136) * [-928.793] (-926.952) (-929.352) (-929.004) -- 0:00:46
448000 -- (-928.307) (-929.101) [-926.657] (-931.257) * [-927.635] (-929.215) (-933.927) (-929.078) -- 0:00:48
448500 -- (-926.751) [-927.214] (-928.921) (-932.374) * (-929.150) (-928.192) (-933.373) [-927.016] -- 0:00:47
449000 -- (-926.711) [-927.711] (-929.050) (-927.669) * (-929.361) (-927.372) [-931.377] (-927.616) -- 0:00:47
449500 -- (-930.898) (-927.222) [-927.501] (-929.905) * (-930.566) [-927.405] (-928.768) (-926.657) -- 0:00:47
450000 -- (-929.273) [-926.905] (-931.493) (-930.130) * (-928.700) [-927.215] (-927.558) (-926.751) -- 0:00:47
Average standard deviation of split frequencies: 0.014513
450500 -- (-927.566) (-927.568) (-931.586) [-926.867] * (-928.668) [-929.406] (-927.597) (-929.038) -- 0:00:47
451000 -- (-927.658) (-926.729) (-929.292) [-926.882] * (-931.485) [-926.959] (-927.691) (-928.654) -- 0:00:47
451500 -- (-928.409) (-926.718) [-927.258] (-927.793) * [-928.561] (-928.296) (-929.032) (-927.828) -- 0:00:47
452000 -- (-928.231) [-927.371] (-925.707) (-928.416) * [-930.171] (-932.678) (-928.468) (-928.860) -- 0:00:47
452500 -- (-930.417) (-926.737) (-927.878) [-928.927] * (-926.961) [-929.355] (-929.069) (-927.165) -- 0:00:47
453000 -- (-928.046) (-927.150) [-927.117] (-928.321) * (-928.015) [-927.648] (-932.487) (-927.750) -- 0:00:47
453500 -- (-931.409) (-927.045) [-927.607] (-928.340) * (-928.847) (-927.612) (-935.680) [-928.896] -- 0:00:46
454000 -- [-926.913] (-929.822) (-928.837) (-928.429) * (-928.214) (-927.745) (-927.879) [-927.010] -- 0:00:46
454500 -- (-928.676) [-926.315] (-927.226) (-927.788) * (-928.559) (-926.447) (-931.287) [-927.199] -- 0:00:46
455000 -- [-926.826] (-926.370) (-926.609) (-928.331) * (-930.787) [-927.272] (-929.768) (-927.814) -- 0:00:46
Average standard deviation of split frequencies: 0.014344
455500 -- (-927.818) [-928.101] (-926.567) (-936.877) * [-926.867] (-927.204) (-929.851) (-929.806) -- 0:00:46
456000 -- (-928.445) (-928.122) (-927.131) [-928.090] * [-928.408] (-928.683) (-926.130) (-928.925) -- 0:00:46
456500 -- (-928.671) (-929.150) (-930.650) [-926.690] * (-931.346) (-927.707) [-927.527] (-931.169) -- 0:00:46
457000 -- (-931.404) [-927.906] (-926.258) (-928.247) * (-933.155) (-929.033) [-927.652] (-927.735) -- 0:00:46
457500 -- (-927.622) [-926.581] (-928.112) (-930.885) * (-927.837) (-926.265) (-926.702) [-926.774] -- 0:00:46
458000 -- (-930.628) (-928.075) [-930.798] (-927.696) * (-926.387) (-927.195) [-926.974] (-926.331) -- 0:00:46
458500 -- [-927.229] (-928.844) (-927.337) (-927.226) * (-926.295) (-927.728) (-928.348) [-927.921] -- 0:00:46
459000 -- (-926.451) (-928.151) (-936.294) [-929.420] * [-927.197] (-929.148) (-926.967) (-926.108) -- 0:00:45
459500 -- (-927.113) (-928.435) (-927.002) [-928.031] * [-926.237] (-926.456) (-929.049) (-927.539) -- 0:00:47
460000 -- (-927.959) (-926.538) (-927.890) [-926.111] * (-929.373) (-926.160) [-927.997] (-929.879) -- 0:00:46
Average standard deviation of split frequencies: 0.015030
460500 -- (-932.028) (-927.242) [-928.081] (-926.907) * (-928.955) (-927.810) (-931.100) [-927.892] -- 0:00:46
461000 -- (-927.122) [-926.665] (-927.159) (-928.521) * [-927.379] (-928.998) (-929.246) (-929.110) -- 0:00:46
461500 -- (-926.397) (-928.330) (-928.417) [-929.532] * (-931.472) [-930.918] (-927.652) (-930.434) -- 0:00:46
462000 -- (-927.226) (-928.997) (-926.829) [-926.909] * (-929.078) [-927.175] (-929.047) (-927.865) -- 0:00:46
462500 -- (-928.548) [-927.567] (-926.043) (-927.536) * (-927.228) (-927.050) [-926.753] (-931.485) -- 0:00:46
463000 -- (-932.002) (-929.415) [-928.939] (-926.153) * (-928.065) (-927.181) (-930.431) [-928.092] -- 0:00:46
463500 -- (-932.920) [-927.564] (-927.789) (-926.115) * [-927.598] (-926.310) (-927.806) (-926.609) -- 0:00:46
464000 -- (-930.612) (-929.086) (-929.480) [-926.697] * (-931.247) (-928.618) [-926.849] (-926.906) -- 0:00:46
464500 -- (-928.138) [-926.239] (-930.174) (-927.292) * (-926.668) (-927.688) (-928.857) [-926.433] -- 0:00:46
465000 -- [-926.414] (-927.936) (-928.921) (-928.869) * (-926.273) (-932.340) [-928.536] (-926.420) -- 0:00:46
Average standard deviation of split frequencies: 0.014921
465500 -- [-926.617] (-926.248) (-928.200) (-930.668) * [-926.714] (-928.543) (-929.289) (-928.239) -- 0:00:45
466000 -- (-926.876) (-931.625) [-925.691] (-929.343) * [-927.751] (-930.147) (-929.870) (-928.621) -- 0:00:45
466500 -- (-927.472) [-925.858] (-931.190) (-929.413) * [-926.540] (-931.435) (-929.465) (-927.887) -- 0:00:45
467000 -- (-929.458) (-929.571) (-932.744) [-928.279] * (-926.707) (-929.199) (-926.951) [-926.882] -- 0:00:45
467500 -- (-929.909) (-926.631) [-927.416] (-933.764) * (-926.589) (-929.901) [-931.009] (-926.674) -- 0:00:45
468000 -- (-929.110) [-926.241] (-932.829) (-929.622) * [-928.066] (-928.431) (-926.265) (-928.104) -- 0:00:45
468500 -- [-929.020] (-926.527) (-927.784) (-927.950) * [-927.833] (-928.981) (-927.550) (-926.642) -- 0:00:45
469000 -- (-927.982) [-926.326] (-927.994) (-927.140) * (-929.204) (-929.757) (-927.228) [-926.217] -- 0:00:45
469500 -- (-928.362) [-926.806] (-931.629) (-927.931) * (-926.554) (-927.467) [-928.433] (-930.318) -- 0:00:45
470000 -- (-928.170) (-927.429) [-930.591] (-927.146) * (-927.466) (-927.826) [-926.742] (-929.066) -- 0:00:45
Average standard deviation of split frequencies: 0.014836
470500 -- (-927.970) (-929.534) (-937.387) [-927.363] * (-928.037) [-927.618] (-928.131) (-928.029) -- 0:00:45
471000 -- (-928.473) (-928.908) [-928.322] (-926.425) * [-928.415] (-927.359) (-929.627) (-932.952) -- 0:00:44
471500 -- (-927.357) (-928.705) (-926.853) [-927.088] * (-929.018) (-926.798) [-930.696] (-928.063) -- 0:00:45
472000 -- (-928.981) [-927.518] (-928.543) (-930.875) * (-927.871) (-927.272) (-929.490) [-929.573] -- 0:00:45
472500 -- [-929.250] (-928.035) (-927.230) (-927.919) * (-927.694) [-927.157] (-930.318) (-930.061) -- 0:00:45
473000 -- [-926.861] (-927.156) (-926.658) (-930.242) * [-927.655] (-928.027) (-927.494) (-928.880) -- 0:00:45
473500 -- (-928.713) (-926.694) [-928.311] (-929.683) * (-927.648) [-927.358] (-928.030) (-928.298) -- 0:00:45
474000 -- (-926.609) (-926.138) [-926.419] (-932.410) * (-926.700) (-926.324) [-927.192] (-927.281) -- 0:00:45
474500 -- (-926.224) (-926.926) (-928.338) [-926.389] * (-928.232) (-926.463) (-927.386) [-933.683] -- 0:00:45
475000 -- [-928.936] (-926.792) (-927.884) (-926.732) * [-926.627] (-930.897) (-931.965) (-927.812) -- 0:00:45
Average standard deviation of split frequencies: 0.014979
475500 -- (-927.776) [-929.025] (-926.743) (-928.023) * (-928.335) (-930.610) [-934.267] (-925.837) -- 0:00:45
476000 -- [-926.054] (-927.988) (-926.853) (-930.378) * (-927.541) (-928.373) [-927.442] (-927.121) -- 0:00:45
476500 -- [-928.475] (-927.342) (-928.233) (-926.680) * (-928.468) (-928.716) (-927.216) [-927.111] -- 0:00:45
477000 -- (-929.238) (-928.303) [-932.940] (-926.889) * (-926.569) (-927.347) (-926.442) [-925.681] -- 0:00:44
477500 -- (-931.353) [-926.356] (-927.637) (-929.195) * (-925.993) (-926.912) [-926.588] (-925.740) -- 0:00:44
478000 -- (-929.868) (-927.264) [-928.634] (-927.370) * (-926.103) (-926.898) (-926.049) [-931.453] -- 0:00:44
478500 -- (-926.667) (-929.271) (-926.256) [-927.461] * [-928.807] (-927.398) (-927.216) (-932.424) -- 0:00:44
479000 -- (-929.065) [-927.247] (-930.383) (-926.118) * (-931.224) [-926.795] (-927.417) (-928.532) -- 0:00:44
479500 -- [-928.447] (-926.875) (-930.733) (-929.446) * [-928.186] (-927.490) (-928.174) (-928.592) -- 0:00:44
480000 -- (-928.296) [-929.209] (-932.741) (-927.901) * (-927.630) [-926.467] (-927.518) (-927.117) -- 0:00:44
Average standard deviation of split frequencies: 0.015079
480500 -- (-929.218) (-927.817) (-931.119) [-926.946] * (-934.520) (-926.854) (-930.763) [-928.525] -- 0:00:44
481000 -- (-929.567) (-926.709) (-931.679) [-929.811] * (-931.746) (-926.230) (-932.385) [-928.619] -- 0:00:44
481500 -- (-926.239) [-926.905] (-931.470) (-930.325) * (-926.024) [-926.980] (-930.370) (-929.256) -- 0:00:44
482000 -- (-926.133) (-927.468) (-933.231) [-929.035] * (-929.704) (-927.117) (-926.333) [-925.900] -- 0:00:44
482500 -- (-927.699) [-929.400] (-931.207) (-928.258) * (-929.060) (-927.035) (-926.774) [-928.576] -- 0:00:43
483000 -- (-930.777) [-927.463] (-927.797) (-928.636) * (-927.200) (-929.646) (-927.241) [-930.589] -- 0:00:43
483500 -- (-930.219) [-928.438] (-927.855) (-927.403) * (-926.983) [-929.503] (-926.665) (-929.082) -- 0:00:44
484000 -- (-933.452) (-928.253) (-928.223) [-926.470] * [-926.889] (-929.349) (-928.240) (-928.850) -- 0:00:44
484500 -- (-926.842) (-926.315) (-926.811) [-926.589] * [-930.105] (-927.132) (-927.341) (-928.313) -- 0:00:44
485000 -- (-928.296) [-926.306] (-927.993) (-925.956) * (-926.548) (-926.546) (-930.502) [-926.507] -- 0:00:44
Average standard deviation of split frequencies: 0.014125
485500 -- [-928.637] (-927.315) (-929.535) (-930.588) * [-927.218] (-928.386) (-929.531) (-926.507) -- 0:00:44
486000 -- [-928.089] (-928.535) (-930.016) (-929.031) * (-926.812) (-935.321) (-927.591) [-926.726] -- 0:00:44
486500 -- (-929.722) (-932.120) (-927.856) [-931.477] * [-927.196] (-929.535) (-927.598) (-927.481) -- 0:00:44
487000 -- [-929.097] (-929.015) (-926.923) (-929.569) * [-929.476] (-930.461) (-926.913) (-932.107) -- 0:00:44
487500 -- (-929.131) (-928.918) [-927.782] (-928.784) * [-930.535] (-929.541) (-930.150) (-927.100) -- 0:00:44
488000 -- [-926.934] (-928.371) (-928.366) (-928.827) * [-928.086] (-931.299) (-929.963) (-926.318) -- 0:00:44
488500 -- (-930.109) [-927.590] (-926.960) (-929.558) * (-928.113) [-927.569] (-928.494) (-928.073) -- 0:00:43
489000 -- [-928.800] (-930.704) (-927.580) (-928.500) * [-929.376] (-927.169) (-931.481) (-926.903) -- 0:00:43
489500 -- (-928.154) (-926.998) (-928.173) [-927.853] * (-931.246) [-928.757] (-928.643) (-926.685) -- 0:00:43
490000 -- [-929.493] (-931.611) (-928.459) (-927.812) * (-928.663) [-930.040] (-927.479) (-930.826) -- 0:00:43
Average standard deviation of split frequencies: 0.013871
490500 -- [-927.625] (-928.083) (-930.053) (-927.426) * (-926.537) (-928.810) [-930.516] (-927.197) -- 0:00:43
491000 -- [-928.799] (-928.381) (-927.400) (-930.336) * (-929.790) (-929.460) [-928.834] (-926.959) -- 0:00:43
491500 -- [-928.201] (-928.138) (-926.504) (-925.841) * [-928.142] (-931.536) (-928.717) (-929.618) -- 0:00:43
492000 -- (-926.846) (-927.670) [-926.492] (-925.957) * (-930.677) [-927.221] (-927.800) (-930.383) -- 0:00:43
492500 -- (-926.676) (-928.382) [-926.695] (-929.607) * (-929.875) (-932.387) (-927.108) [-926.268] -- 0:00:43
493000 -- [-926.314] (-928.783) (-929.890) (-926.881) * (-926.925) (-927.590) (-927.389) [-926.353] -- 0:00:43
493500 -- (-925.934) (-927.296) (-928.650) [-927.396] * (-928.221) (-927.506) [-926.675] (-930.463) -- 0:00:43
494000 -- (-928.648) (-926.708) [-927.569] (-928.784) * (-927.753) (-927.079) [-927.788] (-929.025) -- 0:00:43
494500 -- [-931.093] (-927.565) (-930.120) (-928.216) * [-929.168] (-926.135) (-925.931) (-927.950) -- 0:00:42
495000 -- (-926.229) (-928.203) [-930.562] (-930.353) * (-928.110) (-927.659) (-927.211) [-927.481] -- 0:00:42
Average standard deviation of split frequencies: 0.013306
495500 -- (-926.811) (-929.410) [-928.697] (-929.562) * (-927.438) (-927.729) (-931.628) [-926.476] -- 0:00:43
496000 -- [-926.641] (-926.477) (-928.428) (-929.233) * (-929.096) (-927.044) [-930.700] (-927.616) -- 0:00:43
496500 -- (-929.328) [-926.278] (-931.877) (-927.826) * (-928.952) (-926.696) [-928.142] (-927.265) -- 0:00:43
497000 -- (-928.122) [-928.518] (-930.957) (-927.026) * (-934.226) (-927.568) [-928.097] (-927.686) -- 0:00:43
497500 -- (-928.461) (-927.630) [-927.147] (-927.255) * (-927.607) [-928.577] (-928.658) (-929.880) -- 0:00:43
498000 -- (-929.245) (-926.489) [-925.723] (-928.271) * [-927.781] (-930.372) (-929.938) (-928.339) -- 0:00:43
498500 -- [-928.961] (-928.832) (-927.751) (-927.410) * (-927.090) (-927.483) [-926.032] (-925.964) -- 0:00:43
499000 -- [-929.836] (-926.143) (-927.051) (-930.668) * (-926.857) (-927.064) (-930.452) [-929.803] -- 0:00:43
499500 -- (-929.676) [-926.471] (-928.878) (-927.798) * (-927.537) (-930.297) (-930.403) [-927.429] -- 0:00:43
500000 -- (-926.894) (-926.207) [-926.725] (-927.046) * (-928.322) (-927.809) (-927.502) [-927.560] -- 0:00:43
Average standard deviation of split frequencies: 0.012299
500500 -- (-927.237) (-926.826) [-930.356] (-930.031) * (-927.361) (-926.067) [-927.665] (-929.480) -- 0:00:42
501000 -- (-927.594) [-927.640] (-933.110) (-927.274) * (-927.408) [-926.102] (-928.644) (-928.982) -- 0:00:42
501500 -- (-927.943) (-927.896) (-929.515) [-928.060] * [-928.579] (-925.984) (-927.995) (-926.123) -- 0:00:42
502000 -- (-926.531) [-928.972] (-928.886) (-928.208) * [-928.419] (-926.926) (-928.015) (-927.105) -- 0:00:42
502500 -- (-928.833) (-929.702) (-928.419) [-928.680] * (-927.627) (-928.785) [-926.062] (-926.587) -- 0:00:42
503000 -- (-928.067) [-929.251] (-930.696) (-926.656) * (-934.873) (-928.794) (-927.138) [-928.015] -- 0:00:42
503500 -- [-928.677] (-928.394) (-930.990) (-930.082) * (-928.252) (-927.548) [-931.038] (-929.319) -- 0:00:42
504000 -- (-926.958) [-927.224] (-927.612) (-935.721) * (-931.751) (-927.642) [-928.142] (-930.031) -- 0:00:42
504500 -- [-927.989] (-926.933) (-928.583) (-930.086) * (-933.951) (-926.693) (-927.827) [-928.840] -- 0:00:42
505000 -- (-927.772) (-931.081) [-927.624] (-927.812) * (-928.143) [-926.945] (-930.309) (-931.006) -- 0:00:42
Average standard deviation of split frequencies: 0.012635
505500 -- (-927.886) [-929.179] (-927.989) (-926.842) * [-929.018] (-930.746) (-928.654) (-930.303) -- 0:00:42
506000 -- (-929.199) (-928.155) [-929.405] (-926.037) * (-932.848) [-927.202] (-932.983) (-928.757) -- 0:00:41
506500 -- [-930.501] (-926.871) (-927.934) (-926.346) * [-927.220] (-927.816) (-927.031) (-927.010) -- 0:00:42
507000 -- (-929.613) (-925.597) (-928.211) [-927.365] * [-926.450] (-926.931) (-928.321) (-927.645) -- 0:00:42
507500 -- [-927.615] (-925.759) (-928.937) (-931.638) * (-925.689) [-928.305] (-927.772) (-927.055) -- 0:00:42
508000 -- (-929.976) (-927.156) [-934.609] (-932.223) * (-925.818) (-928.560) [-927.777] (-928.274) -- 0:00:42
508500 -- (-930.741) [-926.015] (-931.889) (-933.274) * (-927.170) (-927.244) (-930.867) [-927.785] -- 0:00:42
509000 -- [-926.558] (-927.003) (-928.256) (-926.902) * (-930.802) (-926.462) [-929.150] (-928.659) -- 0:00:42
509500 -- (-926.766) [-925.889] (-926.169) (-926.876) * (-926.637) [-927.341] (-928.526) (-936.124) -- 0:00:42
510000 -- (-930.393) (-929.949) (-926.687) [-927.094] * (-928.500) [-927.244] (-935.964) (-933.848) -- 0:00:42
Average standard deviation of split frequencies: 0.011620
510500 -- [-926.864] (-929.299) (-926.812) (-929.657) * [-926.906] (-926.514) (-927.606) (-926.547) -- 0:00:42
511000 -- (-929.336) (-930.969) [-929.234] (-929.167) * (-927.297) (-926.279) (-928.186) [-926.536] -- 0:00:42
511500 -- (-928.055) (-928.480) [-927.183] (-926.773) * (-931.195) (-926.885) [-928.081] (-926.549) -- 0:00:42
512000 -- (-926.841) (-926.676) [-928.998] (-930.520) * [-933.114] (-928.369) (-926.324) (-928.213) -- 0:00:41
512500 -- (-927.812) [-927.440] (-927.309) (-926.048) * (-928.142) (-926.696) [-926.722] (-929.090) -- 0:00:41
513000 -- (-929.923) (-929.998) [-928.471] (-926.742) * (-926.401) (-928.523) (-927.732) [-926.548] -- 0:00:41
513500 -- (-927.823) (-927.550) (-929.055) [-928.635] * (-928.026) (-928.460) (-929.223) [-928.063] -- 0:00:41
514000 -- (-927.836) [-926.711] (-930.905) (-927.759) * (-926.065) [-929.687] (-928.288) (-930.335) -- 0:00:41
514500 -- (-931.365) (-927.927) (-931.586) [-928.360] * (-928.150) [-926.722] (-932.018) (-928.355) -- 0:00:41
515000 -- (-927.682) (-929.177) (-928.430) [-927.419] * (-927.978) (-929.396) [-927.122] (-930.819) -- 0:00:41
Average standard deviation of split frequencies: 0.011762
515500 -- (-930.285) (-930.199) (-927.747) [-928.255] * (-927.529) (-933.152) [-926.611] (-926.147) -- 0:00:41
516000 -- (-929.154) (-928.621) [-930.665] (-926.747) * (-926.277) (-927.513) [-928.958] (-928.427) -- 0:00:41
516500 -- (-931.654) (-926.586) [-928.764] (-927.966) * [-926.454] (-928.847) (-930.051) (-929.474) -- 0:00:41
517000 -- (-928.552) [-930.810] (-928.788) (-929.738) * (-930.724) (-927.549) [-929.833] (-928.502) -- 0:00:41
517500 -- (-931.472) (-927.230) [-930.024] (-929.686) * (-929.527) [-928.695] (-930.117) (-928.350) -- 0:00:41
518000 -- [-927.567] (-929.706) (-928.471) (-927.219) * (-926.203) [-927.251] (-927.991) (-927.862) -- 0:00:40
518500 -- [-926.490] (-929.041) (-928.649) (-928.091) * [-929.556] (-927.147) (-931.202) (-927.096) -- 0:00:41
519000 -- (-926.185) (-930.030) [-930.109] (-930.775) * (-932.030) (-927.019) (-929.630) [-928.724] -- 0:00:41
519500 -- [-926.332] (-929.284) (-933.030) (-929.484) * (-932.214) (-928.561) (-926.623) [-930.248] -- 0:00:41
520000 -- (-929.762) (-928.012) [-932.086] (-930.044) * (-938.874) (-928.671) (-926.910) [-931.204] -- 0:00:41
Average standard deviation of split frequencies: 0.012196
520500 -- (-927.081) (-929.358) [-930.389] (-927.741) * (-930.231) [-926.633] (-927.123) (-927.923) -- 0:00:41
521000 -- (-926.683) (-927.399) [-927.529] (-932.002) * (-929.838) (-928.897) [-926.708] (-931.146) -- 0:00:41
521500 -- (-927.280) (-928.127) [-927.288] (-929.752) * (-929.914) (-929.909) (-926.823) [-927.138] -- 0:00:41
522000 -- (-931.498) (-926.130) [-926.576] (-932.153) * (-927.381) (-927.731) [-928.889] (-929.480) -- 0:00:41
522500 -- (-927.607) [-930.493] (-927.584) (-932.409) * (-931.928) [-933.010] (-929.078) (-927.243) -- 0:00:41
523000 -- (-928.096) (-931.960) [-928.722] (-928.358) * (-931.352) (-926.586) (-928.281) [-926.471] -- 0:00:41
523500 -- (-928.996) (-930.122) [-928.404] (-927.919) * (-928.727) (-926.262) [-931.794] (-927.271) -- 0:00:40
524000 -- (-931.987) [-927.640] (-926.746) (-927.183) * [-929.450] (-932.318) (-931.112) (-929.275) -- 0:00:40
524500 -- (-927.433) (-926.078) [-926.284] (-926.043) * (-928.545) [-928.130] (-929.872) (-928.644) -- 0:00:40
525000 -- (-928.648) (-927.129) [-926.209] (-929.755) * [-929.028] (-929.702) (-926.522) (-926.071) -- 0:00:40
Average standard deviation of split frequencies: 0.011900
525500 -- (-927.767) (-927.978) (-926.558) [-926.139] * (-928.867) (-928.405) [-926.774] (-930.737) -- 0:00:40
526000 -- (-927.790) (-927.857) [-926.485] (-925.986) * [-928.499] (-928.150) (-927.838) (-926.460) -- 0:00:40
526500 -- (-926.488) (-930.067) (-926.356) [-926.105] * [-925.882] (-926.684) (-927.001) (-926.940) -- 0:00:40
527000 -- [-929.152] (-927.818) (-927.475) (-926.069) * [-925.934] (-928.005) (-927.172) (-928.466) -- 0:00:40
527500 -- (-928.360) (-930.123) (-928.911) [-927.352] * (-927.963) [-928.851] (-926.901) (-929.712) -- 0:00:40
528000 -- (-928.087) (-926.920) (-927.803) [-929.433] * (-927.705) (-926.520) (-926.445) [-926.371] -- 0:00:40
528500 -- [-926.030] (-929.349) (-930.279) (-928.859) * (-928.223) (-931.760) [-927.468] (-925.759) -- 0:00:40
529000 -- (-926.464) [-927.068] (-926.792) (-927.827) * (-930.301) (-928.232) [-927.520] (-926.393) -- 0:00:40
529500 -- (-927.065) (-927.657) [-926.930] (-927.776) * [-927.049] (-933.341) (-926.141) (-926.212) -- 0:00:39
530000 -- (-926.430) [-928.943] (-932.194) (-927.140) * (-926.044) [-929.912] (-926.784) (-926.212) -- 0:00:39
Average standard deviation of split frequencies: 0.012593
530500 -- [-926.596] (-928.294) (-928.101) (-928.770) * [-926.413] (-931.127) (-930.761) (-926.455) -- 0:00:40
531000 -- [-929.788] (-931.083) (-926.480) (-927.760) * (-926.992) (-928.449) (-928.448) [-925.790] -- 0:00:40
531500 -- (-927.814) (-928.833) [-926.825] (-928.225) * (-928.336) [-926.924] (-928.142) (-927.460) -- 0:00:40
532000 -- (-927.020) (-928.765) [-927.841] (-926.341) * [-928.773] (-925.976) (-930.261) (-927.672) -- 0:00:40
532500 -- [-927.959] (-927.780) (-927.239) (-926.507) * (-930.240) [-926.513] (-928.225) (-927.812) -- 0:00:40
533000 -- [-930.396] (-929.141) (-931.063) (-926.633) * (-930.430) [-926.647] (-929.788) (-928.937) -- 0:00:40
533500 -- (-928.565) (-931.227) [-928.344] (-927.560) * (-928.098) [-929.007] (-928.020) (-931.801) -- 0:00:40
534000 -- (-928.515) [-927.600] (-927.639) (-928.188) * (-932.400) (-929.264) [-928.490] (-932.178) -- 0:00:40
534500 -- (-929.499) (-928.443) [-926.083] (-928.315) * (-928.683) (-931.082) [-928.175] (-933.169) -- 0:00:40
535000 -- (-928.752) (-930.173) [-929.220] (-935.178) * [-929.032] (-928.517) (-929.260) (-933.613) -- 0:00:39
Average standard deviation of split frequencies: 0.012261
535500 -- (-928.060) [-928.939] (-928.835) (-927.758) * (-926.834) [-927.230] (-929.269) (-929.176) -- 0:00:39
536000 -- (-929.111) [-927.365] (-927.563) (-926.872) * (-930.017) (-928.365) (-927.686) [-927.427] -- 0:00:39
536500 -- (-931.170) [-926.654] (-926.340) (-934.614) * (-932.095) [-928.518] (-927.064) (-927.585) -- 0:00:39
537000 -- [-927.493] (-927.327) (-926.375) (-928.936) * (-926.746) (-929.809) [-926.628] (-928.083) -- 0:00:39
537500 -- (-926.659) [-927.253] (-928.705) (-927.710) * (-927.258) (-928.947) [-930.341] (-931.283) -- 0:00:39
538000 -- (-929.436) [-928.786] (-927.684) (-928.856) * (-932.708) [-926.346] (-929.469) (-929.905) -- 0:00:39
538500 -- (-927.380) [-926.475] (-926.856) (-930.733) * (-928.149) [-928.006] (-928.893) (-927.771) -- 0:00:39
539000 -- (-928.713) (-928.380) [-926.535] (-928.472) * (-927.492) [-926.905] (-927.720) (-930.591) -- 0:00:39
539500 -- (-932.707) (-928.462) [-927.333] (-929.161) * (-927.598) (-927.197) [-928.217] (-926.930) -- 0:00:39
540000 -- (-927.580) (-927.387) [-927.013] (-926.907) * (-926.460) [-930.206] (-928.871) (-927.901) -- 0:00:39
Average standard deviation of split frequencies: 0.012412
540500 -- (-927.615) [-927.163] (-929.282) (-929.820) * [-930.520] (-926.329) (-928.232) (-929.081) -- 0:00:39
541000 -- (-929.037) [-926.990] (-927.084) (-929.597) * [-929.528] (-927.239) (-930.544) (-927.763) -- 0:00:39
541500 -- [-927.986] (-927.059) (-928.570) (-929.919) * (-926.425) [-927.542] (-926.634) (-930.975) -- 0:00:38
542000 -- [-928.093] (-925.955) (-928.299) (-926.994) * (-925.951) [-927.910] (-929.399) (-929.245) -- 0:00:38
542500 -- (-926.471) [-926.390] (-927.900) (-927.673) * [-926.641] (-928.306) (-930.036) (-929.245) -- 0:00:39
543000 -- (-928.764) (-926.943) (-927.530) [-930.223] * [-933.659] (-930.178) (-928.451) (-927.407) -- 0:00:39
543500 -- (-926.188) (-928.570) [-929.864] (-930.109) * (-932.892) (-928.132) [-926.963] (-928.912) -- 0:00:39
544000 -- (-927.982) [-928.973] (-929.173) (-928.724) * [-929.824] (-927.958) (-929.951) (-926.964) -- 0:00:39
544500 -- (-926.954) (-927.939) [-929.260] (-928.530) * [-929.701] (-926.541) (-926.276) (-926.186) -- 0:00:39
545000 -- (-926.810) (-927.948) (-926.722) [-926.519] * [-929.845] (-926.655) (-926.561) (-926.304) -- 0:00:39
Average standard deviation of split frequencies: 0.012189
545500 -- (-926.842) (-925.987) [-928.972] (-928.524) * (-931.004) (-927.837) [-926.463] (-926.334) -- 0:00:39
546000 -- (-926.840) [-926.194] (-928.876) (-927.610) * (-937.037) (-927.927) (-928.728) [-928.957] -- 0:00:39
546500 -- [-927.122] (-928.690) (-928.233) (-926.077) * [-929.709] (-926.669) (-928.107) (-929.026) -- 0:00:39
547000 -- (-927.195) [-927.034] (-930.732) (-925.967) * [-925.648] (-928.897) (-927.635) (-926.319) -- 0:00:38
547500 -- (-927.278) (-929.458) (-928.365) [-925.958] * [-926.484] (-927.350) (-927.291) (-925.822) -- 0:00:38
548000 -- (-926.951) (-927.846) (-926.566) [-927.089] * [-928.399] (-927.515) (-927.659) (-926.578) -- 0:00:38
548500 -- (-929.833) (-926.620) [-927.147] (-927.472) * (-929.512) (-928.360) (-928.261) [-927.138] -- 0:00:38
549000 -- (-929.347) (-935.479) [-926.675] (-928.558) * (-931.179) (-929.821) (-931.064) [-926.090] -- 0:00:38
549500 -- (-930.015) (-932.817) [-926.465] (-929.069) * (-930.860) [-931.005] (-927.727) (-926.806) -- 0:00:38
550000 -- (-927.190) (-928.136) [-927.272] (-926.741) * [-928.014] (-929.831) (-928.884) (-929.889) -- 0:00:38
Average standard deviation of split frequencies: 0.012539
550500 -- [-927.136] (-927.512) (-930.207) (-928.875) * [-928.911] (-928.505) (-928.143) (-929.585) -- 0:00:38
551000 -- [-926.344] (-926.237) (-927.093) (-928.845) * (-926.989) (-927.552) [-927.807] (-926.840) -- 0:00:38
551500 -- (-928.679) [-926.614] (-929.433) (-928.988) * [-927.793] (-926.112) (-928.580) (-928.369) -- 0:00:38
552000 -- (-932.831) (-929.572) [-926.898] (-930.566) * (-927.029) [-926.822] (-927.889) (-929.552) -- 0:00:38
552500 -- (-931.754) (-927.761) [-930.760] (-931.334) * [-926.061] (-928.388) (-927.074) (-928.593) -- 0:00:38
553000 -- (-932.332) (-931.201) [-927.132] (-927.697) * (-931.184) (-927.039) [-927.279] (-927.916) -- 0:00:37
553500 -- (-926.821) (-926.816) (-927.795) [-927.765] * (-927.324) (-928.427) [-928.118] (-926.806) -- 0:00:37
554000 -- (-927.501) (-928.916) [-926.514] (-930.924) * (-927.274) (-931.407) [-927.500] (-929.817) -- 0:00:37
554500 -- (-928.066) (-929.445) [-927.306] (-929.600) * (-927.188) (-928.756) [-927.486] (-926.628) -- 0:00:38
555000 -- (-930.907) (-926.321) (-926.853) [-929.704] * (-926.456) (-927.972) (-926.634) [-925.642] -- 0:00:38
Average standard deviation of split frequencies: 0.012069
555500 -- (-929.336) (-927.328) (-927.693) [-928.607] * (-927.528) [-927.639] (-926.260) (-928.154) -- 0:00:38
556000 -- (-926.768) (-928.127) (-931.734) [-926.516] * [-927.845] (-928.090) (-930.092) (-925.995) -- 0:00:38
556500 -- [-927.729] (-930.830) (-930.197) (-928.956) * (-927.319) (-928.289) (-929.688) [-926.172] -- 0:00:38
557000 -- (-927.498) [-929.639] (-927.573) (-927.836) * (-930.275) [-932.313] (-926.549) (-925.794) -- 0:00:38
557500 -- (-927.513) (-930.985) (-928.011) [-927.036] * (-930.642) (-929.398) (-926.873) [-926.867] -- 0:00:38
558000 -- (-928.073) [-927.744] (-926.055) (-925.795) * (-935.447) (-929.293) [-927.568] (-926.403) -- 0:00:38
558500 -- (-929.118) (-932.957) (-928.403) [-927.802] * (-935.105) (-929.181) (-927.570) [-926.752] -- 0:00:37
559000 -- (-928.081) (-929.312) [-925.894] (-926.589) * (-931.686) (-926.503) [-926.901] (-929.093) -- 0:00:37
559500 -- (-927.340) [-926.234] (-927.806) (-930.593) * (-931.923) [-927.651] (-927.974) (-926.922) -- 0:00:37
560000 -- (-932.304) [-926.929] (-930.230) (-927.657) * (-929.789) (-930.305) [-928.274] (-926.214) -- 0:00:37
Average standard deviation of split frequencies: 0.012216
560500 -- [-928.457] (-925.894) (-927.767) (-929.490) * (-927.288) (-930.326) [-929.711] (-929.137) -- 0:00:37
561000 -- (-927.851) (-928.687) (-929.562) [-928.239] * [-930.945] (-929.835) (-928.912) (-927.606) -- 0:00:37
561500 -- (-927.335) (-926.170) (-927.324) [-930.064] * [-927.421] (-931.152) (-925.917) (-926.372) -- 0:00:37
562000 -- (-931.180) (-926.967) [-926.816] (-927.471) * (-927.361) [-925.702] (-925.917) (-926.656) -- 0:00:37
562500 -- (-926.725) (-926.921) [-927.771] (-931.716) * [-928.173] (-928.092) (-929.041) (-929.065) -- 0:00:37
563000 -- [-927.117] (-927.871) (-927.940) (-929.413) * (-927.003) (-927.760) [-926.679] (-929.704) -- 0:00:37
563500 -- [-928.071] (-928.654) (-927.177) (-927.706) * (-926.986) [-928.438] (-925.993) (-927.360) -- 0:00:37
564000 -- (-926.783) (-928.414) [-927.759] (-928.682) * (-929.585) (-928.084) (-926.192) [-928.408] -- 0:00:37
564500 -- [-927.457] (-926.268) (-927.613) (-930.396) * (-930.623) (-929.489) (-927.508) [-927.030] -- 0:00:37
565000 -- (-927.916) (-926.811) (-927.243) [-928.068] * (-928.841) [-926.440] (-928.220) (-926.409) -- 0:00:36
Average standard deviation of split frequencies: 0.011856
565500 -- (-926.463) [-929.406] (-930.290) (-929.543) * (-928.636) [-927.685] (-929.807) (-929.826) -- 0:00:36
566000 -- [-927.636] (-928.159) (-928.717) (-927.343) * (-931.136) [-929.713] (-930.884) (-927.809) -- 0:00:36
566500 -- (-927.300) [-927.670] (-928.114) (-926.972) * (-926.632) (-930.460) (-928.744) [-928.021] -- 0:00:37
567000 -- (-926.223) (-930.521) [-929.270] (-928.890) * (-928.791) (-929.758) (-928.742) [-927.803] -- 0:00:37
567500 -- [-927.496] (-928.509) (-927.310) (-929.912) * (-927.929) (-931.493) (-927.157) [-929.884] -- 0:00:37
568000 -- (-927.446) [-927.364] (-926.416) (-926.572) * (-926.396) (-928.106) [-927.261] (-927.110) -- 0:00:37
568500 -- (-927.764) (-926.858) (-929.849) [-927.561] * [-927.242] (-931.073) (-929.349) (-927.381) -- 0:00:37
569000 -- (-926.981) (-933.217) [-926.508] (-929.551) * [-926.231] (-927.826) (-928.261) (-925.912) -- 0:00:37
569500 -- (-928.743) [-927.157] (-928.109) (-931.098) * (-927.006) (-932.227) (-934.683) [-926.840] -- 0:00:37
570000 -- [-930.474] (-928.188) (-928.235) (-926.756) * (-926.792) (-927.039) (-930.359) [-928.602] -- 0:00:36
Average standard deviation of split frequencies: 0.012488
570500 -- (-928.053) (-931.065) (-927.142) [-929.170] * (-927.787) [-926.382] (-927.791) (-935.479) -- 0:00:36
571000 -- (-926.508) (-926.059) [-927.277] (-926.488) * (-928.329) [-927.553] (-930.318) (-926.530) -- 0:00:36
571500 -- (-927.726) [-926.361] (-927.094) (-929.341) * [-926.753] (-926.440) (-929.206) (-932.800) -- 0:00:36
572000 -- (-926.580) (-929.600) (-926.080) [-928.006] * [-927.150] (-927.978) (-927.118) (-926.648) -- 0:00:36
572500 -- (-928.930) [-927.810] (-927.889) (-929.614) * (-925.905) (-927.268) (-928.241) [-929.580] -- 0:00:36
573000 -- [-928.341] (-929.512) (-928.098) (-929.428) * (-926.917) (-926.095) (-930.439) [-931.450] -- 0:00:36
573500 -- (-928.345) (-928.268) (-928.091) [-927.276] * [-926.763] (-927.740) (-931.433) (-934.818) -- 0:00:36
574000 -- (-932.788) (-928.058) [-932.451] (-927.844) * [-926.666] (-928.506) (-927.170) (-929.958) -- 0:00:36
574500 -- (-932.504) (-929.517) (-930.999) [-926.324] * (-926.793) (-932.086) [-926.716] (-932.773) -- 0:00:36
575000 -- [-926.962] (-926.846) (-928.908) (-928.826) * [-926.402] (-932.863) (-935.711) (-929.464) -- 0:00:36
Average standard deviation of split frequencies: 0.012941
575500 -- (-928.270) [-927.116] (-928.887) (-928.020) * (-927.400) (-929.139) [-928.040] (-929.470) -- 0:00:36
576000 -- (-926.993) (-930.594) (-927.945) [-928.275] * (-927.753) [-928.809] (-927.490) (-929.520) -- 0:00:36
576500 -- (-927.293) (-929.649) [-926.519] (-929.954) * [-928.735] (-927.665) (-927.559) (-930.049) -- 0:00:35
577000 -- (-928.424) (-927.347) [-928.280] (-928.963) * (-929.230) (-928.753) (-929.947) [-930.453] -- 0:00:35
577500 -- (-927.624) (-926.251) (-928.922) [-930.373] * (-926.191) (-930.302) [-931.042] (-931.357) -- 0:00:35
578000 -- (-927.112) (-927.254) (-927.147) [-926.696] * (-930.214) (-933.928) [-927.062] (-929.604) -- 0:00:35
578500 -- (-928.012) [-926.019] (-927.337) (-925.993) * [-926.668] (-930.688) (-928.524) (-928.334) -- 0:00:36
579000 -- (-929.105) [-926.259] (-929.627) (-930.465) * (-930.095) [-926.664] (-927.339) (-927.143) -- 0:00:36
579500 -- (-928.792) [-926.885] (-929.625) (-927.310) * (-928.367) [-927.704] (-930.878) (-929.851) -- 0:00:36
580000 -- (-928.408) (-926.885) (-927.357) [-925.964] * [-926.983] (-927.172) (-926.727) (-927.613) -- 0:00:36
Average standard deviation of split frequencies: 0.013497
580500 -- (-928.894) (-926.171) [-925.808] (-926.169) * [-927.427] (-926.044) (-926.711) (-927.911) -- 0:00:36
581000 -- (-926.096) [-926.195] (-926.620) (-926.994) * [-926.316] (-926.159) (-926.715) (-932.078) -- 0:00:36
581500 -- (-929.273) (-931.065) (-928.749) [-930.602] * [-926.269] (-926.305) (-927.569) (-927.604) -- 0:00:35
582000 -- [-927.950] (-928.634) (-925.857) (-927.571) * (-927.748) (-927.373) (-926.689) [-929.145] -- 0:00:35
582500 -- [-928.202] (-928.640) (-927.085) (-929.708) * (-930.982) [-926.802] (-927.429) (-931.616) -- 0:00:35
583000 -- (-927.134) (-929.794) [-929.128] (-927.183) * (-930.575) (-926.956) [-926.602] (-926.555) -- 0:00:35
583500 -- [-928.725] (-927.756) (-928.786) (-928.235) * (-929.339) (-930.688) (-928.571) [-926.555] -- 0:00:35
584000 -- (-928.722) (-931.136) (-932.285) [-928.222] * (-933.997) [-926.682] (-928.706) (-927.869) -- 0:00:35
584500 -- [-928.208] (-926.519) (-930.275) (-928.512) * (-928.395) (-927.817) (-928.268) [-928.912] -- 0:00:35
585000 -- (-929.593) (-926.025) (-930.850) [-927.155] * [-929.852] (-927.414) (-925.785) (-928.833) -- 0:00:35
Average standard deviation of split frequencies: 0.012921
585500 -- (-930.096) (-928.174) (-927.034) [-928.200] * (-928.679) (-929.143) (-928.206) [-928.970] -- 0:00:35
586000 -- (-926.729) [-926.684] (-929.335) (-929.173) * [-928.067] (-929.969) (-931.258) (-928.657) -- 0:00:35
586500 -- [-926.977] (-928.168) (-927.068) (-933.372) * [-927.260] (-930.509) (-928.164) (-929.051) -- 0:00:35
587000 -- (-927.141) (-926.795) [-928.612] (-926.392) * (-932.327) (-927.930) (-926.644) [-928.529] -- 0:00:35
587500 -- (-926.680) (-926.659) [-927.865] (-928.317) * (-928.747) (-929.277) [-926.969] (-927.777) -- 0:00:35
588000 -- [-927.903] (-927.302) (-927.605) (-931.302) * (-927.769) [-931.031] (-931.227) (-927.504) -- 0:00:35
588500 -- (-929.878) (-928.043) [-928.881] (-927.506) * (-929.880) (-929.792) (-926.753) [-928.026] -- 0:00:34
589000 -- (-927.529) (-927.528) [-929.715] (-928.157) * (-931.643) [-928.568] (-926.664) (-930.870) -- 0:00:34
589500 -- (-930.126) (-929.496) (-930.404) [-926.196] * (-931.720) (-927.201) (-928.391) [-928.369] -- 0:00:34
590000 -- (-926.478) (-928.439) (-929.893) [-931.216] * (-928.686) (-931.121) [-926.945] (-927.533) -- 0:00:34
Average standard deviation of split frequencies: 0.013368
590500 -- (-929.943) [-928.590] (-927.579) (-927.297) * (-928.248) [-930.217] (-926.108) (-931.112) -- 0:00:35
591000 -- (-928.785) (-931.730) (-930.079) [-926.668] * [-926.892] (-927.071) (-925.986) (-933.791) -- 0:00:35
591500 -- (-930.179) (-931.156) (-926.559) [-927.143] * (-928.583) (-926.603) [-929.963] (-930.879) -- 0:00:35
592000 -- [-926.204] (-929.346) (-926.166) (-928.390) * (-927.284) [-931.128] (-933.400) (-928.771) -- 0:00:35
592500 -- [-926.319] (-931.098) (-927.440) (-927.686) * (-928.644) [-927.044] (-926.489) (-927.447) -- 0:00:35
593000 -- [-926.748] (-927.297) (-928.695) (-929.584) * (-931.692) (-929.653) (-927.944) [-926.530] -- 0:00:35
593500 -- [-926.795] (-928.588) (-927.989) (-926.818) * (-926.750) (-929.992) (-927.216) [-926.035] -- 0:00:34
594000 -- [-935.747] (-930.342) (-927.151) (-929.172) * (-927.021) (-928.792) [-927.419] (-927.594) -- 0:00:34
594500 -- (-932.036) [-926.965] (-927.279) (-930.993) * [-927.341] (-926.621) (-929.352) (-928.096) -- 0:00:34
595000 -- (-926.442) (-928.723) (-926.597) [-929.034] * (-929.467) (-927.370) [-927.209] (-927.538) -- 0:00:34
Average standard deviation of split frequencies: 0.012902
595500 -- (-928.896) (-926.289) (-927.267) [-926.515] * (-934.513) (-927.195) (-928.633) [-926.327] -- 0:00:34
596000 -- (-928.520) (-928.486) [-930.313] (-930.424) * [-927.941] (-928.341) (-929.755) (-926.352) -- 0:00:34
596500 -- (-926.274) (-929.780) [-930.442] (-929.701) * (-927.476) [-930.949] (-927.115) (-926.139) -- 0:00:34
597000 -- (-927.697) (-928.204) [-928.612] (-928.421) * (-928.585) (-930.463) (-927.425) [-928.044] -- 0:00:34
597500 -- (-930.765) (-926.702) (-926.237) [-930.704] * [-927.741] (-928.184) (-927.777) (-928.909) -- 0:00:34
598000 -- (-928.740) [-925.893] (-929.582) (-928.535) * (-929.128) [-931.589] (-927.777) (-927.361) -- 0:00:34
598500 -- [-926.872] (-926.853) (-928.415) (-928.861) * [-928.722] (-929.593) (-926.227) (-928.841) -- 0:00:34
599000 -- (-930.610) (-930.790) (-927.012) [-927.398] * (-928.711) [-926.962] (-927.755) (-926.856) -- 0:00:34
599500 -- [-927.402] (-930.022) (-927.986) (-926.932) * (-926.225) [-926.426] (-929.715) (-927.930) -- 0:00:34
600000 -- [-928.371] (-929.246) (-929.146) (-926.435) * (-928.092) (-929.158) [-928.841] (-928.907) -- 0:00:34
Average standard deviation of split frequencies: 0.012753
600500 -- (-929.217) (-929.194) (-927.774) [-927.072] * (-927.282) [-926.031] (-931.812) (-926.113) -- 0:00:33
601000 -- (-926.764) (-926.793) (-928.540) [-926.853] * (-930.552) (-926.046) [-933.174] (-929.434) -- 0:00:33
601500 -- [-926.517] (-926.211) (-930.129) (-931.558) * [-926.929] (-927.219) (-927.221) (-926.375) -- 0:00:33
602000 -- (-929.089) [-926.018] (-931.711) (-928.305) * (-927.410) (-925.854) (-930.092) [-928.828] -- 0:00:33
602500 -- (-928.806) [-927.434] (-929.213) (-927.100) * (-926.277) (-930.048) (-934.295) [-927.130] -- 0:00:34
603000 -- (-928.130) (-926.988) [-927.396] (-930.295) * (-926.852) (-930.444) [-927.865] (-926.945) -- 0:00:34
603500 -- (-927.717) [-926.294] (-927.785) (-930.582) * (-926.961) (-932.165) (-927.205) [-928.583] -- 0:00:34
604000 -- [-926.250] (-928.019) (-926.906) (-929.929) * (-926.731) [-927.513] (-926.522) (-927.734) -- 0:00:34
604500 -- [-927.003] (-929.664) (-927.808) (-930.953) * (-928.385) (-928.499) [-927.684] (-928.888) -- 0:00:34
605000 -- [-926.314] (-926.253) (-926.902) (-930.637) * (-925.917) [-926.073] (-927.552) (-926.643) -- 0:00:33
Average standard deviation of split frequencies: 0.012592
605500 -- (-927.318) [-926.651] (-929.053) (-928.589) * [-925.952] (-928.008) (-929.979) (-926.498) -- 0:00:33
606000 -- (-927.177) [-926.207] (-926.194) (-929.998) * (-927.476) [-927.367] (-928.012) (-932.253) -- 0:00:33
606500 -- (-931.090) (-926.413) (-928.273) [-929.790] * [-928.638] (-927.671) (-929.977) (-928.155) -- 0:00:33
607000 -- (-932.365) (-925.838) (-926.540) [-926.980] * (-927.960) (-928.731) (-930.193) [-927.080] -- 0:00:33
607500 -- (-930.528) (-931.792) [-928.994] (-926.559) * (-928.320) (-930.620) (-927.822) [-927.844] -- 0:00:33
608000 -- (-931.165) (-928.798) (-931.795) [-927.324] * (-930.723) [-929.368] (-929.087) (-926.389) -- 0:00:33
608500 -- (-931.305) (-926.829) [-926.645] (-928.109) * [-926.052] (-931.900) (-930.403) (-928.362) -- 0:00:33
609000 -- (-928.466) (-928.005) (-928.628) [-933.729] * (-926.196) (-931.933) [-927.984] (-927.569) -- 0:00:33
609500 -- (-928.409) [-927.073] (-928.901) (-931.400) * (-928.125) [-932.708] (-929.399) (-926.965) -- 0:00:33
610000 -- (-927.591) (-929.369) (-929.223) [-928.166] * [-925.715] (-928.669) (-929.276) (-926.952) -- 0:00:33
Average standard deviation of split frequencies: 0.011917
610500 -- (-927.202) (-929.616) (-926.803) [-927.430] * (-926.652) [-926.370] (-929.565) (-930.597) -- 0:00:33
611000 -- (-927.691) (-930.408) (-930.952) [-928.493] * (-926.650) (-925.873) [-929.326] (-928.278) -- 0:00:33
611500 -- (-927.663) (-929.590) (-927.916) [-926.461] * [-925.896] (-927.769) (-926.438) (-926.865) -- 0:00:33
612000 -- [-931.335] (-930.259) (-926.965) (-926.600) * [-926.748] (-930.296) (-929.760) (-926.589) -- 0:00:32
612500 -- [-926.860] (-930.850) (-928.537) (-928.319) * (-929.841) (-930.957) [-927.008] (-928.667) -- 0:00:32
613000 -- [-927.535] (-926.424) (-926.557) (-926.206) * (-928.428) [-927.790] (-926.242) (-926.375) -- 0:00:32
613500 -- [-926.257] (-926.896) (-926.227) (-927.128) * [-927.197] (-930.457) (-926.527) (-926.261) -- 0:00:32
614000 -- (-932.597) [-927.321] (-926.473) (-926.516) * [-927.978] (-927.366) (-928.240) (-926.405) -- 0:00:32
614500 -- (-927.245) (-928.991) (-927.337) [-930.155] * (-927.134) (-927.097) (-930.067) [-926.800] -- 0:00:33
615000 -- (-926.421) (-932.997) [-928.529] (-928.771) * (-931.164) (-928.723) [-928.407] (-928.669) -- 0:00:33
Average standard deviation of split frequencies: 0.012149
615500 -- (-927.249) (-927.293) [-927.916] (-926.618) * (-929.764) (-929.672) (-927.677) [-927.109] -- 0:00:33
616000 -- [-928.430] (-927.769) (-927.025) (-928.572) * (-935.882) (-927.990) [-926.643] (-926.982) -- 0:00:33
616500 -- (-928.157) (-930.494) [-927.721] (-931.709) * [-927.463] (-926.035) (-929.205) (-927.182) -- 0:00:32
617000 -- [-927.153] (-925.665) (-927.784) (-928.481) * (-929.526) [-930.184] (-927.023) (-926.177) -- 0:00:32
617500 -- (-929.811) (-926.524) [-929.135] (-927.212) * (-929.282) (-928.406) [-927.966] (-930.492) -- 0:00:32
618000 -- (-929.619) [-929.082] (-927.075) (-928.555) * (-926.732) (-928.612) [-927.039] (-930.343) -- 0:00:32
618500 -- [-926.902] (-928.898) (-928.823) (-927.835) * (-928.006) (-927.102) [-927.553] (-929.153) -- 0:00:32
619000 -- [-928.798] (-929.339) (-927.477) (-927.694) * (-927.267) (-928.195) (-928.975) [-928.545] -- 0:00:32
619500 -- (-928.103) (-927.161) [-929.485] (-927.709) * [-926.435] (-927.703) (-929.821) (-929.810) -- 0:00:32
620000 -- [-925.892] (-930.154) (-927.418) (-926.651) * (-930.082) [-927.017] (-926.890) (-928.367) -- 0:00:32
Average standard deviation of split frequencies: 0.012390
620500 -- (-927.088) (-930.681) [-927.308] (-926.679) * [-927.396] (-926.737) (-928.644) (-932.432) -- 0:00:32
621000 -- [-927.100] (-927.938) (-927.006) (-926.858) * (-932.187) (-927.711) [-927.863] (-928.683) -- 0:00:32
621500 -- [-929.567] (-926.955) (-929.282) (-934.602) * (-935.145) (-927.570) (-930.325) [-929.640] -- 0:00:32
622000 -- (-926.488) [-926.373] (-927.061) (-933.560) * (-927.953) [-929.769] (-927.866) (-926.418) -- 0:00:32
622500 -- [-928.378] (-927.237) (-927.674) (-932.882) * (-930.011) (-926.973) [-926.331] (-931.669) -- 0:00:32
623000 -- [-929.230] (-930.199) (-929.118) (-929.029) * (-928.830) [-927.065] (-929.494) (-928.172) -- 0:00:32
623500 -- (-933.596) (-930.579) (-928.563) [-928.927] * [-928.325] (-929.332) (-929.464) (-928.144) -- 0:00:32
624000 -- (-927.306) [-926.597] (-933.454) (-927.334) * (-928.557) (-928.221) (-929.942) [-928.477] -- 0:00:31
624500 -- (-928.235) [-931.212] (-927.639) (-927.264) * [-929.074] (-928.842) (-932.244) (-929.739) -- 0:00:31
625000 -- (-927.062) [-927.456] (-930.251) (-928.710) * [-926.437] (-928.780) (-930.433) (-927.643) -- 0:00:31
Average standard deviation of split frequencies: 0.012378
625500 -- [-928.013] (-926.964) (-930.056) (-930.751) * (-926.111) (-928.963) [-929.939] (-932.888) -- 0:00:31
626000 -- (-927.730) (-927.945) [-928.034] (-928.748) * (-927.625) (-928.402) [-928.397] (-927.264) -- 0:00:31
626500 -- [-927.500] (-929.983) (-930.118) (-929.942) * (-927.910) (-931.221) [-928.739] (-929.366) -- 0:00:32
627000 -- (-926.922) (-926.922) (-927.086) [-927.265] * [-930.108] (-926.631) (-929.240) (-930.181) -- 0:00:32
627500 -- (-926.001) [-927.471] (-928.981) (-926.367) * [-928.774] (-927.869) (-928.706) (-930.789) -- 0:00:32
628000 -- (-926.003) (-933.607) [-928.180] (-926.159) * (-927.252) [-926.713] (-927.205) (-928.735) -- 0:00:31
628500 -- [-927.976] (-927.138) (-927.891) (-926.998) * (-929.791) (-929.083) (-928.003) [-928.796] -- 0:00:31
629000 -- [-928.013] (-927.104) (-930.306) (-929.052) * (-927.963) (-928.152) (-926.873) [-930.789] -- 0:00:31
629500 -- (-933.517) [-927.405] (-929.502) (-927.622) * (-930.057) [-929.673] (-927.552) (-929.199) -- 0:00:31
630000 -- (-928.727) (-929.851) [-930.396] (-928.236) * (-928.586) (-929.250) (-927.407) [-927.855] -- 0:00:31
Average standard deviation of split frequencies: 0.012520
630500 -- [-927.743] (-927.255) (-926.073) (-929.400) * (-927.613) (-926.761) (-929.381) [-931.902] -- 0:00:31
631000 -- (-927.444) (-928.246) [-926.884] (-926.046) * (-927.067) [-930.450] (-929.446) (-930.741) -- 0:00:31
631500 -- (-927.922) (-926.709) [-926.970] (-927.807) * (-929.034) (-938.354) (-929.229) [-925.926] -- 0:00:31
632000 -- (-927.544) (-926.361) [-927.644] (-927.300) * (-928.291) [-929.782] (-933.814) (-928.719) -- 0:00:31
632500 -- (-926.788) (-926.304) [-927.233] (-928.116) * [-926.719] (-926.083) (-930.029) (-929.446) -- 0:00:31
633000 -- [-926.787] (-927.878) (-927.958) (-928.101) * (-926.115) (-927.643) (-933.707) [-928.363] -- 0:00:31
633500 -- (-930.516) (-928.492) (-927.938) [-927.516] * [-925.892] (-926.811) (-930.147) (-929.198) -- 0:00:31
634000 -- (-927.316) [-926.155] (-927.346) (-929.511) * (-927.927) [-927.037] (-927.088) (-926.727) -- 0:00:31
634500 -- (-929.629) [-925.921] (-927.390) (-933.281) * [-931.862] (-928.577) (-927.304) (-927.630) -- 0:00:31
635000 -- (-926.473) (-927.074) (-930.251) [-929.214] * (-928.455) (-929.744) (-927.946) [-927.226] -- 0:00:31
Average standard deviation of split frequencies: 0.012322
635500 -- (-926.998) (-927.320) [-927.898] (-927.656) * (-928.933) (-930.645) [-927.601] (-931.011) -- 0:00:30
636000 -- (-928.048) (-929.694) (-929.981) [-930.567] * (-929.029) (-926.872) (-927.021) [-926.801] -- 0:00:30
636500 -- [-928.052] (-928.767) (-930.509) (-927.342) * (-927.550) (-927.067) (-927.174) [-933.374] -- 0:00:30
637000 -- (-928.826) (-927.475) [-926.530] (-926.521) * (-928.998) (-930.424) [-927.143] (-932.967) -- 0:00:30
637500 -- [-928.041] (-925.882) (-927.401) (-926.664) * (-927.742) [-930.308] (-927.240) (-929.838) -- 0:00:30
638000 -- (-928.303) (-927.971) [-926.584] (-926.682) * (-926.642) (-925.935) (-929.385) [-926.437] -- 0:00:30
638500 -- (-927.683) (-926.423) (-928.028) [-930.175] * (-929.212) (-925.967) (-929.085) [-926.122] -- 0:00:31
639000 -- (-930.704) (-929.749) (-931.246) [-927.671] * [-929.053] (-926.048) (-934.402) (-929.231) -- 0:00:31
639500 -- (-926.804) (-927.658) [-929.133] (-929.540) * (-931.863) (-926.772) [-926.496] (-927.718) -- 0:00:31
640000 -- [-926.597] (-927.387) (-931.699) (-929.703) * (-929.249) [-926.215] (-929.340) (-927.175) -- 0:00:30
Average standard deviation of split frequencies: 0.011497
640500 -- (-930.631) (-928.101) (-927.227) [-927.899] * (-927.425) (-930.735) (-927.175) [-926.829] -- 0:00:30
641000 -- (-927.926) (-925.875) [-926.038] (-927.108) * [-926.464] (-935.509) (-927.044) (-930.618) -- 0:00:30
641500 -- (-926.364) (-927.173) (-926.474) [-930.414] * (-927.902) [-929.946] (-926.456) (-929.679) -- 0:00:30
642000 -- (-926.452) (-926.759) [-927.678] (-927.423) * (-930.428) [-927.305] (-932.814) (-929.763) -- 0:00:30
642500 -- (-930.423) [-928.274] (-927.440) (-927.597) * [-930.983] (-928.852) (-927.388) (-928.824) -- 0:00:30
643000 -- (-933.890) [-926.330] (-930.770) (-927.777) * [-927.810] (-926.696) (-927.229) (-928.476) -- 0:00:30
643500 -- (-932.071) (-927.025) (-928.128) [-927.172] * (-927.982) (-928.514) (-934.233) [-925.641] -- 0:00:30
644000 -- (-927.093) [-926.561] (-926.300) (-926.556) * (-926.655) (-926.594) (-933.469) [-925.641] -- 0:00:30
644500 -- (-928.644) [-927.255] (-926.599) (-926.411) * (-928.722) [-926.736] (-928.055) (-925.643) -- 0:00:30
645000 -- (-929.959) (-926.740) (-926.836) [-926.711] * (-929.530) (-930.424) (-927.099) [-925.883] -- 0:00:30
Average standard deviation of split frequencies: 0.010654
645500 -- [-929.709] (-927.560) (-929.057) (-928.948) * (-927.153) [-931.254] (-926.325) (-927.467) -- 0:00:30
646000 -- (-927.858) (-929.107) [-929.626] (-930.364) * (-926.289) (-929.139) (-928.812) [-927.502] -- 0:00:30
646500 -- [-930.937] (-928.468) (-927.418) (-929.180) * (-929.307) (-928.591) [-927.935] (-928.804) -- 0:00:30
647000 -- [-929.259] (-928.931) (-926.987) (-929.139) * [-927.838] (-928.581) (-929.226) (-930.400) -- 0:00:30
647500 -- [-929.243] (-928.367) (-930.003) (-927.226) * (-927.048) [-929.103] (-927.112) (-930.920) -- 0:00:29
648000 -- (-927.514) (-931.530) (-929.338) [-926.775] * (-926.933) (-927.962) [-927.064] (-929.786) -- 0:00:29
648500 -- (-931.260) (-926.669) (-930.647) [-929.503] * [-927.923] (-926.698) (-927.213) (-927.263) -- 0:00:29
649000 -- [-927.292] (-926.647) (-928.794) (-929.463) * (-927.953) [-926.187] (-928.888) (-928.295) -- 0:00:29
649500 -- (-927.295) (-926.647) [-928.443] (-929.494) * (-928.514) [-926.383] (-928.172) (-932.757) -- 0:00:29
650000 -- [-930.675] (-926.258) (-928.173) (-931.832) * (-929.496) (-926.730) (-927.829) [-926.211] -- 0:00:29
Average standard deviation of split frequencies: 0.010191
650500 -- [-926.307] (-929.043) (-928.349) (-926.861) * (-928.974) (-930.010) (-927.720) [-926.683] -- 0:00:30
651000 -- (-927.670) (-925.892) [-928.011] (-927.057) * (-930.960) (-926.533) [-926.128] (-929.237) -- 0:00:30
651500 -- [-926.464] (-929.740) (-928.216) (-927.594) * (-926.760) (-928.162) [-928.001] (-929.278) -- 0:00:29
652000 -- (-926.100) (-932.334) [-927.164] (-926.931) * [-926.729] (-927.773) (-927.035) (-927.599) -- 0:00:29
652500 -- (-926.247) [-926.211] (-927.365) (-926.704) * [-928.046] (-929.776) (-928.652) (-929.582) -- 0:00:29
653000 -- (-927.075) [-926.123] (-929.079) (-928.053) * (-928.526) (-927.393) (-927.714) [-929.690] -- 0:00:29
653500 -- [-931.017] (-926.123) (-929.845) (-927.673) * (-927.559) (-932.507) (-928.318) [-928.700] -- 0:00:29
654000 -- (-929.823) [-926.869] (-932.914) (-927.572) * [-929.253] (-930.382) (-929.388) (-928.324) -- 0:00:29
654500 -- [-927.249] (-930.559) (-928.508) (-926.616) * (-927.363) (-928.825) [-929.818] (-932.894) -- 0:00:29
655000 -- (-927.431) [-926.139] (-930.042) (-927.640) * (-930.825) (-929.256) [-926.999] (-929.123) -- 0:00:29
Average standard deviation of split frequencies: 0.010396
655500 -- (-928.382) [-928.194] (-927.516) (-928.248) * (-927.149) [-928.856] (-928.403) (-929.786) -- 0:00:29
656000 -- (-928.373) (-930.295) (-927.815) [-927.032] * (-926.886) (-926.594) (-926.831) [-931.189] -- 0:00:29
656500 -- (-926.686) (-930.334) (-926.936) [-928.441] * (-926.883) [-929.558] (-928.600) (-928.063) -- 0:00:29
657000 -- (-927.540) (-929.975) (-931.746) [-927.456] * [-929.976] (-927.236) (-929.096) (-929.421) -- 0:00:29
657500 -- [-925.865] (-930.448) (-926.634) (-928.243) * [-927.440] (-927.431) (-926.634) (-928.412) -- 0:00:29
658000 -- (-931.487) (-929.283) (-927.390) [-927.152] * (-928.088) (-925.969) (-928.423) [-932.196] -- 0:00:29
658500 -- [-926.291] (-931.497) (-929.881) (-927.896) * (-927.699) [-927.489] (-927.874) (-930.062) -- 0:00:29
659000 -- (-930.779) [-928.538] (-927.962) (-929.476) * [-929.201] (-926.860) (-926.482) (-928.684) -- 0:00:28
659500 -- (-926.424) (-928.717) (-927.909) [-926.736] * (-926.567) (-925.844) (-927.611) [-928.994] -- 0:00:28
660000 -- (-928.091) (-928.733) [-926.889] (-928.882) * (-926.768) (-925.891) (-927.432) [-932.025] -- 0:00:28
Average standard deviation of split frequencies: 0.010418
660500 -- (-929.954) (-927.802) [-928.080] (-926.421) * (-926.574) [-927.111] (-929.125) (-928.015) -- 0:00:28
661000 -- [-928.038] (-926.993) (-929.104) (-926.502) * (-927.162) (-929.840) [-926.342] (-927.030) -- 0:00:28
661500 -- (-930.591) [-928.505] (-927.593) (-927.833) * (-932.520) [-928.444] (-931.486) (-928.689) -- 0:00:28
662000 -- [-929.039] (-929.652) (-926.566) (-929.946) * [-929.516] (-928.034) (-930.942) (-933.592) -- 0:00:28
662500 -- (-925.744) (-927.844) [-926.350] (-930.197) * [-932.046] (-929.238) (-932.172) (-927.240) -- 0:00:29
663000 -- (-927.886) (-931.133) (-927.818) [-927.709] * [-929.419] (-927.704) (-930.918) (-927.623) -- 0:00:28
663500 -- (-928.123) [-931.912] (-929.433) (-927.363) * (-931.299) [-926.690] (-932.758) (-928.473) -- 0:00:28
664000 -- (-927.385) (-926.848) [-928.776] (-927.375) * (-927.666) (-927.308) [-926.920] (-928.095) -- 0:00:28
664500 -- (-928.603) [-926.541] (-930.803) (-929.992) * (-927.616) [-930.072] (-926.211) (-927.347) -- 0:00:28
665000 -- (-931.209) (-933.501) [-929.274] (-929.643) * [-927.428] (-932.134) (-928.721) (-928.441) -- 0:00:28
Average standard deviation of split frequencies: 0.010712
665500 -- (-929.681) [-926.520] (-926.490) (-927.682) * (-931.231) [-929.959] (-928.773) (-928.989) -- 0:00:28
666000 -- (-928.954) (-935.142) [-926.325] (-929.359) * (-929.477) (-926.878) (-927.057) [-929.373] -- 0:00:28
666500 -- (-929.753) (-929.951) [-927.707] (-929.983) * [-929.117] (-926.556) (-929.658) (-928.701) -- 0:00:28
667000 -- (-928.075) (-934.174) (-931.255) [-927.153] * (-929.979) [-928.685] (-929.033) (-930.828) -- 0:00:28
667500 -- (-926.367) [-927.413] (-927.794) (-928.220) * (-927.158) (-927.932) [-928.132] (-928.805) -- 0:00:28
668000 -- (-927.060) [-928.501] (-927.820) (-928.219) * (-927.365) (-932.888) [-927.519] (-928.349) -- 0:00:28
668500 -- [-929.168] (-928.815) (-930.646) (-927.983) * [-926.968] (-931.561) (-927.705) (-932.148) -- 0:00:28
669000 -- (-933.562) [-928.496] (-928.777) (-928.960) * [-928.936] (-929.285) (-927.510) (-929.225) -- 0:00:28
669500 -- (-934.729) (-929.747) (-928.935) [-928.492] * (-931.181) (-926.957) [-927.023] (-929.319) -- 0:00:28
670000 -- (-929.317) (-928.262) (-926.506) [-926.706] * (-930.788) (-927.746) [-928.251] (-928.055) -- 0:00:28
Average standard deviation of split frequencies: 0.010637
670500 -- (-929.578) (-929.238) [-926.478] (-926.043) * (-927.036) (-926.359) [-928.688] (-930.190) -- 0:00:28
671000 -- (-929.750) (-927.354) (-928.263) [-928.137] * (-926.902) (-926.732) [-929.225] (-926.256) -- 0:00:27
671500 -- (-931.023) (-931.843) (-929.910) [-927.841] * (-928.022) (-927.939) (-927.408) [-928.227] -- 0:00:27
672000 -- (-933.408) (-934.257) (-927.510) [-927.981] * (-927.242) [-928.778] (-926.700) (-929.154) -- 0:00:27
672500 -- [-931.306] (-927.465) (-928.063) (-927.328) * [-926.639] (-928.060) (-926.265) (-927.202) -- 0:00:27
673000 -- (-930.911) (-926.130) [-927.975] (-926.895) * (-929.049) (-926.440) [-926.810] (-927.781) -- 0:00:27
673500 -- (-927.889) (-929.756) (-928.764) [-929.697] * [-927.596] (-928.877) (-929.252) (-930.672) -- 0:00:27
674000 -- (-926.340) [-930.226] (-932.875) (-929.638) * (-927.057) (-928.673) [-926.290] (-928.817) -- 0:00:27
674500 -- (-926.459) (-927.732) (-928.409) [-926.246] * (-927.260) (-927.428) [-927.303] (-928.019) -- 0:00:27
675000 -- [-926.796] (-928.480) (-927.885) (-928.681) * (-927.914) (-927.049) (-928.832) [-928.795] -- 0:00:27
Average standard deviation of split frequencies: 0.010460
675500 -- (-930.009) (-927.030) (-928.365) [-926.208] * (-928.181) [-928.950] (-933.278) (-928.824) -- 0:00:27
676000 -- (-930.167) [-929.584] (-930.273) (-926.738) * (-928.123) (-928.184) (-930.482) [-928.464] -- 0:00:27
676500 -- (-929.739) (-927.070) [-927.933] (-927.033) * [-931.255] (-929.618) (-927.103) (-929.083) -- 0:00:27
677000 -- [-927.107] (-927.947) (-926.757) (-927.035) * (-929.670) (-927.751) [-926.564] (-926.631) -- 0:00:27
677500 -- [-929.957] (-928.932) (-927.541) (-926.730) * [-926.485] (-926.500) (-928.537) (-926.641) -- 0:00:27
678000 -- (-929.022) [-926.417] (-929.034) (-927.110) * (-929.695) (-926.318) (-928.966) [-931.143] -- 0:00:27
678500 -- [-926.878] (-930.047) (-927.555) (-926.635) * (-930.918) (-926.630) (-928.592) [-926.060] -- 0:00:27
679000 -- [-929.631] (-927.049) (-931.207) (-926.439) * [-928.584] (-927.251) (-926.264) (-929.924) -- 0:00:27
679500 -- (-928.392) (-928.815) (-929.037) [-926.515] * (-935.292) [-926.677] (-927.002) (-926.388) -- 0:00:27
680000 -- [-929.170] (-926.804) (-927.134) (-926.865) * (-929.160) (-928.104) [-927.519] (-926.186) -- 0:00:27
Average standard deviation of split frequencies: 0.010619
680500 -- [-926.199] (-929.186) (-927.074) (-926.904) * (-929.690) (-930.279) (-928.053) [-926.515] -- 0:00:27
681000 -- (-927.004) [-926.063] (-926.740) (-932.523) * (-932.087) (-929.462) [-927.804] (-929.831) -- 0:00:27
681500 -- [-927.139] (-926.054) (-926.498) (-928.343) * (-926.398) (-928.376) [-926.322] (-933.630) -- 0:00:27
682000 -- [-927.378] (-928.928) (-927.010) (-929.027) * (-926.200) (-933.757) [-928.575] (-931.196) -- 0:00:27
682500 -- (-928.870) (-928.361) (-928.471) [-926.589] * [-927.191] (-929.128) (-928.074) (-927.945) -- 0:00:26
683000 -- (-926.979) (-929.263) [-929.247] (-926.731) * (-927.833) [-927.868] (-932.196) (-929.627) -- 0:00:26
683500 -- (-928.742) [-928.850] (-928.968) (-928.049) * (-926.772) [-928.145] (-928.158) (-930.435) -- 0:00:26
684000 -- (-927.074) (-929.038) (-928.953) [-930.015] * (-926.649) [-930.157] (-927.527) (-933.615) -- 0:00:26
684500 -- [-925.890] (-928.787) (-926.843) (-929.645) * (-929.957) (-928.902) (-928.867) [-928.251] -- 0:00:26
685000 -- (-926.255) [-926.188] (-929.414) (-929.193) * [-931.532] (-928.418) (-927.201) (-930.715) -- 0:00:26
Average standard deviation of split frequencies: 0.010720
685500 -- (-929.362) (-927.526) (-928.889) [-926.495] * (-929.776) (-927.082) [-926.468] (-928.094) -- 0:00:26
686000 -- (-934.459) [-927.396] (-927.193) (-930.787) * (-930.445) (-932.631) [-927.769] (-929.227) -- 0:00:26
686500 -- (-929.950) [-928.193] (-927.529) (-927.101) * (-930.520) (-928.018) [-926.970] (-934.493) -- 0:00:26
687000 -- (-927.132) (-933.226) [-927.358] (-928.324) * [-928.217] (-928.137) (-926.157) (-930.982) -- 0:00:26
687500 -- (-927.970) (-934.433) (-925.955) [-930.522] * [-926.793] (-928.472) (-926.556) (-930.740) -- 0:00:26
688000 -- (-928.174) [-928.622] (-928.310) (-928.070) * [-928.896] (-934.197) (-926.899) (-929.017) -- 0:00:26
688500 -- (-929.117) (-928.002) [-929.402] (-927.381) * [-928.261] (-933.241) (-928.347) (-929.640) -- 0:00:26
689000 -- [-928.810] (-930.909) (-927.166) (-927.815) * (-927.736) (-930.126) [-930.373] (-929.783) -- 0:00:26
689500 -- (-927.092) (-930.995) [-926.480] (-936.639) * (-927.499) [-928.826] (-928.973) (-928.082) -- 0:00:26
690000 -- (-927.675) [-928.723] (-925.971) (-934.173) * [-928.251] (-930.440) (-926.861) (-927.829) -- 0:00:26
Average standard deviation of split frequencies: 0.011012
690500 -- (-928.026) (-926.450) [-925.897] (-926.074) * (-928.322) (-931.001) (-926.501) [-928.210] -- 0:00:26
691000 -- (-927.582) [-927.532] (-926.427) (-934.593) * [-926.915] (-929.029) (-926.564) (-928.460) -- 0:00:26
691500 -- (-932.384) (-932.486) [-927.244] (-929.496) * (-926.962) [-926.052] (-927.473) (-931.310) -- 0:00:26
692000 -- [-929.531] (-928.901) (-927.660) (-927.875) * (-926.397) [-926.414] (-926.535) (-928.032) -- 0:00:26
692500 -- (-928.030) [-927.028] (-927.044) (-926.968) * (-927.296) [-928.394] (-927.795) (-927.617) -- 0:00:26
693000 -- (-926.636) (-926.939) [-926.534] (-929.779) * (-926.168) (-930.145) (-930.808) [-927.509] -- 0:00:26
693500 -- (-931.352) [-925.670] (-927.019) (-931.090) * (-927.628) [-929.236] (-932.065) (-927.205) -- 0:00:26
694000 -- (-927.892) (-926.397) (-927.692) [-926.754] * [-927.331] (-927.672) (-929.600) (-929.672) -- 0:00:26
694500 -- [-929.923] (-928.216) (-927.807) (-926.140) * (-926.758) (-926.614) (-926.283) [-931.004] -- 0:00:25
695000 -- (-927.912) (-929.309) [-927.953] (-929.362) * (-926.210) [-928.310] (-929.181) (-932.237) -- 0:00:25
Average standard deviation of split frequencies: 0.011430
695500 -- (-927.395) [-928.434] (-929.874) (-933.071) * (-925.778) (-932.270) (-929.181) [-927.095] -- 0:00:25
696000 -- (-927.571) [-928.177] (-929.299) (-926.812) * [-927.343] (-928.651) (-925.623) (-929.952) -- 0:00:25
696500 -- (-926.448) (-933.115) (-929.881) [-926.990] * (-930.113) (-927.647) [-928.279] (-930.256) -- 0:00:25
697000 -- (-926.532) (-928.959) [-929.028] (-927.628) * (-927.339) (-927.354) [-929.269] (-927.451) -- 0:00:25
697500 -- [-927.312] (-928.265) (-927.233) (-928.808) * (-930.326) (-929.675) [-926.032] (-927.617) -- 0:00:25
698000 -- (-928.462) (-929.469) [-926.539] (-929.359) * (-931.799) (-927.819) [-926.560] (-933.830) -- 0:00:25
698500 -- (-929.357) (-927.917) (-927.558) [-927.198] * (-928.059) [-927.227] (-925.920) (-928.611) -- 0:00:25
699000 -- (-929.477) (-928.279) [-926.433] (-929.155) * (-927.413) (-927.386) (-926.887) [-927.080] -- 0:00:25
699500 -- (-928.464) (-928.059) (-926.433) [-927.771] * (-927.355) (-928.703) (-931.311) [-928.011] -- 0:00:25
700000 -- (-931.514) [-930.351] (-927.252) (-928.169) * (-931.452) (-930.825) (-928.423) [-927.511] -- 0:00:25
Average standard deviation of split frequencies: 0.011480
700500 -- [-926.146] (-930.869) (-927.476) (-927.183) * (-926.268) (-928.012) [-929.186] (-926.285) -- 0:00:25
701000 -- [-928.986] (-927.497) (-930.564) (-927.591) * (-927.877) (-926.471) [-929.334] (-926.873) -- 0:00:25
701500 -- (-925.869) (-928.077) [-929.166] (-927.142) * (-926.551) (-927.953) [-927.814] (-928.652) -- 0:00:25
702000 -- (-926.052) (-926.841) (-930.372) [-927.825] * (-927.213) (-926.990) (-930.159) [-927.844] -- 0:00:25
702500 -- (-925.982) (-926.082) (-932.182) [-928.296] * [-927.148] (-927.290) (-927.560) (-929.671) -- 0:00:25
703000 -- [-926.570] (-929.673) (-929.179) (-928.238) * (-926.590) (-928.058) [-927.682] (-930.265) -- 0:00:25
703500 -- (-926.194) (-926.823) (-929.015) [-926.252] * [-926.669] (-928.625) (-929.782) (-926.481) -- 0:00:25
704000 -- [-926.524] (-926.292) (-930.297) (-927.952) * (-927.075) (-932.443) [-927.505] (-926.717) -- 0:00:25
704500 -- (-927.557) (-929.689) [-927.794] (-928.087) * (-928.289) (-931.292) [-926.058] (-926.239) -- 0:00:25
705000 -- (-930.511) [-927.864] (-927.739) (-928.249) * (-928.420) (-932.376) (-929.339) [-926.899] -- 0:00:25
Average standard deviation of split frequencies: 0.011643
705500 -- (-929.184) (-929.620) (-929.494) [-929.990] * (-930.268) [-927.122] (-927.655) (-926.600) -- 0:00:25
706000 -- [-933.003] (-927.335) (-927.238) (-929.176) * (-926.155) (-929.455) (-930.924) [-928.063] -- 0:00:24
706500 -- (-928.225) (-927.691) (-926.803) [-930.150] * (-933.100) (-927.422) [-927.719] (-928.099) -- 0:00:24
707000 -- (-927.769) [-929.656] (-926.908) (-926.619) * (-928.144) (-929.033) [-928.547] (-928.421) -- 0:00:24
707500 -- (-933.391) (-930.800) (-933.382) [-928.113] * (-931.727) (-926.799) [-927.491] (-926.874) -- 0:00:24
708000 -- (-929.342) (-929.709) [-931.748] (-927.614) * (-930.730) [-928.754] (-929.680) (-928.725) -- 0:00:24
708500 -- (-930.627) (-932.118) [-928.383] (-929.114) * (-928.192) [-927.089] (-927.299) (-928.473) -- 0:00:24
709000 -- [-929.244] (-931.231) (-927.620) (-926.177) * (-926.494) (-927.575) [-926.624] (-930.677) -- 0:00:24
709500 -- (-929.587) [-927.490] (-928.071) (-929.238) * (-928.272) [-928.594] (-927.859) (-930.580) -- 0:00:24
710000 -- [-928.291] (-927.797) (-926.391) (-926.583) * (-926.867) (-929.020) [-926.483] (-927.646) -- 0:00:24
Average standard deviation of split frequencies: 0.011484
710500 -- (-928.040) (-927.786) [-926.804] (-926.598) * (-928.173) (-927.229) [-928.640] (-928.681) -- 0:00:24
711000 -- (-926.750) (-934.900) (-928.673) [-927.430] * [-928.305] (-930.660) (-927.084) (-929.316) -- 0:00:24
711500 -- (-926.229) [-926.976] (-930.145) (-927.410) * (-926.333) (-928.945) [-926.882] (-930.829) -- 0:00:24
712000 -- (-926.912) [-926.034] (-932.891) (-929.939) * (-926.257) [-927.096] (-928.074) (-929.842) -- 0:00:24
712500 -- (-925.841) [-927.492] (-928.264) (-927.741) * [-927.616] (-931.140) (-927.361) (-927.786) -- 0:00:24
713000 -- (-925.829) (-931.955) (-927.307) [-927.440] * (-928.744) (-928.321) (-926.843) [-931.422] -- 0:00:24
713500 -- [-929.348] (-929.918) (-926.039) (-927.909) * (-928.648) (-930.711) (-927.025) [-927.463] -- 0:00:24
714000 -- [-927.820] (-930.848) (-926.283) (-932.101) * [-927.573] (-929.772) (-928.650) (-927.476) -- 0:00:24
714500 -- (-927.011) (-926.544) [-927.312] (-928.092) * (-929.570) (-933.375) (-927.168) [-926.608] -- 0:00:24
715000 -- (-926.139) (-926.442) (-926.056) [-929.086] * (-931.112) (-931.300) [-926.499] (-927.420) -- 0:00:24
Average standard deviation of split frequencies: 0.011686
715500 -- (-926.666) (-926.242) (-925.747) [-927.098] * (-930.171) (-927.566) (-927.374) [-929.489] -- 0:00:24
716000 -- (-926.798) [-931.086] (-926.577) (-927.952) * (-928.351) [-927.069] (-926.969) (-927.664) -- 0:00:24
716500 -- (-926.642) (-927.717) (-926.584) [-926.205] * (-930.238) [-926.030] (-927.296) (-928.068) -- 0:00:24
717000 -- (-926.342) (-926.194) (-930.161) [-925.895] * [-926.970] (-929.053) (-927.916) (-928.760) -- 0:00:24
717500 -- (-926.892) (-926.101) [-927.394] (-928.752) * (-926.061) (-926.401) [-928.271] (-928.665) -- 0:00:24
718000 -- (-927.527) (-926.101) (-926.460) [-926.136] * (-926.868) (-931.301) [-928.963] (-926.879) -- 0:00:23
718500 -- [-927.307] (-928.797) (-926.527) (-931.132) * [-926.533] (-928.371) (-926.129) (-930.284) -- 0:00:23
719000 -- (-928.600) (-927.322) (-927.113) [-930.891] * (-927.375) [-926.242] (-928.290) (-929.840) -- 0:00:23
719500 -- [-929.156] (-926.648) (-930.966) (-926.109) * (-928.241) (-927.931) (-926.921) [-927.371] -- 0:00:23
720000 -- (-928.687) (-928.016) (-930.046) [-926.258] * [-929.595] (-931.238) (-927.625) (-926.872) -- 0:00:23
Average standard deviation of split frequencies: 0.011529
720500 -- (-926.741) (-926.294) [-929.301] (-926.029) * [-928.335] (-928.010) (-929.062) (-927.866) -- 0:00:23
721000 -- (-928.455) (-926.159) (-928.049) [-930.368] * (-926.572) (-927.117) (-927.634) [-927.517] -- 0:00:23
721500 -- (-934.514) (-929.665) [-927.544] (-930.947) * (-926.412) [-927.661] (-929.989) (-929.336) -- 0:00:23
722000 -- (-929.505) [-931.051] (-929.493) (-929.200) * (-925.850) [-926.508] (-927.919) (-932.281) -- 0:00:23
722500 -- (-926.236) [-930.047] (-926.101) (-927.726) * (-925.869) (-929.076) [-927.336] (-929.768) -- 0:00:23
723000 -- (-929.984) (-930.974) (-929.902) [-927.888] * (-925.795) [-926.223] (-930.037) (-932.870) -- 0:00:23
723500 -- (-933.200) (-929.176) [-926.404] (-926.754) * (-929.436) (-926.978) (-926.625) [-928.837] -- 0:00:23
724000 -- [-929.950] (-930.059) (-927.461) (-925.723) * (-926.668) (-927.113) (-927.858) [-928.228] -- 0:00:23
724500 -- [-931.142] (-927.336) (-927.459) (-927.246) * (-927.042) [-928.249] (-930.214) (-926.371) -- 0:00:23
725000 -- (-932.892) (-928.105) (-927.045) [-927.800] * [-926.531] (-926.644) (-927.823) (-926.445) -- 0:00:23
Average standard deviation of split frequencies: 0.011404
725500 -- (-933.490) (-928.148) (-927.153) [-926.475] * (-926.219) [-926.241] (-926.712) (-930.597) -- 0:00:23
726000 -- (-929.354) (-928.985) [-927.564] (-928.766) * [-929.826] (-926.451) (-929.011) (-928.233) -- 0:00:23
726500 -- (-928.117) [-928.363] (-930.016) (-928.602) * (-929.201) [-926.389] (-927.375) (-930.666) -- 0:00:23
727000 -- (-929.006) [-926.121] (-933.845) (-926.861) * (-930.116) (-928.595) (-926.555) [-928.990] -- 0:00:23
727500 -- (-933.044) [-930.502] (-927.651) (-927.279) * (-927.933) [-926.997] (-927.445) (-930.507) -- 0:00:23
728000 -- (-929.351) [-930.920] (-928.215) (-928.980) * (-927.866) (-926.966) (-927.615) [-928.747] -- 0:00:23
728500 -- [-926.759] (-930.961) (-929.247) (-928.271) * [-928.077] (-926.974) (-928.057) (-926.229) -- 0:00:23
729000 -- [-928.856] (-928.647) (-929.283) (-928.399) * (-930.648) (-934.321) (-929.148) [-928.297] -- 0:00:23
729500 -- [-927.684] (-937.682) (-926.524) (-929.271) * (-930.492) (-928.494) (-928.058) [-926.312] -- 0:00:22
730000 -- [-926.574] (-930.477) (-926.524) (-931.088) * [-927.214] (-929.867) (-928.864) (-928.133) -- 0:00:22
Average standard deviation of split frequencies: 0.010667
730500 -- (-927.606) (-929.079) [-926.947] (-929.364) * (-926.495) [-925.845] (-926.809) (-926.936) -- 0:00:22
731000 -- (-927.044) [-926.578] (-929.510) (-933.374) * [-927.057] (-926.996) (-926.947) (-928.058) -- 0:00:22
731500 -- (-928.789) (-927.446) (-928.480) [-927.167] * (-928.940) [-926.357] (-927.123) (-926.321) -- 0:00:22
732000 -- (-926.069) [-928.998] (-928.135) (-928.827) * (-928.953) [-930.917] (-927.804) (-926.237) -- 0:00:22
732500 -- [-929.277] (-926.394) (-928.631) (-927.349) * (-928.184) (-930.329) (-928.460) [-927.296] -- 0:00:22
733000 -- (-928.415) (-928.244) [-928.646] (-928.603) * [-927.154] (-927.042) (-929.331) (-926.268) -- 0:00:22
733500 -- (-926.411) (-931.538) (-926.189) [-928.639] * (-932.685) [-928.771] (-927.361) (-927.120) -- 0:00:22
734000 -- [-926.467] (-929.993) (-926.931) (-928.798) * (-932.923) (-928.784) (-927.675) [-927.073] -- 0:00:22
734500 -- (-930.822) [-926.761] (-926.328) (-929.871) * (-930.776) (-928.499) (-927.691) [-927.494] -- 0:00:22
735000 -- (-928.991) (-926.769) [-928.452] (-926.462) * [-928.973] (-931.843) (-930.242) (-929.946) -- 0:00:22
Average standard deviation of split frequencies: 0.011358
735500 -- [-927.191] (-930.265) (-929.164) (-928.182) * (-925.933) (-927.592) (-930.722) [-927.802] -- 0:00:22
736000 -- [-926.447] (-930.469) (-928.571) (-927.252) * [-926.676] (-926.958) (-930.503) (-927.928) -- 0:00:22
736500 -- (-929.212) [-927.815] (-930.224) (-927.621) * (-930.153) [-926.488] (-930.284) (-929.963) -- 0:00:22
737000 -- [-928.272] (-931.189) (-932.483) (-928.137) * (-929.751) (-928.552) (-927.487) [-929.549] -- 0:00:22
737500 -- [-926.958] (-927.360) (-929.547) (-930.810) * (-926.154) (-927.563) (-927.646) [-930.241] -- 0:00:22
738000 -- (-927.905) [-927.448] (-928.752) (-928.784) * (-929.308) (-926.681) [-930.046] (-930.156) -- 0:00:22
738500 -- [-929.325] (-926.591) (-929.675) (-929.108) * (-929.606) (-928.136) [-929.208] (-932.593) -- 0:00:22
739000 -- [-927.393] (-931.411) (-927.127) (-931.397) * [-930.602] (-927.947) (-926.703) (-932.588) -- 0:00:22
739500 -- (-933.374) (-927.676) (-927.847) [-929.217] * [-929.230] (-927.687) (-930.732) (-930.042) -- 0:00:22
740000 -- (-931.344) (-926.900) [-927.655] (-926.772) * (-926.417) [-927.677] (-931.311) (-932.364) -- 0:00:22
Average standard deviation of split frequencies: 0.011202
740500 -- (-927.587) (-928.089) [-930.447] (-927.125) * (-927.814) (-926.769) [-929.932] (-926.741) -- 0:00:22
741000 -- (-927.775) [-927.629] (-930.317) (-927.746) * (-926.826) (-927.373) (-929.227) [-926.582] -- 0:00:22
741500 -- [-927.096] (-928.613) (-932.003) (-926.680) * (-930.968) [-929.869] (-928.687) (-926.882) -- 0:00:21
742000 -- (-929.353) [-929.552] (-929.985) (-926.434) * [-926.807] (-928.854) (-926.658) (-927.234) -- 0:00:21
742500 -- (-931.569) [-927.077] (-929.338) (-928.463) * (-927.486) (-930.058) [-926.988] (-926.692) -- 0:00:21
743000 -- (-928.366) [-927.302] (-927.993) (-927.345) * [-929.802] (-929.414) (-928.575) (-927.873) -- 0:00:21
743500 -- (-931.147) (-928.169) [-926.619] (-929.752) * (-928.162) [-929.319] (-932.195) (-926.800) -- 0:00:21
744000 -- [-929.024] (-927.761) (-927.775) (-926.656) * [-927.782] (-933.386) (-928.730) (-931.098) -- 0:00:21
744500 -- (-930.373) [-926.796] (-926.746) (-926.624) * (-925.976) (-928.371) [-931.386] (-930.947) -- 0:00:21
745000 -- (-927.759) (-929.728) (-931.598) [-925.988] * (-928.521) (-928.057) (-928.261) [-927.251] -- 0:00:21
Average standard deviation of split frequencies: 0.010742
745500 -- [-927.577] (-927.909) (-928.511) (-927.154) * (-927.181) [-926.516] (-927.806) (-927.566) -- 0:00:21
746000 -- (-925.964) [-929.457] (-928.592) (-926.102) * [-929.476] (-926.586) (-929.241) (-927.917) -- 0:00:21
746500 -- (-928.942) [-927.241] (-926.736) (-929.155) * (-928.535) [-927.154] (-930.631) (-927.856) -- 0:00:21
747000 -- (-926.903) (-930.049) (-926.909) [-929.778] * (-930.322) [-927.176] (-927.763) (-927.265) -- 0:00:21
747500 -- (-928.454) (-927.162) (-927.239) [-928.535] * (-928.061) (-933.004) (-928.365) [-929.395] -- 0:00:21
748000 -- (-928.997) (-927.865) (-926.562) [-927.226] * [-929.850] (-931.209) (-927.669) (-928.458) -- 0:00:21
748500 -- (-930.340) (-927.804) (-929.016) [-926.932] * (-926.088) (-932.088) (-926.182) [-926.768] -- 0:00:21
749000 -- (-927.968) [-929.374] (-929.051) (-929.661) * (-929.428) (-932.964) [-926.685] (-931.596) -- 0:00:21
749500 -- (-931.049) [-928.197] (-928.508) (-925.881) * (-928.143) (-929.712) [-927.509] (-929.462) -- 0:00:21
750000 -- (-927.289) (-926.477) (-929.105) [-927.417] * (-926.850) [-927.776] (-929.477) (-934.497) -- 0:00:21
Average standard deviation of split frequencies: 0.011220
750500 -- (-928.752) [-927.318] (-927.258) (-934.079) * (-928.746) (-926.599) (-930.362) [-928.618] -- 0:00:21
751000 -- (-926.654) (-928.480) [-928.176] (-926.852) * (-933.806) [-928.272] (-931.400) (-929.288) -- 0:00:21
751500 -- (-926.763) (-928.534) [-929.190] (-929.112) * [-926.145] (-926.994) (-927.767) (-926.418) -- 0:00:21
752000 -- (-929.166) (-927.323) [-929.495] (-927.370) * (-926.982) (-929.177) (-929.443) [-927.235] -- 0:00:21
752500 -- (-929.073) (-929.867) [-931.705] (-928.501) * (-927.297) [-926.628] (-927.124) (-926.704) -- 0:00:21
753000 -- (-927.031) (-929.066) (-932.107) [-926.563] * (-927.490) (-930.787) (-932.464) [-928.343] -- 0:00:20
753500 -- (-926.542) (-938.563) [-927.232] (-932.217) * (-927.081) (-929.508) (-927.925) [-927.277] -- 0:00:20
754000 -- (-927.530) [-927.192] (-932.022) (-932.244) * [-930.239] (-928.814) (-928.230) (-929.455) -- 0:00:20
754500 -- (-928.413) (-927.186) [-928.902] (-929.341) * (-929.767) (-927.921) (-930.029) [-928.428] -- 0:00:20
755000 -- (-928.861) [-926.932] (-928.961) (-930.848) * (-926.660) [-927.761] (-927.165) (-932.086) -- 0:00:20
Average standard deviation of split frequencies: 0.011141
755500 -- (-927.485) (-926.542) [-927.356] (-931.275) * (-926.799) [-927.207] (-926.800) (-933.998) -- 0:00:20
756000 -- (-927.343) [-927.431] (-926.087) (-927.121) * [-928.895] (-927.631) (-928.539) (-927.403) -- 0:00:20
756500 -- (-926.508) (-928.760) [-926.708] (-927.347) * (-928.421) (-928.308) [-926.109] (-927.102) -- 0:00:20
757000 -- [-932.389] (-926.934) (-928.342) (-927.183) * [-928.236] (-926.037) (-928.082) (-928.439) -- 0:00:20
757500 -- (-928.863) [-928.986] (-926.269) (-926.554) * [-926.981] (-926.213) (-930.519) (-928.654) -- 0:00:20
758000 -- (-927.208) [-926.699] (-931.281) (-926.998) * [-926.842] (-926.243) (-926.066) (-932.229) -- 0:00:20
758500 -- [-928.320] (-930.456) (-930.552) (-926.277) * (-925.788) (-930.026) [-929.746] (-926.700) -- 0:00:20
759000 -- (-927.648) (-928.382) [-928.283] (-926.105) * (-926.743) (-926.864) (-931.875) [-929.765] -- 0:00:20
759500 -- [-929.639] (-928.511) (-927.763) (-926.453) * (-926.388) (-928.994) [-929.819] (-928.250) -- 0:00:20
760000 -- (-930.164) (-927.057) [-926.380] (-927.481) * [-930.893] (-928.283) (-928.781) (-929.069) -- 0:00:20
Average standard deviation of split frequencies: 0.011320
760500 -- (-929.420) (-930.030) [-927.214] (-927.551) * (-928.403) [-928.486] (-926.550) (-930.575) -- 0:00:20
761000 -- (-929.906) (-927.473) [-926.390] (-926.941) * [-927.436] (-927.021) (-929.769) (-929.337) -- 0:00:20
761500 -- (-927.654) (-929.676) (-928.086) [-927.529] * [-929.942] (-927.762) (-930.599) (-927.114) -- 0:00:20
762000 -- (-928.727) (-927.486) (-932.314) [-929.231] * [-929.737] (-927.465) (-932.892) (-926.466) -- 0:00:20
762500 -- (-926.201) (-927.463) (-929.122) [-931.480] * (-930.160) (-931.429) (-930.523) [-929.708] -- 0:00:20
763000 -- [-926.567] (-927.693) (-927.277) (-926.873) * (-927.240) [-928.207] (-929.733) (-927.069) -- 0:00:20
763500 -- (-926.632) (-927.914) [-926.529] (-927.888) * (-931.059) [-926.982] (-931.023) (-929.861) -- 0:00:20
764000 -- [-927.065] (-931.455) (-927.111) (-928.115) * (-931.324) [-928.163] (-934.933) (-925.847) -- 0:00:20
764500 -- (-929.530) (-926.481) [-926.363] (-933.288) * (-927.840) (-926.825) (-927.780) [-929.446] -- 0:00:20
765000 -- (-931.138) (-926.253) [-927.882] (-928.486) * (-927.229) [-927.049] (-928.720) (-929.483) -- 0:00:19
Average standard deviation of split frequencies: 0.011734
765500 -- [-930.453] (-926.257) (-926.423) (-928.166) * (-928.078) [-927.057] (-927.182) (-927.120) -- 0:00:19
766000 -- (-929.806) [-926.573] (-927.933) (-927.372) * (-928.268) (-929.000) [-928.650] (-927.761) -- 0:00:19
766500 -- [-927.769] (-926.949) (-927.605) (-933.991) * (-928.002) [-930.106] (-933.913) (-928.005) -- 0:00:19
767000 -- [-930.433] (-926.678) (-926.922) (-929.241) * (-929.148) (-927.547) [-927.026] (-928.345) -- 0:00:19
767500 -- (-935.794) (-929.096) [-928.748] (-927.957) * [-929.298] (-928.905) (-926.418) (-927.933) -- 0:00:19
768000 -- (-929.241) [-927.021] (-927.429) (-927.818) * (-927.559) [-927.104] (-926.407) (-927.858) -- 0:00:19
768500 -- (-926.686) [-925.837] (-927.368) (-926.928) * [-926.458] (-928.056) (-927.249) (-926.690) -- 0:00:19
769000 -- (-929.615) (-926.425) (-927.717) [-927.416] * (-927.142) [-927.534] (-926.341) (-931.890) -- 0:00:19
769500 -- (-927.763) [-926.399] (-928.479) (-926.791) * (-926.377) (-927.632) [-926.442] (-930.698) -- 0:00:19
770000 -- (-927.398) (-926.174) [-927.123] (-933.713) * (-933.600) (-929.755) [-926.991] (-929.038) -- 0:00:19
Average standard deviation of split frequencies: 0.011500
770500 -- (-929.214) (-926.454) (-926.055) [-929.586] * (-929.648) [-927.514] (-928.218) (-928.045) -- 0:00:19
771000 -- (-931.687) [-927.650] (-926.891) (-928.872) * (-927.492) (-927.367) [-929.563] (-926.396) -- 0:00:19
771500 -- (-928.318) [-929.430] (-931.463) (-935.189) * (-927.483) [-927.182] (-928.630) (-928.521) -- 0:00:19
772000 -- (-928.931) (-927.215) [-930.417] (-929.248) * (-926.264) (-928.359) (-927.958) [-927.276] -- 0:00:19
772500 -- [-928.258] (-926.654) (-931.372) (-928.682) * (-928.840) [-927.170] (-925.852) (-930.178) -- 0:00:19
773000 -- (-930.975) (-929.683) (-930.019) [-926.151] * (-929.302) [-927.330] (-930.059) (-929.437) -- 0:00:19
773500 -- (-927.880) (-927.812) (-926.257) [-926.034] * (-927.628) (-929.639) [-926.210] (-930.310) -- 0:00:19
774000 -- (-927.498) (-929.354) (-926.257) [-927.565] * [-927.891] (-927.395) (-928.020) (-929.286) -- 0:00:19
774500 -- (-926.731) [-926.437] (-927.670) (-927.582) * (-926.359) (-926.001) [-928.069] (-930.995) -- 0:00:19
775000 -- [-926.639] (-929.095) (-927.223) (-931.164) * (-927.123) (-928.551) (-928.682) [-927.250] -- 0:00:19
Average standard deviation of split frequencies: 0.011866
775500 -- (-927.017) [-926.523] (-926.064) (-928.836) * [-927.279] (-927.210) (-926.448) (-931.190) -- 0:00:19
776000 -- [-927.610] (-926.394) (-928.063) (-933.725) * (-927.716) [-927.785] (-929.503) (-927.490) -- 0:00:19
776500 -- (-926.799) (-930.493) [-927.975] (-928.635) * (-927.988) (-927.519) [-927.389] (-928.381) -- 0:00:18
777000 -- (-928.863) (-927.909) [-926.380] (-930.761) * [-926.951] (-927.375) (-928.029) (-926.997) -- 0:00:18
777500 -- [-928.279] (-927.068) (-927.181) (-927.394) * [-929.028] (-927.289) (-928.133) (-927.831) -- 0:00:18
778000 -- (-927.712) (-928.891) [-926.991] (-927.578) * (-928.999) [-926.919] (-926.891) (-927.779) -- 0:00:18
778500 -- (-927.709) (-928.557) (-931.070) [-927.318] * (-933.005) (-928.366) (-927.572) [-925.978] -- 0:00:18
779000 -- [-928.344] (-928.098) (-929.456) (-931.676) * (-928.405) (-926.274) (-928.220) [-926.083] -- 0:00:18
779500 -- (-929.144) (-926.670) (-930.112) [-930.297] * (-926.664) [-927.504] (-927.525) (-928.591) -- 0:00:18
780000 -- (-928.526) [-930.407] (-928.205) (-926.754) * (-927.128) [-929.645] (-932.135) (-929.035) -- 0:00:18
Average standard deviation of split frequencies: 0.012198
780500 -- (-929.272) (-929.589) [-929.401] (-927.695) * (-933.387) [-927.551] (-932.816) (-927.060) -- 0:00:18
781000 -- [-926.696] (-929.043) (-927.312) (-929.342) * (-927.746) (-928.787) [-926.581] (-927.384) -- 0:00:18
781500 -- (-927.371) (-931.107) [-928.005] (-929.405) * (-926.144) [-929.332] (-928.200) (-932.738) -- 0:00:18
782000 -- (-926.721) [-926.719] (-928.393) (-929.354) * [-926.063] (-931.548) (-928.131) (-929.691) -- 0:00:18
782500 -- (-927.169) [-928.687] (-928.909) (-931.153) * [-926.159] (-929.163) (-933.155) (-930.592) -- 0:00:18
783000 -- (-926.567) [-927.025] (-930.294) (-928.454) * (-927.612) [-929.789] (-927.217) (-928.530) -- 0:00:18
783500 -- [-927.443] (-929.267) (-928.652) (-934.674) * (-927.333) (-927.666) (-928.272) [-930.414] -- 0:00:18
784000 -- (-927.776) [-928.046] (-931.589) (-933.519) * (-929.313) [-927.256] (-926.912) (-928.375) -- 0:00:18
784500 -- (-928.696) [-930.637] (-927.980) (-933.308) * (-927.597) (-926.309) (-927.211) [-927.247] -- 0:00:18
785000 -- (-926.733) (-928.527) [-928.605] (-926.410) * (-930.151) (-928.329) [-926.544] (-927.489) -- 0:00:18
Average standard deviation of split frequencies: 0.011675
785500 -- [-929.467] (-930.999) (-926.095) (-928.264) * (-931.097) (-926.519) [-925.804] (-927.799) -- 0:00:18
786000 -- (-927.653) [-929.185] (-927.064) (-927.423) * (-927.597) [-929.774] (-925.874) (-927.257) -- 0:00:18
786500 -- (-930.845) [-926.936] (-927.918) (-929.564) * (-926.870) (-928.636) (-927.320) [-926.823] -- 0:00:18
787000 -- (-929.554) [-927.058] (-927.801) (-931.576) * (-926.939) (-926.673) (-929.444) [-928.841] -- 0:00:18
787500 -- [-926.467] (-928.958) (-927.327) (-932.028) * (-928.197) [-927.573] (-928.652) (-927.516) -- 0:00:18
788000 -- (-926.534) (-929.713) [-927.714] (-929.297) * (-931.861) [-926.913] (-927.788) (-929.053) -- 0:00:18
788500 -- (-927.862) (-929.818) [-928.433] (-933.977) * (-927.567) [-928.995] (-928.340) (-927.924) -- 0:00:17
789000 -- [-927.565] (-931.164) (-930.157) (-931.320) * (-928.584) (-928.457) [-930.195] (-926.551) -- 0:00:17
789500 -- (-928.184) (-931.932) [-928.601] (-929.087) * (-935.799) (-926.855) (-926.209) [-925.697] -- 0:00:17
790000 -- [-928.488] (-930.256) (-928.882) (-927.427) * (-928.672) (-926.109) [-926.081] (-927.405) -- 0:00:17
Average standard deviation of split frequencies: 0.011845
790500 -- [-928.000] (-929.066) (-930.555) (-933.687) * (-929.319) (-928.368) [-928.824] (-927.798) -- 0:00:17
791000 -- (-927.255) (-928.108) [-929.307] (-929.820) * [-928.344] (-928.111) (-927.286) (-927.225) -- 0:00:17
791500 -- (-927.900) (-930.736) (-926.437) [-928.300] * (-931.369) (-927.579) (-928.695) [-927.094] -- 0:00:17
792000 -- (-927.895) (-930.126) (-928.848) [-927.844] * (-929.984) (-928.528) (-928.556) [-928.726] -- 0:00:17
792500 -- (-927.478) [-927.746] (-927.111) (-932.606) * (-928.749) (-926.666) [-926.638] (-931.396) -- 0:00:17
793000 -- (-934.550) (-930.668) (-930.079) [-932.856] * (-927.994) [-929.334] (-926.919) (-928.464) -- 0:00:17
793500 -- [-931.830] (-927.460) (-932.851) (-929.540) * (-932.085) (-929.223) (-926.404) [-926.693] -- 0:00:17
794000 -- [-927.947] (-928.033) (-929.123) (-927.148) * (-931.300) (-930.981) (-928.215) [-927.037] -- 0:00:17
794500 -- (-927.979) [-930.216] (-927.925) (-927.130) * (-931.515) (-928.291) (-932.339) [-927.302] -- 0:00:17
795000 -- (-925.675) [-927.185] (-928.704) (-926.294) * (-930.622) [-931.661] (-928.363) (-928.634) -- 0:00:17
Average standard deviation of split frequencies: 0.011528
795500 -- [-930.903] (-926.187) (-930.721) (-931.781) * (-931.116) (-928.228) [-928.017] (-926.329) -- 0:00:17
796000 -- (-926.926) (-928.638) (-927.564) [-929.287] * (-939.529) (-928.414) [-932.097] (-929.651) -- 0:00:17
796500 -- [-929.309] (-927.478) (-926.840) (-927.353) * [-926.100] (-928.402) (-926.686) (-926.149) -- 0:00:17
797000 -- [-927.741] (-930.245) (-928.686) (-929.755) * (-926.032) [-926.636] (-929.701) (-928.747) -- 0:00:17
797500 -- (-928.502) (-930.140) (-928.841) [-928.623] * (-929.183) (-925.764) (-929.677) [-928.857] -- 0:00:17
798000 -- (-926.530) (-931.947) (-929.192) [-928.882] * (-927.854) [-925.764] (-930.020) (-928.980) -- 0:00:17
798500 -- (-929.335) (-927.387) (-927.246) [-928.402] * (-927.798) [-926.712] (-927.522) (-928.968) -- 0:00:17
799000 -- [-931.231] (-930.835) (-927.087) (-928.142) * (-929.078) [-925.881] (-927.118) (-928.412) -- 0:00:17
799500 -- (-927.559) (-927.554) (-925.997) [-927.013] * [-931.924] (-929.170) (-927.115) (-927.378) -- 0:00:17
800000 -- (-928.815) (-931.092) (-928.822) [-928.110] * (-928.726) [-928.772] (-928.371) (-927.373) -- 0:00:17
Average standard deviation of split frequencies: 0.010873
800500 -- (-926.514) (-927.575) [-926.592] (-930.811) * (-929.604) [-930.077] (-928.210) (-927.437) -- 0:00:16
801000 -- [-927.396] (-929.624) (-926.736) (-927.117) * [-929.193] (-933.006) (-927.481) (-927.588) -- 0:00:16
801500 -- (-929.386) (-928.717) (-930.722) [-926.732] * (-926.340) (-933.699) (-929.163) [-928.659] -- 0:00:16
802000 -- (-928.027) (-929.440) [-925.850] (-927.240) * (-927.486) (-931.894) [-928.479] (-926.821) -- 0:00:16
802500 -- (-926.848) [-928.114] (-928.657) (-927.156) * (-927.682) (-933.774) (-928.476) [-926.929] -- 0:00:16
803000 -- [-926.967] (-926.714) (-929.809) (-927.145) * (-930.008) (-926.923) [-926.403] (-927.364) -- 0:00:16
803500 -- [-926.666] (-928.370) (-931.732) (-927.865) * (-929.887) (-925.824) [-928.633] (-926.146) -- 0:00:16
804000 -- (-926.753) (-927.667) (-932.846) [-926.798] * [-928.691] (-926.716) (-928.034) (-926.568) -- 0:00:16
804500 -- [-926.524] (-926.163) (-931.397) (-926.726) * (-926.220) [-927.564] (-930.260) (-931.113) -- 0:00:16
805000 -- (-929.516) (-929.485) (-931.452) [-926.468] * (-928.580) (-928.764) (-929.591) [-925.936] -- 0:00:16
Average standard deviation of split frequencies: 0.010840
805500 -- [-925.722] (-928.588) (-931.678) (-926.465) * (-926.219) (-927.198) (-930.490) [-928.709] -- 0:00:16
806000 -- (-925.698) (-928.564) (-929.049) [-926.663] * [-931.144] (-926.122) (-929.880) (-927.539) -- 0:00:16
806500 -- [-926.278] (-929.415) (-928.205) (-929.236) * (-929.163) [-927.851] (-930.860) (-928.100) -- 0:00:16
807000 -- [-928.005] (-927.078) (-931.237) (-926.594) * (-926.791) [-931.726] (-928.533) (-927.339) -- 0:00:16
807500 -- [-927.397] (-927.211) (-930.207) (-925.845) * [-927.813] (-932.035) (-927.524) (-927.516) -- 0:00:16
808000 -- (-926.759) (-929.672) (-933.078) [-926.722] * (-927.456) (-927.174) [-927.651] (-927.263) -- 0:00:16
808500 -- [-928.162] (-927.674) (-929.803) (-926.423) * (-930.069) [-929.391] (-929.497) (-928.351) -- 0:00:16
809000 -- (-928.683) [-926.815] (-931.626) (-927.068) * (-930.128) (-930.499) [-929.483] (-926.841) -- 0:00:16
809500 -- (-929.757) (-928.590) [-926.892] (-927.275) * [-927.400] (-931.713) (-928.131) (-928.402) -- 0:00:16
810000 -- (-927.058) (-928.750) (-929.040) [-929.190] * (-926.320) (-926.743) (-926.900) [-928.120] -- 0:00:16
Average standard deviation of split frequencies: 0.011165
810500 -- (-926.717) (-929.366) [-927.711] (-928.238) * (-926.750) [-926.511] (-932.564) (-926.186) -- 0:00:16
811000 -- [-928.686] (-930.246) (-926.712) (-929.200) * (-927.433) (-927.178) (-933.207) [-929.757] -- 0:00:16
811500 -- [-927.470] (-928.372) (-927.714) (-927.875) * [-927.796] (-926.273) (-926.010) (-928.108) -- 0:00:16
812000 -- (-928.585) (-929.886) (-929.435) [-934.598] * (-926.561) (-927.090) (-933.328) [-929.755] -- 0:00:15
812500 -- (-927.938) (-938.079) [-929.422] (-927.255) * (-928.574) [-926.837] (-932.262) (-929.653) -- 0:00:15
813000 -- (-927.226) (-934.460) [-926.725] (-931.894) * (-927.213) [-926.968] (-929.199) (-929.733) -- 0:00:15
813500 -- (-926.551) (-927.376) [-929.741] (-926.714) * (-927.217) (-928.833) [-926.571] (-931.078) -- 0:00:15
814000 -- [-927.629] (-930.317) (-933.480) (-927.250) * (-928.693) (-926.481) (-926.566) [-933.150] -- 0:00:15
814500 -- (-928.833) (-932.986) (-929.178) [-928.475] * (-928.257) (-926.114) (-928.627) [-929.815] -- 0:00:15
815000 -- (-926.506) (-929.895) [-927.333] (-925.680) * [-930.886] (-928.104) (-926.909) (-928.852) -- 0:00:15
Average standard deviation of split frequencies: 0.011092
815500 -- (-928.964) (-926.986) (-927.333) [-925.988] * (-928.471) (-927.494) (-926.782) [-928.552] -- 0:00:15
816000 -- [-929.097] (-929.584) (-928.401) (-930.130) * (-928.855) (-927.687) (-927.650) [-928.059] -- 0:00:15
816500 -- (-930.213) [-927.662] (-927.798) (-926.723) * (-926.443) (-928.235) [-928.728] (-927.312) -- 0:00:15
817000 -- (-930.072) (-930.286) [-927.495] (-927.940) * (-926.396) [-927.814] (-932.423) (-925.931) -- 0:00:15
817500 -- (-930.101) (-929.225) [-928.673] (-928.305) * [-926.006] (-927.311) (-933.488) (-925.983) -- 0:00:15
818000 -- (-927.887) (-927.308) (-929.105) [-928.170] * (-926.410) (-929.063) (-937.177) [-928.655] -- 0:00:15
818500 -- (-927.798) (-927.618) (-928.234) [-927.267] * [-928.316] (-933.024) (-928.945) (-930.868) -- 0:00:15
819000 -- (-929.872) (-930.303) (-927.563) [-928.779] * (-927.090) (-929.274) [-928.736] (-930.696) -- 0:00:15
819500 -- [-929.745] (-927.047) (-927.566) (-929.338) * [-928.442] (-928.579) (-932.719) (-929.215) -- 0:00:15
820000 -- (-929.644) (-927.617) (-929.020) [-926.228] * [-927.884] (-927.663) (-930.210) (-927.892) -- 0:00:15
Average standard deviation of split frequencies: 0.010991
820500 -- (-930.768) (-929.246) [-926.514] (-927.694) * (-926.757) (-931.716) [-927.306] (-927.471) -- 0:00:15
821000 -- (-927.276) (-929.511) (-927.697) [-929.597] * (-929.177) (-928.548) (-929.099) [-927.139] -- 0:00:15
821500 -- (-927.629) (-927.985) (-926.085) [-931.395] * (-929.103) [-930.447] (-930.133) (-928.693) -- 0:00:15
822000 -- (-933.664) (-927.051) (-926.927) [-927.571] * (-929.457) (-927.799) [-929.886] (-930.317) -- 0:00:15
822500 -- (-932.765) [-927.684] (-929.022) (-928.251) * [-926.292] (-928.294) (-927.530) (-928.247) -- 0:00:15
823000 -- (-929.031) [-926.621] (-935.651) (-930.380) * [-926.091] (-928.649) (-930.305) (-926.486) -- 0:00:15
823500 -- (-927.851) (-926.374) [-926.904] (-929.108) * (-926.047) (-930.360) [-928.330] (-930.584) -- 0:00:15
824000 -- (-931.164) [-926.300] (-927.565) (-932.205) * (-926.211) (-928.050) (-927.552) [-927.564] -- 0:00:14
824500 -- (-929.116) (-926.794) [-929.116] (-927.214) * [-926.532] (-926.177) (-928.458) (-929.199) -- 0:00:14
825000 -- (-926.394) (-927.317) [-926.424] (-926.778) * (-927.963) (-928.090) (-933.752) [-928.999] -- 0:00:14
Average standard deviation of split frequencies: 0.010691
825500 -- (-929.414) (-926.970) (-933.345) [-926.780] * (-927.159) (-928.019) [-929.241] (-928.416) -- 0:00:14
826000 -- (-927.153) [-927.130] (-926.966) (-926.140) * (-928.427) (-928.922) (-927.471) [-926.953] -- 0:00:14
826500 -- [-928.055] (-928.545) (-926.693) (-927.895) * (-926.354) (-934.310) (-925.997) [-929.026] -- 0:00:14
827000 -- (-927.599) [-928.537] (-926.732) (-928.268) * (-927.051) (-932.537) [-928.394] (-926.433) -- 0:00:14
827500 -- (-933.781) (-931.996) [-926.197] (-927.013) * (-926.411) [-929.410] (-927.895) (-930.850) -- 0:00:14
828000 -- (-929.380) (-926.503) (-927.440) [-928.275] * (-927.354) (-932.276) [-927.828] (-930.447) -- 0:00:14
828500 -- (-927.331) (-927.921) [-926.125] (-926.314) * (-929.960) [-927.274] (-930.723) (-932.200) -- 0:00:14
829000 -- (-930.702) (-930.779) [-927.528] (-931.719) * [-929.048] (-925.986) (-931.578) (-927.973) -- 0:00:14
829500 -- [-927.510] (-928.192) (-934.761) (-927.346) * [-926.796] (-929.256) (-927.230) (-927.224) -- 0:00:14
830000 -- (-932.597) [-927.071] (-929.687) (-927.564) * (-928.220) [-929.054] (-926.440) (-929.919) -- 0:00:14
Average standard deviation of split frequencies: 0.010707
830500 -- (-930.602) (-926.461) (-927.641) [-928.486] * [-928.846] (-928.961) (-929.123) (-928.647) -- 0:00:14
831000 -- (-927.046) [-927.210] (-928.409) (-927.788) * (-927.473) [-928.928] (-929.812) (-928.326) -- 0:00:14
831500 -- (-928.527) [-930.015] (-927.077) (-926.411) * (-926.002) [-929.299] (-928.451) (-926.962) -- 0:00:14
832000 -- (-928.837) (-926.384) [-928.683] (-926.834) * (-927.813) (-933.037) (-928.584) [-926.471] -- 0:00:14
832500 -- (-927.935) (-929.032) [-926.679] (-929.662) * [-927.116] (-927.719) (-928.221) (-928.688) -- 0:00:14
833000 -- [-931.098] (-927.905) (-928.393) (-927.486) * (-927.684) (-927.174) (-928.409) [-931.826] -- 0:00:14
833500 -- (-929.500) (-927.799) (-928.629) [-928.269] * (-927.929) [-927.045] (-927.124) (-929.427) -- 0:00:14
834000 -- (-927.434) [-928.250] (-928.479) (-926.612) * [-929.074] (-926.845) (-929.019) (-928.452) -- 0:00:14
834500 -- (-930.899) [-926.715] (-930.001) (-927.889) * (-928.809) [-926.469] (-931.380) (-927.916) -- 0:00:14
835000 -- (-932.325) (-928.560) [-930.396] (-927.461) * (-927.237) (-929.655) (-935.762) [-928.236] -- 0:00:14
Average standard deviation of split frequencies: 0.010714
835500 -- (-929.712) (-929.793) (-931.641) [-927.644] * (-926.451) [-930.748] (-933.246) (-930.153) -- 0:00:13
836000 -- [-927.409] (-929.654) (-932.145) (-927.229) * [-926.908] (-927.808) (-927.784) (-930.809) -- 0:00:13
836500 -- (-926.564) [-934.403] (-929.883) (-929.977) * (-930.487) [-930.063] (-927.032) (-927.979) -- 0:00:13
837000 -- (-928.882) (-931.035) [-931.494] (-926.496) * (-931.753) [-929.814] (-925.715) (-928.294) -- 0:00:13
837500 -- (-928.986) (-926.628) [-927.195] (-926.018) * (-929.380) (-926.221) (-926.969) [-926.740] -- 0:00:13
838000 -- [-927.603] (-926.197) (-931.407) (-932.927) * (-927.578) [-926.933] (-927.293) (-932.941) -- 0:00:13
838500 -- [-928.625] (-926.555) (-929.341) (-928.461) * (-930.280) [-930.352] (-927.618) (-926.802) -- 0:00:13
839000 -- (-927.885) (-931.673) (-928.161) [-929.787] * (-928.484) (-929.229) (-927.247) [-927.147] -- 0:00:13
839500 -- (-928.419) (-930.496) [-928.019] (-929.254) * (-929.114) (-927.657) [-930.594] (-927.625) -- 0:00:13
840000 -- [-926.549] (-928.832) (-926.369) (-929.439) * (-927.135) (-926.051) [-927.524] (-929.490) -- 0:00:13
Average standard deviation of split frequencies: 0.010206
840500 -- (-930.436) [-927.606] (-927.143) (-926.798) * [-926.739] (-930.395) (-928.899) (-929.797) -- 0:00:13
841000 -- (-931.062) (-927.762) [-926.807] (-928.127) * (-926.570) (-930.610) (-927.584) [-927.755] -- 0:00:13
841500 -- (-933.589) (-931.382) [-926.854] (-927.853) * [-926.698] (-928.468) (-926.576) (-927.259) -- 0:00:13
842000 -- [-928.308] (-928.775) (-928.412) (-930.015) * (-928.999) [-928.665] (-929.152) (-927.873) -- 0:00:13
842500 -- (-927.284) (-928.770) [-927.738] (-929.523) * [-928.691] (-928.404) (-927.948) (-930.112) -- 0:00:13
843000 -- (-926.666) [-926.587] (-928.208) (-929.059) * (-929.319) (-930.249) [-928.135] (-928.363) -- 0:00:13
843500 -- (-926.830) (-927.027) (-927.606) [-928.757] * (-928.243) [-930.469] (-926.564) (-929.717) -- 0:00:13
844000 -- (-926.904) (-927.678) (-936.654) [-928.819] * [-929.774] (-927.436) (-926.222) (-929.344) -- 0:00:13
844500 -- (-927.489) (-930.094) (-927.457) [-927.311] * (-928.648) (-927.861) (-928.882) [-929.569] -- 0:00:13
845000 -- (-928.016) (-929.264) (-928.618) [-931.250] * (-929.451) [-926.413] (-928.080) (-926.643) -- 0:00:13
Average standard deviation of split frequencies: 0.010067
845500 -- (-929.899) (-927.676) (-926.361) [-927.754] * (-928.958) (-930.156) [-926.579] (-927.218) -- 0:00:13
846000 -- (-927.695) (-930.048) (-930.540) [-928.702] * (-926.124) (-927.692) (-927.991) [-927.452] -- 0:00:13
846500 -- (-927.819) (-929.296) [-928.943] (-928.907) * (-927.150) [-928.695] (-933.953) (-927.862) -- 0:00:13
847000 -- (-926.437) (-926.442) (-927.974) [-927.046] * (-926.446) [-926.993] (-928.720) (-927.663) -- 0:00:13
847500 -- [-926.246] (-926.692) (-926.446) (-926.043) * (-932.024) (-929.558) (-926.780) [-928.462] -- 0:00:12
848000 -- (-926.840) (-926.777) (-926.575) [-927.248] * (-928.780) (-929.158) [-927.784] (-927.191) -- 0:00:12
848500 -- (-926.718) (-930.123) (-928.319) [-928.809] * (-927.788) (-926.382) [-928.502] (-936.618) -- 0:00:12
849000 -- (-928.695) (-928.095) (-926.635) [-926.877] * (-927.892) [-926.999] (-929.225) (-928.979) -- 0:00:12
849500 -- [-926.471] (-926.441) (-928.501) (-929.361) * [-926.672] (-927.780) (-928.993) (-927.899) -- 0:00:12
850000 -- (-927.479) (-925.835) [-927.409] (-927.721) * (-926.605) (-928.080) (-928.295) [-926.853] -- 0:00:12
Average standard deviation of split frequencies: 0.009753
850500 -- (-930.485) [-926.602] (-930.141) (-932.419) * (-927.897) (-928.407) [-926.002] (-926.271) -- 0:00:12
851000 -- (-928.046) (-926.178) [-928.766] (-927.494) * [-926.490] (-930.151) (-929.920) (-929.764) -- 0:00:12
851500 -- [-927.406] (-928.594) (-928.888) (-929.651) * (-932.935) (-927.335) [-928.733] (-926.395) -- 0:00:12
852000 -- (-927.989) (-932.912) [-926.865] (-932.854) * [-930.147] (-928.281) (-933.539) (-926.080) -- 0:00:12
852500 -- (-930.283) [-928.278] (-927.919) (-926.673) * (-929.697) [-926.751] (-928.893) (-925.677) -- 0:00:12
853000 -- [-928.248] (-928.599) (-930.386) (-926.530) * (-928.196) (-927.443) (-930.045) [-927.621] -- 0:00:12
853500 -- (-926.642) (-932.081) [-927.419] (-926.854) * (-931.002) [-936.817] (-927.480) (-929.127) -- 0:00:12
854000 -- [-927.207] (-926.524) (-926.318) (-928.383) * [-931.367] (-930.534) (-928.468) (-929.826) -- 0:00:12
854500 -- (-926.200) [-926.526] (-928.821) (-929.583) * (-928.431) (-928.515) [-927.640] (-925.961) -- 0:00:12
855000 -- (-927.642) (-927.389) (-928.936) [-928.400] * (-928.356) (-930.004) [-928.494] (-926.969) -- 0:00:12
Average standard deviation of split frequencies: 0.009913
855500 -- (-927.299) (-929.200) (-927.175) [-927.873] * [-927.452] (-928.340) (-928.760) (-927.650) -- 0:00:12
856000 -- (-927.100) (-930.171) (-929.001) [-930.075] * [-928.656] (-927.220) (-927.622) (-927.521) -- 0:00:12
856500 -- (-935.108) [-928.864] (-929.837) (-933.826) * (-926.824) [-925.931] (-928.975) (-926.428) -- 0:00:12
857000 -- (-927.981) (-927.537) [-929.600] (-929.328) * (-926.564) (-927.619) [-928.413] (-929.132) -- 0:00:12
857500 -- (-935.595) [-927.708] (-926.720) (-930.082) * [-926.224] (-927.420) (-927.333) (-927.130) -- 0:00:12
858000 -- (-932.096) (-927.380) [-929.697] (-929.734) * (-931.353) (-928.621) (-927.464) [-928.098] -- 0:00:12
858500 -- (-926.101) (-929.224) [-933.622] (-929.144) * (-930.450) (-930.485) [-927.296] (-932.004) -- 0:00:12
859000 -- (-930.399) (-928.725) [-931.422] (-928.216) * (-927.751) [-928.644] (-929.550) (-928.585) -- 0:00:11
859500 -- (-926.832) (-927.967) (-936.879) [-926.793] * (-926.994) [-929.140] (-929.654) (-928.498) -- 0:00:11
860000 -- [-930.557] (-929.760) (-928.658) (-925.829) * (-929.863) [-926.348] (-927.317) (-926.827) -- 0:00:11
Average standard deviation of split frequencies: 0.009311
860500 -- (-926.940) (-928.262) [-927.190] (-926.797) * (-927.879) (-930.131) (-928.706) [-928.813] -- 0:00:11
861000 -- [-930.546] (-926.117) (-930.695) (-926.552) * (-933.170) (-932.638) [-926.177] (-928.352) -- 0:00:11
861500 -- [-927.907] (-927.573) (-927.647) (-925.851) * (-928.251) (-928.558) [-927.986] (-926.459) -- 0:00:11
862000 -- (-926.217) [-929.601] (-928.716) (-925.745) * [-927.705] (-928.199) (-926.773) (-929.662) -- 0:00:11
862500 -- (-925.819) [-930.072] (-926.641) (-925.880) * (-927.108) (-927.751) (-926.441) [-927.905] -- 0:00:11
863000 -- [-926.876] (-930.187) (-927.395) (-925.841) * (-927.482) [-926.632] (-928.673) (-931.296) -- 0:00:11
863500 -- (-928.661) [-926.469] (-926.353) (-926.665) * (-927.067) (-926.600) (-926.586) [-930.134] -- 0:00:11
864000 -- (-926.667) [-926.061] (-926.428) (-928.633) * (-927.311) [-926.327] (-927.702) (-927.451) -- 0:00:11
864500 -- [-926.221] (-928.923) (-926.442) (-925.607) * [-926.603] (-930.146) (-927.025) (-933.945) -- 0:00:11
865000 -- (-928.381) (-928.115) (-928.946) [-935.426] * (-926.620) (-930.089) [-926.363] (-927.149) -- 0:00:11
Average standard deviation of split frequencies: 0.009581
865500 -- (-926.721) (-928.025) [-930.342] (-931.642) * (-925.969) [-930.258] (-926.324) (-926.861) -- 0:00:11
866000 -- (-927.299) (-928.025) (-928.325) [-927.515] * (-927.172) (-927.899) (-927.416) [-928.786] -- 0:00:11
866500 -- (-929.761) [-925.772] (-927.369) (-928.912) * [-927.286] (-928.094) (-928.403) (-933.750) -- 0:00:11
867000 -- (-930.504) (-926.847) (-928.035) [-926.839] * (-928.136) (-927.111) (-927.494) [-933.235] -- 0:00:11
867500 -- [-928.116] (-933.010) (-926.615) (-928.465) * (-930.537) [-927.070] (-927.709) (-928.179) -- 0:00:11
868000 -- [-928.529] (-927.883) (-927.206) (-929.403) * (-927.991) [-926.797] (-926.094) (-926.912) -- 0:00:11
868500 -- (-927.214) [-931.215] (-927.596) (-927.991) * (-926.954) (-927.107) (-927.399) [-927.716] -- 0:00:11
869000 -- (-929.697) (-927.291) [-931.517] (-927.824) * (-928.733) (-927.287) [-928.265] (-927.770) -- 0:00:11
869500 -- (-926.403) [-926.881] (-930.050) (-931.645) * (-927.908) [-926.426] (-927.399) (-928.990) -- 0:00:11
870000 -- [-928.588] (-927.693) (-930.693) (-928.935) * (-928.177) (-929.310) [-928.725] (-930.766) -- 0:00:11
Average standard deviation of split frequencies: 0.009674
870500 -- (-928.765) (-928.396) [-928.340] (-932.855) * (-927.593) (-930.677) (-928.391) [-929.020] -- 0:00:11
871000 -- (-932.595) (-927.842) [-927.148] (-931.173) * (-931.942) [-926.635] (-927.376) (-928.907) -- 0:00:10
871500 -- (-931.097) [-929.455] (-929.209) (-931.634) * [-926.955] (-928.415) (-928.331) (-928.850) -- 0:00:10
872000 -- (-928.487) [-928.835] (-929.158) (-926.267) * [-927.477] (-925.784) (-928.821) (-927.362) -- 0:00:10
872500 -- (-926.701) [-928.208] (-929.010) (-929.776) * (-929.319) (-931.704) [-926.156] (-929.299) -- 0:00:10
873000 -- (-927.912) (-930.544) (-927.400) [-926.500] * (-925.898) [-928.121] (-927.720) (-930.074) -- 0:00:10
873500 -- (-928.154) (-926.168) (-928.422) [-926.960] * (-926.597) [-926.639] (-927.111) (-929.026) -- 0:00:10
874000 -- [-930.699] (-927.608) (-927.613) (-927.904) * (-926.124) [-928.462] (-929.257) (-927.987) -- 0:00:10
874500 -- (-927.611) (-933.988) [-927.269] (-926.640) * (-927.529) [-930.219] (-928.696) (-926.826) -- 0:00:10
875000 -- [-926.242] (-929.006) (-932.614) (-927.926) * [-928.428] (-931.193) (-929.675) (-929.906) -- 0:00:10
Average standard deviation of split frequencies: 0.009471
875500 -- (-929.436) [-929.809] (-925.903) (-927.838) * [-927.644] (-928.574) (-926.410) (-927.834) -- 0:00:10
876000 -- (-928.036) (-929.830) (-926.805) [-927.412] * (-930.116) [-928.297] (-928.862) (-927.113) -- 0:00:10
876500 -- (-929.089) (-925.934) (-926.749) [-929.076] * (-930.872) [-927.943] (-928.326) (-928.098) -- 0:00:10
877000 -- (-927.656) (-927.464) (-929.089) [-927.535] * (-930.146) (-932.617) [-931.361] (-928.198) -- 0:00:10
877500 -- (-927.757) (-927.203) [-930.123] (-927.162) * (-927.552) (-925.673) (-928.267) [-926.538] -- 0:00:10
878000 -- (-927.851) [-926.344] (-928.229) (-930.873) * [-926.991] (-928.354) (-929.928) (-927.060) -- 0:00:10
878500 -- (-927.931) (-926.163) [-927.706] (-927.685) * (-928.947) (-927.456) [-927.803] (-925.612) -- 0:00:10
879000 -- (-927.607) (-926.524) (-927.062) [-925.710] * [-928.191] (-926.869) (-928.054) (-925.651) -- 0:00:10
879500 -- [-927.540] (-928.768) (-927.941) (-929.098) * [-926.839] (-926.697) (-926.753) (-928.488) -- 0:00:10
880000 -- (-925.582) [-928.415] (-927.484) (-932.437) * (-927.005) (-927.312) (-927.011) [-928.393] -- 0:00:10
Average standard deviation of split frequencies: 0.009385
880500 -- [-927.012] (-928.383) (-931.670) (-929.303) * (-930.745) [-927.250] (-926.325) (-926.952) -- 0:00:10
881000 -- (-929.217) (-926.612) [-929.481] (-926.893) * [-927.758] (-931.072) (-929.443) (-928.051) -- 0:00:10
881500 -- (-927.060) (-926.945) [-928.361] (-928.589) * (-927.864) (-927.508) (-927.123) [-927.668] -- 0:00:10
882000 -- (-927.576) (-927.650) (-929.150) [-931.549] * (-927.840) (-926.037) [-926.816] (-927.726) -- 0:00:10
882500 -- (-927.423) (-927.646) (-930.725) [-929.439] * (-927.438) (-926.202) [-927.261] (-926.344) -- 0:00:09
883000 -- (-931.603) (-929.880) (-929.545) [-930.794] * (-926.945) (-933.050) (-928.576) [-930.842] -- 0:00:09
883500 -- (-931.424) [-926.467] (-928.475) (-928.028) * [-927.527] (-929.490) (-927.416) (-929.464) -- 0:00:09
884000 -- (-931.812) [-928.481] (-930.387) (-928.753) * (-927.344) [-929.460] (-926.933) (-929.486) -- 0:00:09
884500 -- (-928.093) (-927.460) (-929.194) [-926.748] * (-926.868) [-928.897] (-928.760) (-929.360) -- 0:00:09
885000 -- (-925.840) [-927.413] (-928.579) (-926.532) * (-927.304) (-933.714) [-926.538] (-926.358) -- 0:00:09
Average standard deviation of split frequencies: 0.009364
885500 -- [-926.714] (-932.126) (-927.606) (-927.704) * (-929.369) (-926.651) (-932.736) [-925.978] -- 0:00:09
886000 -- (-933.498) (-925.871) [-925.790] (-927.571) * (-926.481) (-928.212) (-926.876) [-927.466] -- 0:00:09
886500 -- [-929.697] (-927.028) (-927.308) (-925.978) * [-928.438] (-929.015) (-930.892) (-926.636) -- 0:00:09
887000 -- (-926.556) (-930.414) [-927.504] (-928.976) * (-927.337) (-926.229) [-927.631] (-926.356) -- 0:00:09
887500 -- [-926.911] (-926.412) (-928.088) (-927.756) * (-926.483) (-926.655) (-929.571) [-930.375] -- 0:00:09
888000 -- (-929.980) [-928.243] (-926.729) (-926.383) * [-926.607] (-927.003) (-931.151) (-930.389) -- 0:00:09
888500 -- (-926.795) (-928.322) (-927.342) [-927.341] * (-930.681) (-927.617) [-931.546] (-931.169) -- 0:00:09
889000 -- (-928.193) (-927.159) (-926.358) [-930.035] * (-930.307) (-926.095) [-927.716] (-930.373) -- 0:00:09
889500 -- (-929.079) [-927.374] (-926.951) (-931.135) * [-930.247] (-927.675) (-926.569) (-926.753) -- 0:00:09
890000 -- (-927.813) (-928.672) [-936.527] (-926.592) * (-929.347) (-928.651) [-926.303] (-926.753) -- 0:00:09
Average standard deviation of split frequencies: 0.010021
890500 -- (-926.518) (-927.467) [-927.877] (-926.090) * (-930.003) [-927.788] (-928.106) (-927.769) -- 0:00:09
891000 -- (-926.928) (-926.653) (-927.308) [-928.586] * (-925.902) [-926.665] (-928.277) (-928.918) -- 0:00:09
891500 -- (-929.723) (-926.475) (-926.953) [-929.064] * (-928.984) [-926.214] (-930.440) (-930.633) -- 0:00:09
892000 -- [-927.578] (-927.200) (-927.665) (-928.980) * (-929.221) (-928.271) (-933.975) [-927.671] -- 0:00:09
892500 -- [-931.824] (-930.515) (-927.898) (-925.895) * (-928.434) [-927.694] (-930.568) (-928.411) -- 0:00:09
893000 -- (-932.037) [-927.246] (-927.988) (-927.016) * (-930.251) (-927.529) [-926.782] (-928.274) -- 0:00:09
893500 -- (-929.194) [-926.468] (-928.376) (-928.027) * (-926.111) [-928.447] (-926.764) (-928.898) -- 0:00:09
894000 -- (-929.431) (-926.376) [-926.734] (-930.381) * (-925.693) (-927.511) [-927.332] (-929.242) -- 0:00:09
894500 -- (-929.480) (-927.262) (-927.028) [-930.761] * (-930.159) [-927.114] (-931.412) (-926.370) -- 0:00:08
895000 -- (-929.083) (-928.439) [-926.252] (-926.230) * (-929.120) [-926.981] (-928.421) (-930.284) -- 0:00:08
Average standard deviation of split frequencies: 0.010207
895500 -- [-927.690] (-930.531) (-926.496) (-929.123) * (-934.824) (-927.096) [-927.934] (-933.599) -- 0:00:08
896000 -- (-928.118) (-926.982) (-926.216) [-925.801] * (-929.261) [-929.740] (-929.235) (-927.089) -- 0:00:08
896500 -- (-930.026) (-931.343) [-926.486] (-927.484) * (-928.845) (-927.983) [-929.618] (-927.143) -- 0:00:08
897000 -- (-933.953) (-933.769) [-925.922] (-928.583) * (-929.879) (-928.288) [-927.157] (-929.126) -- 0:00:08
897500 -- [-932.581] (-930.869) (-926.517) (-930.058) * (-929.635) (-927.293) [-926.452] (-927.956) -- 0:00:08
898000 -- (-929.805) (-928.079) (-930.919) [-928.186] * (-930.362) (-928.163) [-926.269] (-927.133) -- 0:00:08
898500 -- (-929.661) (-928.398) (-927.467) [-928.438] * (-927.256) (-929.241) (-926.500) [-931.743] -- 0:00:08
899000 -- (-929.579) (-928.351) [-926.325] (-928.292) * [-928.715] (-926.599) (-927.010) (-930.137) -- 0:00:08
899500 -- (-926.253) (-928.132) (-929.942) [-927.944] * [-926.941] (-929.545) (-926.877) (-927.928) -- 0:00:08
900000 -- (-926.086) (-930.552) (-928.791) [-927.043] * [-929.098] (-927.229) (-926.838) (-928.669) -- 0:00:08
Average standard deviation of split frequencies: 0.010259
900500 -- (-928.097) (-927.634) (-927.980) [-926.280] * (-927.768) (-927.155) (-927.156) [-926.646] -- 0:00:08
901000 -- [-927.711] (-927.384) (-929.465) (-926.513) * [-927.023] (-927.488) (-928.052) (-927.538) -- 0:00:08
901500 -- (-926.389) (-929.282) (-929.115) [-928.644] * (-928.341) (-927.093) (-927.173) [-926.479] -- 0:00:08
902000 -- (-928.791) (-926.400) [-927.339] (-926.938) * (-927.764) (-930.698) [-927.211] (-932.061) -- 0:00:08
902500 -- [-926.026] (-926.635) (-927.243) (-927.276) * (-931.864) (-929.026) (-930.149) [-927.271] -- 0:00:08
903000 -- [-928.844] (-927.515) (-929.478) (-927.287) * [-928.652] (-928.567) (-928.160) (-930.246) -- 0:00:08
903500 -- (-927.724) (-929.583) [-927.207] (-928.975) * (-926.734) (-927.051) (-930.444) [-928.839] -- 0:00:08
904000 -- [-926.834] (-930.132) (-928.577) (-929.524) * (-927.417) (-928.700) (-926.728) [-932.451] -- 0:00:08
904500 -- (-928.765) (-927.898) [-927.310] (-927.246) * (-929.394) (-930.013) [-926.837] (-926.870) -- 0:00:08
905000 -- [-928.464] (-926.716) (-927.864) (-928.434) * (-928.909) [-926.482] (-926.907) (-930.285) -- 0:00:08
Average standard deviation of split frequencies: 0.009921
905500 -- (-928.357) [-927.835] (-928.832) (-927.758) * (-930.220) (-928.509) [-929.136] (-930.529) -- 0:00:08
906000 -- [-932.075] (-932.981) (-930.457) (-926.384) * (-926.492) [-929.042] (-927.840) (-927.014) -- 0:00:07
906500 -- (-926.659) [-926.608] (-930.191) (-928.433) * (-926.519) [-929.174] (-926.390) (-931.924) -- 0:00:07
907000 -- [-926.799] (-927.053) (-930.601) (-932.014) * (-927.395) [-926.880] (-927.874) (-928.058) -- 0:00:07
907500 -- (-928.719) [-929.761] (-927.710) (-927.311) * (-926.214) (-927.876) (-930.097) [-930.059] -- 0:00:07
908000 -- (-926.293) (-928.405) (-927.296) [-930.552] * (-928.081) (-930.102) [-927.580] (-930.463) -- 0:00:07
908500 -- [-926.060] (-926.558) (-927.006) (-928.320) * (-926.527) [-929.516] (-926.429) (-927.199) -- 0:00:07
909000 -- (-928.605) (-929.896) [-926.792] (-930.281) * (-931.735) (-928.762) [-926.043] (-929.067) -- 0:00:07
909500 -- [-928.990] (-927.323) (-926.371) (-928.043) * [-929.425] (-926.629) (-926.870) (-927.527) -- 0:00:07
910000 -- (-929.995) (-927.577) (-925.724) [-927.985] * [-927.355] (-928.780) (-928.449) (-928.657) -- 0:00:07
Average standard deviation of split frequencies: 0.009904
910500 -- (-929.062) [-928.131] (-931.701) (-929.133) * (-929.930) (-931.669) [-928.148] (-927.189) -- 0:00:07
911000 -- [-926.524] (-925.973) (-927.579) (-928.810) * (-929.454) (-931.303) (-926.813) [-928.652] -- 0:00:07
911500 -- (-927.086) (-928.037) (-926.362) [-928.004] * (-928.798) (-931.819) [-926.922] (-930.041) -- 0:00:07
912000 -- (-932.927) (-929.045) (-928.930) [-926.968] * (-926.682) (-932.117) [-928.650] (-930.698) -- 0:00:07
912500 -- [-928.591] (-927.422) (-931.180) (-931.115) * (-927.152) (-928.036) (-929.266) [-930.054] -- 0:00:07
913000 -- (-927.387) [-926.777] (-927.951) (-931.378) * (-927.283) (-928.733) [-930.299] (-932.781) -- 0:00:07
913500 -- (-928.698) (-927.221) (-926.528) [-927.251] * (-928.940) [-926.331] (-929.522) (-930.973) -- 0:00:07
914000 -- (-929.425) (-926.347) [-926.458] (-929.937) * (-930.650) (-928.074) (-930.151) [-927.614] -- 0:00:07
914500 -- (-928.017) (-934.101) (-928.493) [-928.242] * (-928.058) (-928.212) (-929.236) [-927.689] -- 0:00:07
915000 -- (-926.380) [-929.416] (-926.807) (-929.163) * (-928.079) [-930.026] (-930.784) (-930.101) -- 0:00:07
Average standard deviation of split frequencies: 0.009675
915500 -- (-926.612) (-930.359) [-928.535] (-929.206) * (-931.108) [-927.626] (-935.978) (-933.038) -- 0:00:07
916000 -- [-926.176] (-931.119) (-930.293) (-929.020) * (-926.614) (-931.391) (-928.466) [-927.904] -- 0:00:07
916500 -- (-929.456) (-927.255) [-927.615] (-926.633) * (-926.812) [-931.592] (-926.639) (-928.279) -- 0:00:07
917000 -- (-929.996) (-928.351) [-928.579] (-928.566) * (-926.030) [-927.099] (-926.482) (-931.096) -- 0:00:07
917500 -- (-932.467) (-927.331) [-928.883] (-927.205) * (-926.749) (-928.267) (-926.067) [-926.130] -- 0:00:07
918000 -- [-927.781] (-928.548) (-926.871) (-927.044) * (-927.538) [-928.003] (-926.068) (-926.229) -- 0:00:06
918500 -- (-928.288) (-928.901) [-928.779] (-930.909) * [-927.932] (-933.374) (-926.914) (-928.810) -- 0:00:06
919000 -- (-928.533) (-927.227) (-931.263) [-928.616] * (-931.253) (-926.188) (-926.160) [-929.187] -- 0:00:06
919500 -- (-926.598) (-927.841) [-928.789] (-932.309) * (-930.933) (-926.026) (-927.802) [-928.052] -- 0:00:06
920000 -- (-928.649) [-930.887] (-927.647) (-927.694) * (-934.272) (-927.815) [-928.243] (-927.471) -- 0:00:06
Average standard deviation of split frequencies: 0.009080
920500 -- (-933.403) (-929.296) (-927.616) [-927.497] * (-931.596) [-925.695] (-929.831) (-926.853) -- 0:00:06
921000 -- (-929.392) (-931.490) (-930.866) [-928.024] * [-929.359] (-930.053) (-927.542) (-927.721) -- 0:00:06
921500 -- (-929.798) (-926.913) (-927.741) [-928.700] * [-927.770] (-927.957) (-927.333) (-926.638) -- 0:00:06
922000 -- (-929.410) (-929.300) (-928.193) [-926.850] * (-926.757) (-926.553) (-928.910) [-926.325] -- 0:00:06
922500 -- [-927.024] (-927.068) (-927.501) (-926.867) * [-928.015] (-931.649) (-928.233) (-929.376) -- 0:00:06
923000 -- (-932.162) [-927.843] (-926.772) (-927.821) * (-926.536) [-928.954] (-928.347) (-928.858) -- 0:00:06
923500 -- [-926.989] (-926.879) (-926.356) (-928.915) * (-927.309) [-927.031] (-929.231) (-928.941) -- 0:00:06
924000 -- (-926.078) [-925.973] (-928.001) (-928.734) * [-926.995] (-929.112) (-930.304) (-928.219) -- 0:00:06
924500 -- (-925.917) (-932.381) (-926.649) [-928.076] * [-927.415] (-927.629) (-929.658) (-926.526) -- 0:00:06
925000 -- [-929.039] (-930.275) (-926.512) (-928.952) * [-928.474] (-933.707) (-926.608) (-927.076) -- 0:00:06
Average standard deviation of split frequencies: 0.009129
925500 -- [-928.634] (-927.208) (-926.645) (-928.245) * (-929.049) (-930.541) (-926.839) [-928.924] -- 0:00:06
926000 -- (-927.934) (-931.663) (-928.709) [-929.115] * (-928.086) (-934.731) [-928.202] (-929.207) -- 0:00:06
926500 -- (-929.370) (-927.195) (-932.851) [-932.331] * (-935.501) (-928.171) [-927.967] (-930.858) -- 0:00:06
927000 -- (-930.459) [-928.799] (-928.848) (-931.408) * (-927.470) (-926.142) (-929.894) [-930.053] -- 0:00:06
927500 -- (-929.867) [-929.320] (-926.440) (-930.857) * (-926.300) (-927.302) [-929.720] (-929.805) -- 0:00:06
928000 -- (-928.594) (-928.785) [-927.202] (-930.550) * [-929.684] (-927.930) (-928.583) (-926.163) -- 0:00:06
928500 -- (-928.600) (-927.576) [-927.638] (-927.884) * (-930.989) (-926.557) (-928.004) [-926.175] -- 0:00:06
929000 -- (-927.615) (-929.658) [-927.177] (-927.058) * (-930.887) (-927.001) [-930.569] (-926.945) -- 0:00:06
929500 -- (-925.992) (-931.358) [-928.925] (-927.294) * [-929.825] (-928.742) (-929.940) (-926.426) -- 0:00:05
930000 -- (-931.101) (-927.154) [-927.662] (-927.658) * (-926.150) (-931.202) (-930.693) [-926.400] -- 0:00:05
Average standard deviation of split frequencies: 0.008375
930500 -- (-928.889) (-932.101) (-929.429) [-928.410] * (-926.700) [-927.863] (-931.458) (-927.966) -- 0:00:05
931000 -- [-928.303] (-929.364) (-930.756) (-926.767) * (-927.265) [-931.127] (-932.942) (-929.808) -- 0:00:05
931500 -- (-928.462) (-928.956) (-927.020) [-925.799] * (-926.466) (-926.415) [-928.094] (-931.187) -- 0:00:05
932000 -- (-928.163) (-929.379) (-926.924) [-928.556] * (-928.291) (-927.567) (-927.986) [-928.871] -- 0:00:05
932500 -- (-927.372) (-927.639) (-929.253) [-927.341] * (-926.804) (-927.025) [-926.219] (-938.643) -- 0:00:05
933000 -- [-927.942] (-927.397) (-929.122) (-929.841) * [-926.959] (-928.625) (-927.477) (-937.299) -- 0:00:05
933500 -- (-926.073) [-926.954] (-931.284) (-926.498) * (-926.439) [-926.776] (-929.817) (-927.783) -- 0:00:05
934000 -- (-927.141) [-926.879] (-930.295) (-927.611) * [-927.462] (-927.217) (-926.073) (-930.659) -- 0:00:05
934500 -- (-931.003) [-926.772] (-927.693) (-931.978) * (-926.855) [-926.465] (-926.437) (-928.579) -- 0:00:05
935000 -- (-927.219) (-929.201) [-927.263] (-927.328) * [-928.739] (-927.861) (-925.855) (-927.626) -- 0:00:05
Average standard deviation of split frequencies: 0.008696
935500 -- (-927.410) (-926.832) (-930.664) [-926.027] * (-929.051) (-929.143) (-926.100) [-928.034] -- 0:00:05
936000 -- [-929.216] (-927.831) (-929.919) (-926.295) * [-928.174] (-929.291) (-928.204) (-926.409) -- 0:00:05
936500 -- (-927.289) [-927.467] (-927.287) (-930.213) * (-931.438) (-931.507) (-933.765) [-928.465] -- 0:00:05
937000 -- (-927.746) (-930.196) [-932.854] (-927.462) * (-930.002) (-926.649) [-927.605] (-928.817) -- 0:00:05
937500 -- (-927.060) (-926.692) [-927.778] (-929.591) * [-930.776] (-926.194) (-927.104) (-928.078) -- 0:00:05
938000 -- [-929.201] (-926.016) (-929.822) (-929.703) * (-927.574) (-928.970) [-926.432] (-926.504) -- 0:00:05
938500 -- (-932.196) (-929.842) [-929.640] (-927.782) * (-926.321) (-928.498) [-926.075] (-926.308) -- 0:00:05
939000 -- (-929.579) [-927.884] (-927.585) (-929.679) * (-928.419) [-930.143] (-928.265) (-930.576) -- 0:00:05
939500 -- (-930.081) [-928.549] (-930.226) (-928.399) * (-927.324) (-928.555) [-927.388] (-931.046) -- 0:00:05
940000 -- (-926.544) (-928.223) [-928.767] (-927.648) * (-925.874) (-928.233) (-926.594) [-928.645] -- 0:00:05
Average standard deviation of split frequencies: 0.008519
940500 -- [-926.458] (-926.437) (-927.739) (-926.450) * (-928.328) (-927.185) [-926.947] (-930.412) -- 0:00:05
941000 -- (-930.111) (-928.494) [-932.040] (-926.502) * (-927.067) (-928.814) (-928.151) [-929.384] -- 0:00:05
941500 -- [-926.312] (-929.390) (-926.523) (-930.400) * (-928.098) (-926.823) [-928.072] (-928.386) -- 0:00:04
942000 -- (-926.223) [-926.901] (-928.018) (-933.270) * (-928.137) (-929.810) (-928.207) [-928.586] -- 0:00:04
942500 -- (-934.088) [-927.062] (-926.898) (-926.908) * (-928.584) (-929.976) (-928.377) [-926.497] -- 0:00:04
943000 -- [-928.143] (-928.628) (-926.645) (-931.173) * (-929.764) [-927.343] (-926.997) (-926.361) -- 0:00:04
943500 -- (-927.779) (-927.814) [-927.563] (-932.872) * (-928.481) [-927.513] (-929.995) (-926.864) -- 0:00:04
944000 -- (-927.971) (-928.019) (-928.514) [-928.572] * [-927.978] (-927.989) (-928.684) (-926.498) -- 0:00:04
944500 -- (-928.893) [-926.316] (-929.374) (-927.721) * [-926.931] (-928.241) (-930.108) (-929.110) -- 0:00:04
945000 -- (-928.820) [-927.520] (-930.050) (-929.828) * [-928.870] (-929.222) (-927.208) (-928.159) -- 0:00:04
Average standard deviation of split frequencies: 0.008704
945500 -- (-929.382) [-927.844] (-931.163) (-927.446) * (-928.133) (-929.786) [-926.724] (-928.271) -- 0:00:04
946000 -- (-928.212) (-927.171) (-929.295) [-927.393] * (-926.389) (-929.614) (-928.890) [-929.717] -- 0:00:04
946500 -- [-928.379] (-929.699) (-930.999) (-926.389) * (-925.884) (-930.980) (-930.218) [-930.445] -- 0:00:04
947000 -- (-931.201) (-929.101) [-927.984] (-927.758) * [-932.408] (-927.261) (-928.276) (-928.961) -- 0:00:04
947500 -- (-932.303) (-928.936) (-927.339) [-929.291] * [-932.347] (-927.080) (-929.860) (-927.166) -- 0:00:04
948000 -- (-930.348) [-926.732] (-927.002) (-928.912) * (-927.603) (-927.414) (-928.939) [-926.942] -- 0:00:04
948500 -- (-926.726) (-927.724) [-927.819] (-925.944) * (-926.152) [-928.350] (-928.324) (-931.139) -- 0:00:04
949000 -- [-927.573] (-929.017) (-927.258) (-937.950) * (-927.160) (-929.659) [-928.039] (-928.025) -- 0:00:04
949500 -- (-926.945) (-929.546) [-926.205] (-932.975) * (-930.376) [-927.520] (-927.091) (-930.196) -- 0:00:04
950000 -- [-926.975] (-929.678) (-929.065) (-927.078) * (-928.773) (-928.382) [-925.665] (-928.575) -- 0:00:04
Average standard deviation of split frequencies: 0.008496
950500 -- [-931.334] (-927.183) (-927.469) (-926.449) * (-928.366) (-927.447) (-925.641) [-928.296] -- 0:00:04
951000 -- [-929.554] (-927.439) (-927.753) (-927.136) * [-928.183] (-926.150) (-929.118) (-929.906) -- 0:00:04
951500 -- (-931.125) (-928.602) (-927.904) [-929.591] * (-927.701) (-926.564) [-927.972] (-928.570) -- 0:00:04
952000 -- (-932.453) (-930.896) [-928.200] (-929.095) * (-930.879) (-929.297) (-928.935) [-930.415] -- 0:00:04
952500 -- [-926.289] (-932.963) (-929.788) (-930.752) * (-928.829) [-928.535] (-928.739) (-926.166) -- 0:00:04
953000 -- (-926.152) (-931.203) [-927.350] (-931.049) * (-927.861) (-930.798) [-927.999] (-931.449) -- 0:00:03
953500 -- [-926.265] (-933.490) (-930.171) (-929.280) * [-927.364] (-931.155) (-926.868) (-926.749) -- 0:00:03
954000 -- (-928.373) [-930.432] (-930.066) (-927.822) * [-931.947] (-933.508) (-929.586) (-927.270) -- 0:00:03
954500 -- (-929.216) (-932.514) (-929.521) [-930.509] * (-927.223) [-931.209] (-927.184) (-926.675) -- 0:00:03
955000 -- [-927.936] (-933.274) (-928.733) (-928.589) * (-928.324) (-930.628) [-927.395] (-928.295) -- 0:00:03
Average standard deviation of split frequencies: 0.008416
955500 -- (-928.926) (-928.867) (-930.666) [-927.697] * (-928.542) [-931.759] (-926.039) (-928.497) -- 0:00:03
956000 -- [-926.895] (-927.350) (-932.727) (-927.563) * (-928.313) [-930.336] (-928.308) (-927.614) -- 0:00:03
956500 -- (-927.692) [-927.957] (-928.707) (-926.066) * [-927.866] (-932.667) (-927.738) (-930.057) -- 0:00:03
957000 -- [-932.237] (-925.952) (-927.932) (-926.421) * (-927.939) (-931.020) (-928.032) [-928.821] -- 0:00:03
957500 -- (-930.089) [-925.836] (-930.892) (-927.315) * (-931.700) (-927.055) [-926.177] (-928.178) -- 0:00:03
958000 -- (-931.715) [-925.971] (-927.216) (-929.368) * [-927.491] (-928.356) (-933.576) (-929.516) -- 0:00:03
958500 -- [-927.996] (-928.087) (-928.274) (-932.680) * (-926.201) (-929.350) (-931.662) [-929.488] -- 0:00:03
959000 -- (-928.404) [-928.271] (-927.950) (-929.878) * (-927.144) (-929.266) (-928.820) [-927.339] -- 0:00:03
959500 -- (-927.566) (-927.482) (-929.840) [-928.636] * (-928.264) [-928.665] (-928.665) (-927.180) -- 0:00:03
960000 -- (-928.314) (-927.403) [-927.985] (-928.226) * (-928.086) (-930.117) [-927.603] (-928.362) -- 0:00:03
Average standard deviation of split frequencies: 0.008538
960500 -- (-930.010) (-927.564) [-927.712] (-932.554) * (-931.757) (-927.520) [-927.447] (-930.025) -- 0:00:03
961000 -- [-927.324] (-927.649) (-926.978) (-927.014) * (-927.937) (-929.415) (-928.239) [-926.932] -- 0:00:03
961500 -- [-930.352] (-927.809) (-931.782) (-931.754) * (-927.143) (-929.106) (-929.495) [-926.434] -- 0:00:03
962000 -- [-927.560] (-929.011) (-930.567) (-928.901) * (-926.321) (-931.960) (-929.250) [-926.065] -- 0:00:03
962500 -- [-930.159] (-927.724) (-927.013) (-929.812) * (-926.362) (-928.348) [-930.031] (-925.950) -- 0:00:03
963000 -- (-927.156) (-926.047) (-926.259) [-928.414] * (-926.554) (-927.184) (-928.057) [-926.259] -- 0:00:03
963500 -- (-927.388) [-926.647] (-926.344) (-928.772) * (-927.469) (-927.108) (-927.564) [-927.721] -- 0:00:03
964000 -- [-928.378] (-927.182) (-926.716) (-927.556) * (-927.109) (-926.579) [-926.048] (-929.217) -- 0:00:03
964500 -- (-928.912) (-928.065) (-926.879) [-928.184] * [-930.009] (-927.113) (-927.430) (-928.302) -- 0:00:03
965000 -- (-927.058) (-933.149) (-926.853) [-927.401] * [-929.330] (-927.730) (-930.710) (-927.439) -- 0:00:02
Average standard deviation of split frequencies: 0.008361
965500 -- (-930.215) [-929.688] (-926.680) (-926.774) * [-928.777] (-926.966) (-927.951) (-929.454) -- 0:00:02
966000 -- (-926.395) [-926.794] (-925.972) (-927.240) * (-928.928) (-928.059) [-927.822] (-926.528) -- 0:00:02
966500 -- (-926.516) (-927.807) [-927.124] (-928.548) * (-926.873) (-927.827) [-927.773] (-931.103) -- 0:00:02
967000 -- [-926.752] (-930.416) (-930.049) (-930.595) * (-928.320) (-927.709) (-928.312) [-927.281] -- 0:00:02
967500 -- (-927.378) (-930.509) (-927.026) [-928.562] * (-926.931) (-929.797) (-926.421) [-931.082] -- 0:00:02
968000 -- [-929.680] (-928.729) (-926.967) (-926.908) * [-931.747] (-929.219) (-927.246) (-929.239) -- 0:00:02
968500 -- (-928.340) [-928.247] (-927.682) (-927.028) * [-926.564] (-927.301) (-929.373) (-927.305) -- 0:00:02
969000 -- (-927.755) [-929.941] (-927.411) (-928.026) * (-926.350) (-930.770) (-930.254) [-927.158] -- 0:00:02
969500 -- [-930.852] (-926.753) (-929.446) (-930.461) * (-926.399) (-928.166) [-926.638] (-928.588) -- 0:00:02
970000 -- (-926.112) (-928.583) [-927.290] (-928.788) * (-927.138) [-928.254] (-926.141) (-928.124) -- 0:00:02
Average standard deviation of split frequencies: 0.007868
970500 -- (-926.152) (-927.557) (-927.592) [-928.426] * (-928.935) (-928.249) (-927.478) [-927.688] -- 0:00:02
971000 -- (-930.545) (-930.912) (-927.312) [-932.485] * (-926.574) (-927.754) (-926.677) [-928.446] -- 0:00:02
971500 -- (-928.895) (-928.626) (-929.977) [-926.370] * [-926.237] (-928.526) (-930.096) (-927.629) -- 0:00:02
972000 -- (-932.199) (-929.470) (-928.398) [-927.745] * (-928.540) [-930.338] (-926.914) (-927.718) -- 0:00:02
972500 -- (-926.917) [-926.404] (-927.103) (-929.054) * (-927.168) (-927.878) [-927.610] (-929.912) -- 0:00:02
973000 -- (-927.037) (-928.722) [-927.689] (-930.228) * (-926.487) (-927.892) (-928.506) [-929.617] -- 0:00:02
973500 -- (-930.587) (-930.519) (-927.288) [-931.284] * [-928.553] (-929.115) (-927.190) (-927.987) -- 0:00:02
974000 -- (-927.182) (-928.727) [-926.534] (-932.019) * [-926.972] (-927.033) (-928.354) (-929.025) -- 0:00:02
974500 -- (-928.399) (-927.367) [-928.659] (-928.520) * (-926.035) (-928.401) (-926.921) [-928.033] -- 0:00:02
975000 -- (-930.625) (-928.621) (-927.295) [-926.569] * [-927.285] (-930.557) (-929.597) (-926.668) -- 0:00:02
Average standard deviation of split frequencies: 0.007535
975500 -- [-927.384] (-926.629) (-926.666) (-930.060) * (-928.969) [-926.757] (-931.414) (-929.544) -- 0:00:02
976000 -- (-928.032) (-926.655) [-927.182] (-930.043) * [-927.953] (-929.365) (-927.607) (-925.897) -- 0:00:02
976500 -- (-926.389) (-925.747) [-928.717] (-931.414) * (-927.771) (-926.699) [-926.456] (-926.105) -- 0:00:01
977000 -- (-929.077) (-932.036) [-928.227] (-930.374) * [-928.338] (-927.451) (-927.861) (-926.809) -- 0:00:01
977500 -- (-927.074) (-930.918) [-926.975] (-926.382) * [-927.453] (-927.205) (-927.236) (-928.181) -- 0:00:01
978000 -- [-928.965] (-930.167) (-926.084) (-926.706) * (-929.225) (-929.015) (-926.968) [-927.436] -- 0:00:01
978500 -- (-926.651) (-932.538) [-926.953] (-929.788) * (-927.762) (-932.984) (-929.447) [-926.421] -- 0:00:01
979000 -- (-925.766) (-928.373) [-927.166] (-929.493) * (-928.135) (-929.741) [-929.336] (-926.516) -- 0:00:01
979500 -- [-930.726] (-926.482) (-925.976) (-929.372) * (-928.906) (-930.629) (-927.595) [-931.468] -- 0:00:01
980000 -- (-929.364) [-927.005] (-927.081) (-931.298) * (-928.807) (-928.574) (-927.520) [-926.965] -- 0:00:01
Average standard deviation of split frequencies: 0.007563
980500 -- (-926.661) (-925.854) (-930.494) [-928.631] * (-930.218) (-927.712) [-926.221] (-928.098) -- 0:00:01
981000 -- (-927.457) [-930.891] (-930.681) (-927.995) * (-928.213) (-926.641) [-929.417] (-930.072) -- 0:00:01
981500 -- (-926.106) (-929.756) (-930.910) [-927.365] * (-927.436) [-927.835] (-927.974) (-926.415) -- 0:00:01
982000 -- (-926.149) (-929.140) (-929.026) [-926.777] * [-929.493] (-927.683) (-930.045) (-929.059) -- 0:00:01
982500 -- (-928.070) (-927.730) [-927.728] (-929.776) * (-928.398) [-928.692] (-929.317) (-931.598) -- 0:00:01
983000 -- (-928.075) (-926.623) [-927.083] (-926.737) * [-926.346] (-926.951) (-927.855) (-930.509) -- 0:00:01
983500 -- (-927.462) (-926.513) [-927.785] (-926.562) * (-926.748) [-929.014] (-931.606) (-928.841) -- 0:00:01
984000 -- (-927.733) [-926.624] (-934.430) (-930.129) * (-929.867) (-928.306) (-928.063) [-927.611] -- 0:00:01
984500 -- [-928.028] (-926.276) (-926.028) (-927.435) * (-931.325) [-926.740] (-927.073) (-927.689) -- 0:00:01
985000 -- [-927.187] (-926.102) (-926.444) (-929.291) * [-926.941] (-927.958) (-928.279) (-927.964) -- 0:00:01
Average standard deviation of split frequencies: 0.007395
985500 -- (-926.528) (-929.619) [-927.811] (-928.778) * (-926.219) (-927.062) (-928.582) [-926.525] -- 0:00:01
986000 -- (-931.529) (-928.710) (-927.184) [-933.451] * (-926.962) [-927.417] (-927.180) (-928.589) -- 0:00:01
986500 -- (-935.128) (-927.078) [-926.516] (-926.870) * (-926.331) (-925.980) [-928.130] (-930.921) -- 0:00:01
987000 -- (-928.822) [-930.355] (-926.626) (-926.874) * (-929.608) [-927.110] (-927.604) (-929.350) -- 0:00:01
987500 -- (-926.885) [-927.457] (-930.197) (-928.508) * (-927.409) (-927.087) [-927.768] (-930.157) -- 0:00:01
988000 -- (-926.306) (-931.660) [-928.345] (-927.847) * (-927.396) (-926.357) (-927.370) [-929.350] -- 0:00:01
988500 -- [-927.669] (-932.830) (-928.867) (-927.859) * [-926.768] (-929.439) (-931.490) (-928.257) -- 0:00:00
989000 -- (-926.711) [-930.542] (-929.674) (-925.838) * (-926.841) [-926.877] (-927.332) (-929.340) -- 0:00:00
989500 -- (-926.711) (-926.745) [-929.856] (-928.423) * (-927.785) (-929.256) (-928.458) [-928.431] -- 0:00:00
990000 -- [-927.336] (-929.396) (-927.233) (-925.796) * (-928.638) [-929.317] (-926.372) (-928.494) -- 0:00:00
Average standard deviation of split frequencies: 0.007360
990500 -- [-929.299] (-929.185) (-927.216) (-926.585) * (-933.676) [-927.797] (-926.042) (-930.413) -- 0:00:00
991000 -- [-926.422] (-927.679) (-928.297) (-928.370) * (-930.389) (-927.990) [-927.073] (-929.136) -- 0:00:00
991500 -- (-926.773) [-926.951] (-928.109) (-928.777) * (-929.113) (-929.261) [-928.336] (-928.100) -- 0:00:00
992000 -- (-929.478) (-927.036) (-926.790) [-927.118] * (-932.483) (-934.871) (-926.973) [-927.268] -- 0:00:00
992500 -- (-928.638) (-926.966) [-926.673] (-928.502) * (-926.838) (-937.180) (-927.383) [-930.564] -- 0:00:00
993000 -- (-927.640) (-931.368) [-927.304] (-928.267) * (-928.374) (-933.524) (-926.958) [-926.908] -- 0:00:00
993500 -- (-931.009) (-928.025) (-926.543) [-926.449] * (-926.252) (-926.885) [-928.661] (-926.547) -- 0:00:00
994000 -- (-927.604) [-935.519] (-930.002) (-926.341) * (-926.939) (-928.901) [-927.412] (-928.432) -- 0:00:00
994500 -- (-927.012) (-937.784) [-927.322] (-933.209) * (-926.996) [-927.212] (-929.717) (-929.457) -- 0:00:00
995000 -- (-927.246) (-932.107) [-930.253] (-931.503) * (-929.402) [-929.357] (-928.103) (-931.536) -- 0:00:00
Average standard deviation of split frequencies: 0.007194
995500 -- (-930.724) (-931.818) [-929.898] (-931.567) * (-927.933) [-929.108] (-932.526) (-929.222) -- 0:00:00
996000 -- (-927.979) (-926.912) (-927.680) [-931.385] * [-930.366] (-929.337) (-930.440) (-925.809) -- 0:00:00
996500 -- (-926.136) [-925.878] (-929.791) (-927.694) * (-928.040) [-927.900] (-928.727) (-927.273) -- 0:00:00
997000 -- (-932.212) (-928.955) (-932.460) [-927.882] * (-928.743) (-926.683) (-928.172) [-932.398] -- 0:00:00
997500 -- [-928.491] (-926.220) (-928.875) (-932.073) * (-928.548) [-926.587] (-929.536) (-928.073) -- 0:00:00
998000 -- (-928.704) (-927.692) [-928.064] (-928.008) * (-927.014) (-926.231) [-928.447] (-927.230) -- 0:00:00
998500 -- (-930.094) (-927.458) (-927.352) [-926.074] * (-928.574) [-928.493] (-927.726) (-928.280) -- 0:00:00
999000 -- (-929.371) [-927.234] (-927.425) (-926.334) * (-927.450) [-927.654] (-930.549) (-927.641) -- 0:00:00
999500 -- (-927.811) [-927.262] (-927.235) (-929.727) * (-928.548) (-927.978) (-929.250) [-926.546] -- 0:00:00
1000000 -- (-928.135) (-927.379) [-926.899] (-928.082) * (-927.800) (-928.866) [-928.012] (-930.014) -- 0:00:00
Average standard deviation of split frequencies: 0.007537
Analysis completed in 1 mins 25 seconds
Analysis used 83.69 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -925.56
Likelihood of best state for "cold" chain of run 2 was -925.56
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.6 % ( 12 %) Dirichlet(Pi{all})
30.6 % ( 23 %) Slider(Pi{all})
78.8 % ( 57 %) Multiplier(Alpha{1,2})
77.8 % ( 52 %) Multiplier(Alpha{3})
20.9 % ( 21 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.3 % ( 29 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.2 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
28.6 % ( 27 %) Dirichlet(Pi{all})
30.1 % ( 27 %) Slider(Pi{all})
78.7 % ( 56 %) Multiplier(Alpha{1,2})
78.3 % ( 52 %) Multiplier(Alpha{3})
21.9 % ( 32 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.0 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 95 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.3 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166336 0.82 0.67
3 | 166329 167259 0.84
4 | 166767 166731 166578
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166523 0.82 0.67
3 | 166006 166948 0.84
4 | 166932 166863 166728
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -927.35
| 1 |
| 1 1 1 1 |
| 1 * 1 1 2 1 2 |
| * 2 * 1 222 2 |
| * 111 2 22 1 1 * 1 |
| 21 2 2 1 2 2 1 22 1 |
|1 1 2 2 1 1 2 1 2 2 1 |
|2 2 1 12 1 1 1 2 1 |
| 22 2 1 2 1 2 2 2 1|
| 21 1 121 1 2 2 1 * *2 2|
| * 12 2 11 1 1 2 1 |
| 1 * 2 2 |
| 2 2 2 2 2 1 |
| 2 2 |
| 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -928.80
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -927.26 -930.72
2 -927.31 -930.61
--------------------------------------
TOTAL -927.29 -930.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888053 0.088642 0.395427 1.529950 0.855536 1501.00 1501.00 1.000
r(A<->C){all} 0.162191 0.019916 0.000052 0.454711 0.120472 219.61 225.79 1.000
r(A<->G){all} 0.178428 0.022504 0.000001 0.488178 0.136048 174.59 187.27 1.000
r(A<->T){all} 0.169518 0.019799 0.000036 0.459523 0.133929 225.35 243.03 1.000
r(C<->G){all} 0.158708 0.018465 0.000310 0.430882 0.121381 188.00 210.43 1.002
r(C<->T){all} 0.165958 0.020156 0.000042 0.451072 0.129132 235.98 313.24 1.000
r(G<->T){all} 0.165198 0.018318 0.000017 0.431842 0.133142 205.35 221.10 1.001
pi(A){all} 0.197044 0.000229 0.168918 0.226847 0.196383 1279.24 1287.91 1.000
pi(C){all} 0.273556 0.000284 0.241833 0.307494 0.272992 1350.35 1391.98 1.000
pi(G){all} 0.322841 0.000313 0.288487 0.357458 0.322225 1251.85 1273.86 1.000
pi(T){all} 0.206558 0.000241 0.177002 0.238004 0.206558 808.80 1031.07 1.001
alpha{1,2} 0.429191 0.228381 0.000261 1.436906 0.260787 1304.64 1327.06 1.000
alpha{3} 0.442424 0.217974 0.000120 1.357014 0.284774 959.23 1147.80 1.001
pinvar{all} 0.997715 0.000008 0.992518 1.000000 0.998596 1305.65 1351.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...**.
8 -- ..****
9 -- ..**..
10 -- ....**
11 -- .***.*
12 -- ..*..*
13 -- .**...
14 -- .*...*
15 -- .*.***
16 -- ...*.*
17 -- .*..*.
18 -- .*.*..
19 -- ..*.*.
20 -- .**.**
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 453 0.150899 0.002355 0.149234 0.152565 2
8 448 0.149234 0.016017 0.137908 0.160560 2
9 447 0.148901 0.002355 0.147235 0.150566 2
10 446 0.148568 0.017901 0.135909 0.161226 2
11 440 0.146569 0.002827 0.144570 0.148568 2
12 433 0.144237 0.006124 0.139907 0.148568 2
13 427 0.142239 0.006124 0.137908 0.146569 2
14 424 0.141239 0.001884 0.139907 0.142572 2
15 421 0.140240 0.001413 0.139241 0.141239 2
16 420 0.139907 0.001884 0.138574 0.141239 2
17 418 0.139241 0.000942 0.138574 0.139907 2
18 417 0.138907 0.018373 0.125916 0.151899 2
19 417 0.138907 0.008951 0.132578 0.145237 2
20 407 0.135576 0.003298 0.133245 0.137908 2
21 406 0.135243 0.022612 0.119254 0.151233 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100899 0.010654 0.000024 0.306551 0.067804 1.000 2
length{all}[2] 0.098688 0.010356 0.000010 0.317997 0.067638 1.001 2
length{all}[3] 0.097409 0.009521 0.000000 0.289741 0.067596 1.000 2
length{all}[4] 0.098394 0.009758 0.000016 0.290286 0.067838 1.000 2
length{all}[5] 0.098071 0.009392 0.000126 0.293657 0.069299 1.000 2
length{all}[6] 0.098586 0.010101 0.000026 0.291326 0.068690 1.000 2
length{all}[7] 0.099016 0.009379 0.000399 0.301651 0.067116 0.998 2
length{all}[8] 0.101050 0.011264 0.000226 0.343742 0.069422 0.998 2
length{all}[9] 0.100716 0.008097 0.000371 0.306010 0.073918 0.999 2
length{all}[10] 0.097649 0.010107 0.000054 0.293258 0.065776 0.998 2
length{all}[11] 0.092805 0.009464 0.000202 0.266998 0.066752 0.998 2
length{all}[12] 0.098466 0.009236 0.000438 0.302564 0.069961 1.007 2
length{all}[13] 0.105225 0.010011 0.000123 0.306140 0.075859 0.998 2
length{all}[14] 0.092834 0.007936 0.000036 0.273231 0.063111 0.998 2
length{all}[15] 0.088088 0.006794 0.000554 0.264719 0.062162 0.999 2
length{all}[16] 0.098366 0.010614 0.000075 0.304033 0.063483 0.998 2
length{all}[17] 0.092387 0.007574 0.000090 0.252555 0.067042 0.999 2
length{all}[18] 0.106064 0.010748 0.000066 0.308709 0.072598 0.998 2
length{all}[19] 0.104583 0.010414 0.000322 0.316326 0.068968 0.998 2
length{all}[20] 0.102615 0.009079 0.000023 0.294980 0.076067 0.998 2
length{all}[21] 0.092855 0.009477 0.000112 0.268913 0.063251 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007537
Maximum standard deviation of split frequencies = 0.022612
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 696
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
27 ambiguity characters in seq. 1
36 ambiguity characters in seq. 2
27 ambiguity characters in seq. 3
27 ambiguity characters in seq. 4
18 ambiguity characters in seq. 5
18 ambiguity characters in seq. 6
12 sites are removed. 1 2 3 4 5 6 227 228 229 230 231 232
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 220 / 220 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 220 / 220 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021730 0.090695 0.060161 0.056805 0.078698 0.010970 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -936.266818
Iterating by ming2
Initial: fx= 936.266818
x= 0.02173 0.09070 0.06016 0.05680 0.07870 0.01097 0.30000 1.30000
1 h-m-p 0.0000 0.0001 527.6260 ++ 922.190866 m 0.0001 13 | 1/8
2 h-m-p 0.0004 0.0081 56.0379 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 481.8746 ++ 910.648598 m 0.0000 44 | 2/8
4 h-m-p 0.0005 0.0101 46.1463 -----------.. | 2/8
5 h-m-p 0.0000 0.0002 431.0579 +++ 880.271817 m 0.0002 76 | 3/8
6 h-m-p 0.0018 0.0168 34.5935 ------------.. | 3/8
7 h-m-p 0.0000 0.0000 375.4214 ++ 878.072450 m 0.0000 108 | 4/8
8 h-m-p 0.0002 0.0357 24.7261 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 306.2510 ++ 869.947614 m 0.0001 138 | 5/8
10 h-m-p 0.0011 0.0604 16.4810 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 217.0624 ++ 867.301537 m 0.0001 169 | 6/8
12 h-m-p 0.2030 8.0000 0.0000 +++ 867.301537 m 8.0000 181 | 6/8
13 h-m-p 0.4999 8.0000 0.0001 ++Y 867.301537 0 7.9986 196 | 6/8
14 h-m-p 0.0160 8.0000 0.2804 +++C 867.301537 0 1.3489 212 | 6/8
15 h-m-p 1.6000 8.0000 0.0246 Y 867.301537 0 1.0784 225 | 6/8
16 h-m-p 1.6000 8.0000 0.0007 --C 867.301537 0 0.0250 240 | 6/8
17 h-m-p 1.6000 8.0000 0.0000 N 867.301537 0 1.6000 253 | 6/8
18 h-m-p 0.9192 8.0000 0.0000 ----------------.. | 6/8
19 h-m-p 0.0160 8.0000 0.0000 +++++ 867.301537 m 8.0000 296 | 6/8
20 h-m-p 0.0160 8.0000 0.9801 ----------Y 867.301537 0 0.0000 319 | 6/8
21 h-m-p 0.0160 8.0000 0.0004 +++++ 867.301536 m 8.0000 335 | 6/8
22 h-m-p 0.0160 8.0000 0.4864 -------------.. | 6/8
23 h-m-p 0.0160 8.0000 0.0000 +++++ 867.301536 m 8.0000 375 | 6/8
24 h-m-p 0.0160 8.0000 0.2733 --------C 867.301536 0 0.0000 396 | 6/8
25 h-m-p 0.0160 8.0000 0.0010 +++++ 867.301536 m 8.0000 412 | 6/8
26 h-m-p 0.0178 8.0000 0.4610 --------C 867.301536 0 0.0000 433 | 6/8
27 h-m-p 0.0160 8.0000 0.0001 -----Y 867.301536 0 0.0000 451 | 6/8
28 h-m-p 0.0160 8.0000 0.0001 ---------Y 867.301536 0 0.0000 473
Out..
lnL = -867.301536
474 lfun, 474 eigenQcodon, 2844 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031795 0.096296 0.088696 0.075591 0.109121 0.024505 0.642449 0.575987 0.507961
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.333255
np = 9
lnL0 = -957.633848
Iterating by ming2
Initial: fx= 957.633848
x= 0.03180 0.09630 0.08870 0.07559 0.10912 0.02450 0.64245 0.57599 0.50796
1 h-m-p 0.0000 0.0001 509.6659 ++ 927.078797 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 373.3037 ++ 919.305636 m 0.0001 26 | 2/9
3 h-m-p 0.0001 0.0003 390.4391 ++ 883.143034 m 0.0003 38 | 3/9
4 h-m-p 0.0001 0.0006 131.9611 ++ 873.299057 m 0.0006 50 | 4/9
5 h-m-p 0.0000 0.0000 1899.5016 ++ 869.936079 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 88365.0598 ++ 867.301497 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 867.301497 m 8.0000 86 | 6/9
8 h-m-p 0.0136 6.7901 0.1400 ---------Y 867.301497 0 0.0000 110 | 6/9
9 h-m-p 0.0160 8.0000 0.0003 +++++ 867.301497 m 8.0000 128 | 6/9
10 h-m-p 0.0084 2.6238 0.2869 -------------.. | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 867.301497 m 8.0000 172 | 6/9
12 h-m-p 0.0076 3.7853 0.2721 ---------C 867.301497 0 0.0000 196 | 6/9
13 h-m-p 0.0160 8.0000 0.0116 +++++ 867.301483 m 8.0000 214 | 6/9
14 h-m-p 0.3054 3.9560 0.3027 ------------Y 867.301483 0 0.0000 241 | 6/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 867.301483 m 8.0000 259 | 6/9
16 h-m-p 0.0063 3.1298 0.2688 --------C 867.301483 0 0.0000 282 | 6/9
17 h-m-p 0.0160 8.0000 0.0003 +++++ 867.301483 m 8.0000 300 | 6/9
18 h-m-p 0.0089 3.2408 0.2593 ------------C 867.301483 0 0.0000 327 | 6/9
19 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/9
20 h-m-p 0.0160 8.0000 0.0002 +++++ 867.301482 m 8.0000 371 | 6/9
21 h-m-p 0.0093 4.6320 0.2360 -------------.. | 6/9
22 h-m-p 0.0160 8.0000 0.0002 +++++ 867.301482 m 8.0000 415 | 6/9
23 h-m-p 0.0093 4.6276 0.2364 -------------.. | 6/9
24 h-m-p 0.0160 8.0000 0.0002 +++++ 867.301482 m 8.0000 459 | 6/9
25 h-m-p 0.0094 4.6870 0.2337 -----------C 867.301482 0 0.0000 485 | 6/9
26 h-m-p 0.0160 8.0000 0.0001 +++++ 867.301482 m 8.0000 503 | 6/9
27 h-m-p 0.0005 0.2475 1.9761 +++++ 867.301457 m 0.2475 521 | 7/9
28 h-m-p 0.3151 1.5753 0.4232 ++ 867.301403 m 1.5753 533 | 8/9
29 h-m-p 0.1686 0.8431 0.9148 ++ 867.301119 m 0.8431 547 | 9/9
30 h-m-p 0.0160 8.0000 0.0000 N 867.301119 0 0.0160 560 | 9/9
31 h-m-p 0.0160 8.0000 0.0000 N 867.301119 0 0.0160 572
Out..
lnL = -867.301119
573 lfun, 1719 eigenQcodon, 6876 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108549 0.012651 0.019619 0.066571 0.104004 0.105939 0.000100 1.088743 0.207404 0.329694 1.445349
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.064798
np = 11
lnL0 = -951.290036
Iterating by ming2
Initial: fx= 951.290036
x= 0.10855 0.01265 0.01962 0.06657 0.10400 0.10594 0.00011 1.08874 0.20740 0.32969 1.44535
1 h-m-p 0.0000 0.0000 464.6400 ++ 950.928969 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 354.2576 +++ 935.698275 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0001 119.8960 ++ 930.223394 m 0.0001 45 | 3/11
4 h-m-p 0.0002 0.0040 68.9269 +++ 897.009489 m 0.0040 60 | 4/11
5 h-m-p 0.0000 0.0002 836.1450 ++ 869.539115 m 0.0002 74 | 5/11
6 h-m-p 0.0000 0.0001 246.6572 ++ 868.674724 m 0.0001 88 | 6/11
7 h-m-p 0.0008 0.0039 5.0286 -----------.. | 6/11
8 h-m-p 0.0000 0.0000 299.0957 ++ 868.204875 m 0.0000 125 | 7/11
9 h-m-p 0.0003 0.1565 4.0009 ----------.. | 7/11
10 h-m-p 0.0000 0.0000 211.7973 ++ 867.301428 m 0.0000 161 | 8/11
11 h-m-p 0.0457 8.0000 0.0000 ++++ 867.301428 m 8.0000 177 | 8/11
12 h-m-p 0.0160 8.0000 0.0296 +++++ 867.301426 m 8.0000 197 | 8/11
13 h-m-p 0.2632 8.0000 0.9012 -------------Y 867.301426 0 0.0000 227 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 867.301426 m 8.0000 247 | 8/11
15 h-m-p 0.0160 8.0000 1.4256 ---------Y 867.301426 0 0.0000 273 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 --Y 867.301426 0 0.0003 289 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 867.301426 m 8.0000 309 | 8/11
18 h-m-p 0.0009 0.0872 0.2759 ++++ 867.301426 m 0.0872 328 | 9/11
19 h-m-p 0.0167 8.0000 1.1291 ++++Y 867.301370 0 4.2812 349 | 9/11
20 h-m-p 1.6000 8.0000 0.1430 +C 867.301369 0 5.6437 364 | 9/11
21 h-m-p 1.6000 8.0000 0.0504 Y 867.301369 0 0.6550 380 | 9/11
22 h-m-p 1.6000 8.0000 0.0002 Y 867.301369 0 1.6000 396 | 9/11
23 h-m-p 1.2392 8.0000 0.0003 ++ 867.301369 m 8.0000 412 | 9/11
24 h-m-p 0.6424 8.0000 0.0033 +C 867.301369 0 2.5697 429 | 9/11
25 h-m-p 1.6000 8.0000 0.0005 ++ 867.301369 m 8.0000 445 | 9/11
26 h-m-p 0.0724 8.0000 0.0605 ++Y 867.301369 0 2.4593 463 | 9/11
27 h-m-p 1.6000 8.0000 0.0038 ++ 867.301369 m 8.0000 479 | 9/11
28 h-m-p 0.0160 8.0000 3.1455 ++Y 867.301357 0 0.5616 497 | 9/11
29 h-m-p 1.6000 8.0000 0.7265 +YC 867.301279 1 4.4076 513 | 9/11
30 h-m-p 0.5956 8.0000 5.3760 ++ 867.301119 m 8.0000 529 | 9/11
31 h-m-p 1.6000 8.0000 0.0000 N 867.301119 0 1.6000 543 | 9/11
32 h-m-p 0.0160 8.0000 0.0000 C 867.301119 0 0.0160 559
Out..
lnL = -867.301119
560 lfun, 2240 eigenQcodon, 10080 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -867.356653 S = -867.302244 -0.021044
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:06
did 20 / 55 patterns 0:06
did 30 / 55 patterns 0:06
did 40 / 55 patterns 0:06
did 50 / 55 patterns 0:06
did 55 / 55 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.011863 0.093020 0.050169 0.073577 0.026604 0.026546 0.000100 0.575514 1.401888
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.783897
np = 9
lnL0 = -923.842581
Iterating by ming2
Initial: fx= 923.842581
x= 0.01186 0.09302 0.05017 0.07358 0.02660 0.02655 0.00011 0.57551 1.40189
1 h-m-p 0.0000 0.0000 469.8533 ++ 923.534557 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0043 66.6743 +++++ 907.270728 m 0.0043 29 | 2/9
3 h-m-p 0.0000 0.0001 505.0503 ++ 901.814440 m 0.0001 41 | 3/9
4 h-m-p 0.0003 0.0024 178.7500 ++ 874.481257 m 0.0024 53 | 4/9
5 h-m-p 0.0000 0.0001 232.5521 ++ 873.525954 m 0.0001 65 | 5/9
6 h-m-p 0.0000 0.0000 2764.2609 ++ 873.124175 m 0.0000 77 | 6/9
7 h-m-p 0.0028 0.0138 43.2423 ++ 872.079717 m 0.0138 89 | 7/9
8 h-m-p 0.0026 0.7107 138.0231 ------------.. | 7/9
9 h-m-p 0.0000 0.0001 194.5770 ++ 867.301119 m 0.0001 123 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 Y 867.301119 0 1.6000 135 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 -----N 867.301119 0 0.0004 153
Out..
lnL = -867.301119
154 lfun, 1694 eigenQcodon, 9240 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.107491 0.095452 0.063639 0.071707 0.050760 0.057947 0.000100 0.900000 0.785532 1.127900 1.227279
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 14.278966
np = 11
lnL0 = -955.833817
Iterating by ming2
Initial: fx= 955.833817
x= 0.10749 0.09545 0.06364 0.07171 0.05076 0.05795 0.00011 0.90000 0.78553 1.12790 1.22728
1 h-m-p 0.0000 0.0000 450.2875 ++ 955.604929 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0035 140.6474 +++++ 894.241636 m 0.0035 33 | 2/11
3 h-m-p 0.0000 0.0000 49467.8749 ++ 887.407692 m 0.0000 47 | 3/11
4 h-m-p 0.0003 0.0014 91.5339 ++ 882.891472 m 0.0014 61 | 4/11
5 h-m-p 0.0000 0.0001 1042.1224 ++ 879.052739 m 0.0001 75 | 5/11
6 h-m-p 0.0000 0.0001 3085.6487 ++ 871.583564 m 0.0001 89 | 6/11
7 h-m-p 0.0001 0.0007 61.3316 ++ 870.164585 m 0.0007 103 | 7/11
8 h-m-p 0.0000 0.0000 249845.8209 ++ 867.301460 m 0.0000 117 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 -----------Y 867.301460 0 0.0000 142 | 8/11
10 h-m-p 0.0160 8.0000 0.0003 +++++ 867.301460 m 8.0000 162 | 8/11
11 h-m-p 0.0075 2.6942 0.2836 -------------.. | 8/11
12 h-m-p 0.0160 8.0000 0.0003 +++++ 867.301459 m 8.0000 210 | 8/11
13 h-m-p 0.0103 2.7363 0.2503 ----------C 867.301459 0 0.0000 237 | 8/11
14 h-m-p 0.0160 8.0000 0.0009 +++++ 867.301457 m 8.0000 257 | 8/11
15 h-m-p 0.0277 2.8086 0.2743 --------------.. | 8/11
16 h-m-p 0.0160 8.0000 0.0003 +++++ 867.301456 m 8.0000 306 | 8/11
17 h-m-p 0.0110 2.8310 0.2450 -----------Y 867.301456 0 0.0000 334 | 8/11
18 h-m-p 0.0160 8.0000 0.0106 +++++ 867.301422 m 8.0000 354 | 8/11
19 h-m-p 0.3257 2.9583 0.2593 -------------C 867.301422 0 0.0000 384 | 8/11
20 h-m-p 0.0160 8.0000 0.0003 +++++ 867.301421 m 8.0000 404 | 8/11
21 h-m-p 0.0092 4.1471 0.2559 -----------C 867.301421 0 0.0000 432 | 8/11
22 h-m-p 0.0160 8.0000 0.0001 +++++ 867.301421 m 8.0000 452 | 8/11
23 h-m-p 0.0076 3.8247 1.7364 -------------.. | 8/11
24 h-m-p 0.0160 8.0000 0.0005 +++++ 867.301419 m 8.0000 497 | 8/11
25 h-m-p 0.0203 3.9032 0.1993 ------------Y 867.301419 0 0.0000 526 | 8/11
26 h-m-p 0.0035 1.7539 0.1325 +++++ 867.301119 m 1.7539 546 | 9/11
27 h-m-p 1.6000 8.0000 0.0000 ++ 867.301119 m 8.0000 563 | 9/11
28 h-m-p 0.0656 8.0000 0.0011 ++++ 867.301119 m 8.0000 581 | 9/11
29 h-m-p 0.1171 8.0000 0.0767 ----Y 867.301119 0 0.0001 601 | 9/11
30 h-m-p 0.0332 8.0000 0.0003 ++++ 867.301119 m 8.0000 619 | 9/11
31 h-m-p 0.0851 8.0000 0.0248 ++++ 867.301119 m 8.0000 637 | 9/11
32 h-m-p 0.0183 0.0913 4.4644 ++ 867.301119 m 0.0913 653 | 10/11
33 h-m-p 1.6000 8.0000 0.0000 N 867.301119 0 1.6000 667 | 10/11
34 h-m-p 0.0160 8.0000 0.0000 Y 867.301119 0 0.0160 682
Out..
lnL = -867.301119
683 lfun, 8196 eigenQcodon, 45078 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -867.372944 S = -867.302244 -0.031508
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:21
did 20 / 55 patterns 0:21
did 30 / 55 patterns 0:21
did 40 / 55 patterns 0:21
did 50 / 55 patterns 0:21
did 55 / 55 patterns 0:21
Time used: 0:21
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=232
NC_011896_1_WP_041322633_1_1206_MLBR_RS05675 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NC_002677_1_NP_301846_1_718_ML1155 ------VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230 VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
NZ_AP014567_1_WP_111481006_1_1252_nucS VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL
********************************************
NC_011896_1_WP_041322633_1_1206_MLBR_RS05675 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
NC_002677_1_NP_301846_1_718_ML1155 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230 NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
NZ_AP014567_1_WP_111481006_1_1252_nucS NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG
**************************************************
NC_011896_1_WP_041322633_1_1206_MLBR_RS05675 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
NC_002677_1_NP_301846_1_718_ML1155 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230 LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
NZ_AP014567_1_WP_111481006_1_1252_nucS LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS
**************************************************
NC_011896_1_WP_041322633_1_1206_MLBR_RS05675 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
NC_002677_1_NP_301846_1_718_ML1155 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230 VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
NZ_AP014567_1_WP_111481006_1_1252_nucS VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA
**************************************************
NC_011896_1_WP_041322633_1_1206_MLBR_RS05675 TDRGIRCVTLDYDKMRGMDSDEYRLFooo---
NC_002677_1_NP_301846_1_718_ML1155 TDRGIRCVTLDYDKMRGMDSDEYRLFoooooo
NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315 TDRGIRCVTLDYDKMRGMDSDEYRLFooo---
NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370 TDRGIRCVTLDYDKMRGMDSDEYRLFooo---
NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230 TDRGIRCVTLDYDKMRGMDSDEYRLF------
NZ_AP014567_1_WP_111481006_1_1252_nucS TDRGIRCVTLDYDKMRGMDSDEYRLF------
**************************
>NC_011896_1_WP_041322633_1_1206_MLBR_RS05675 ---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG CATGGACAGCGATGAGTACCGGTTGTTC------------------ >NC_002677_1_NP_301846_1_718_ML1155 ------------------GTGATTGCCCAGTGCACCGTAGACTACCTTGG CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG CATGGACAGCGATGAGTACCGGTTGTTC------------------ >NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315 ---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG CATGGACAGCGATGAGTACCGGTTGTTC------------------ >NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370 ---------GTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG CATGGACAGCGATGAGTACCGGTTGTTC------------------ >NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230 GTGAGTTGGGTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG CATGGACAGCGATGAGTACCGGTTGTTC------------------ >NZ_AP014567_1_WP_111481006_1_1252_nucS GTGAGTTGGGTGCGTCTAGTGATTGCCCAGTGCACCGTAGACTACCTTGG CCGGCTCACCGCTCACCTGCCGTCCGCGCGCAGGTTGTTGCTGTTTAAGG CAGACGGATCGGTCAGTGTGCACGCCGACGACCGCGCCTACAAACCGTTG AACTGGATGAGTCCGCCATGTTGGTTGACCGAAGACGTCGCTGGCGCCTC GCCGGCCTGGGTGGTCGAGAACAAGGCTGGCGAACAACTGCGGATCACCG TTGAAGAGGTAGAGCACGATTCCTGTCACGATTTGGGCGTGGACCCCGGG CTGGTCAAAGACGGCGTCGAAGCCCACCTACAAACTTTGCTCGCTGAGCA AGTCCAACTGCTGGGCGAGGGATATACGTTGGTCCGCTGTGAGTACATGA CCGCGATCGGCCCTGTCGACCTGTTATGCCGCGATGAGCAGGGTGGTTCG GTCGCGGTGGAAATCAAACGGCGTGGCGAAATCGACGGCGTTGAGCAGCT CACCCGCTATCTAGCGTTACTTAATCGGAACAGTGTTCTCGCGCCGGTAA GGGGGGTGTTCGCCGCTCAACACATCAAGCCGCAGGCGCGCACTTTGGCC ACCGACCGTGGCATCCGTTGTGTAACATTGGATTACGACAAGATGCGGGG CATGGACAGCGATGAGTACCGGTTGTTC------------------
>NC_011896_1_WP_041322633_1_1206_MLBR_RS05675 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA TDRGIRCVTLDYDKMRGMDSDEYRLF >NC_002677_1_NP_301846_1_718_ML1155 ------VIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA TDRGIRCVTLDYDKMRGMDSDEYRLF >NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA TDRGIRCVTLDYDKMRGMDSDEYRLF >NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370 ---VRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA TDRGIRCVTLDYDKMRGMDSDEYRLF >NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230 VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA TDRGIRCVTLDYDKMRGMDSDEYRLF >NZ_AP014567_1_WP_111481006_1_1252_nucS VSWVRLVIAQCTVDYLGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPL NWMSPPCWLTEDVAGASPAWVVENKAGEQLRITVEEVEHDSCHDLGVDPG LVKDGVEAHLQTLLAEQVQLLGEGYTLVRCEYMTAIGPVDLLCRDEQGGS VAVEIKRRGEIDGVEQLTRYLALLNRNSVLAPVRGVFAAQHIKPQARTLA TDRGIRCVTLDYDKMRGMDSDEYRLF
#NEXUS
[ID: 5079426262]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_041322633_1_1206_MLBR_RS05675
NC_002677_1_NP_301846_1_718_ML1155
NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315
NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370
NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230
NZ_AP014567_1_WP_111481006_1_1252_nucS
;
end;
begin trees;
translate
1 NC_011896_1_WP_041322633_1_1206_MLBR_RS05675,
2 NC_002677_1_NP_301846_1_718_ML1155,
3 NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315,
4 NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370,
5 NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230,
6 NZ_AP014567_1_WP_111481006_1_1252_nucS
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06780391,2:0.06763783,3:0.06759608,4:0.06783816,5:0.06929908,6:0.06868968);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06780391,2:0.06763783,3:0.06759608,4:0.06783816,5:0.06929908,6:0.06868968);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -927.26 -930.72
2 -927.31 -930.61
--------------------------------------
TOTAL -927.29 -930.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1155/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.888053 0.088642 0.395427 1.529950 0.855536 1501.00 1501.00 1.000
r(A<->C){all} 0.162191 0.019916 0.000052 0.454711 0.120472 219.61 225.79 1.000
r(A<->G){all} 0.178428 0.022504 0.000001 0.488178 0.136048 174.59 187.27 1.000
r(A<->T){all} 0.169518 0.019799 0.000036 0.459523 0.133929 225.35 243.03 1.000
r(C<->G){all} 0.158708 0.018465 0.000310 0.430882 0.121381 188.00 210.43 1.002
r(C<->T){all} 0.165958 0.020156 0.000042 0.451072 0.129132 235.98 313.24 1.000
r(G<->T){all} 0.165198 0.018318 0.000017 0.431842 0.133142 205.35 221.10 1.001
pi(A){all} 0.197044 0.000229 0.168918 0.226847 0.196383 1279.24 1287.91 1.000
pi(C){all} 0.273556 0.000284 0.241833 0.307494 0.272992 1350.35 1391.98 1.000
pi(G){all} 0.322841 0.000313 0.288487 0.357458 0.322225 1251.85 1273.86 1.000
pi(T){all} 0.206558 0.000241 0.177002 0.238004 0.206558 808.80 1031.07 1.001
alpha{1,2} 0.429191 0.228381 0.000261 1.436906 0.260787 1304.64 1327.06 1.000
alpha{3} 0.442424 0.217974 0.000120 1.357014 0.284774 959.23 1147.80 1.001
pinvar{all} 0.997715 0.000008 0.992518 1.000000 0.998596 1305.65 1351.09 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1155/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 220
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 4 4 4 4 4 4
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 5 5 5 5 5 5 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 10 10 10 10 10 10 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 3 3 3 3 3 3
CTC 4 4 4 4 4 4 | CCC 1 1 1 1 1 1 | CAC 6 6 6 6 6 6 | CGC 6 6 6 6 6 6
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 5 5 5 5 5 5 | CGA 0 0 0 0 0 0
CTG 7 7 7 7 7 7 | CCG 6 6 6 6 6 6 | CAG 4 4 4 4 4 4 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 3 3 3 3 3 3
ATC 6 6 6 6 6 6 | ACC 7 7 7 7 7 7 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 1 1 1 1 1 1 | AAG 4 4 4 4 4 4 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 5 5 5 5 5 5 | Asp GAT 5 5 5 5 5 5 | Gly GGT 2 2 2 2 2 2
GTC 9 9 9 9 9 9 | GCC 8 8 8 8 8 8 | GAC 12 12 12 12 12 12 | GGC 11 11 11 11 11 11
GTA 4 4 4 4 4 4 | GCA 1 1 1 1 1 1 | Glu GAA 6 6 6 6 6 6 | GGA 2 2 2 2 2 2
GTG 6 6 6 6 6 6 | GCG 6 6 6 6 6 6 | GAG 9 9 9 9 9 9 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_041322633_1_1206_MLBR_RS05675
position 1: T:0.16364 C:0.24545 A:0.17727 G:0.41364
position 2: T:0.28636 C:0.20455 A:0.29545 G:0.21364
position 3: T:0.15909 C:0.38636 A:0.12273 G:0.33182
Average T:0.20303 C:0.27879 A:0.19848 G:0.31970
#2: NC_002677_1_NP_301846_1_718_ML1155
position 1: T:0.16364 C:0.24545 A:0.17727 G:0.41364
position 2: T:0.28636 C:0.20455 A:0.29545 G:0.21364
position 3: T:0.15909 C:0.38636 A:0.12273 G:0.33182
Average T:0.20303 C:0.27879 A:0.19848 G:0.31970
#3: NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315
position 1: T:0.16364 C:0.24545 A:0.17727 G:0.41364
position 2: T:0.28636 C:0.20455 A:0.29545 G:0.21364
position 3: T:0.15909 C:0.38636 A:0.12273 G:0.33182
Average T:0.20303 C:0.27879 A:0.19848 G:0.31970
#4: NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370
position 1: T:0.16364 C:0.24545 A:0.17727 G:0.41364
position 2: T:0.28636 C:0.20455 A:0.29545 G:0.21364
position 3: T:0.15909 C:0.38636 A:0.12273 G:0.33182
Average T:0.20303 C:0.27879 A:0.19848 G:0.31970
#5: NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230
position 1: T:0.16364 C:0.24545 A:0.17727 G:0.41364
position 2: T:0.28636 C:0.20455 A:0.29545 G:0.21364
position 3: T:0.15909 C:0.38636 A:0.12273 G:0.33182
Average T:0.20303 C:0.27879 A:0.19848 G:0.31970
#6: NZ_AP014567_1_WP_111481006_1_1252_nucS
position 1: T:0.16364 C:0.24545 A:0.17727 G:0.41364
position 2: T:0.28636 C:0.20455 A:0.29545 G:0.21364
position 3: T:0.15909 C:0.38636 A:0.12273 G:0.33182
Average T:0.20303 C:0.27879 A:0.19848 G:0.31970
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 12 | Cys C TGT 24
TTC 12 | TCC 12 | TAC 30 | TGC 12
Leu L TTA 12 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 60 | TCG 18 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 18
CTC 24 | CCC 6 | CAC 36 | CGC 36
CTA 12 | CCA 6 | Gln Q CAA 30 | CGA 0
CTG 42 | CCG 36 | CAG 24 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 12 | Asn N AAT 6 | Ser S AGT 18
ATC 36 | ACC 42 | AAC 18 | AGC 6
ATA 0 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 24 | ACG 6 | AAG 24 | AGG 12
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 30 | Asp D GAT 30 | Gly G GGT 12
GTC 54 | GCC 48 | GAC 72 | GGC 66
GTA 24 | GCA 6 | Glu E GAA 36 | GGA 12
GTG 36 | GCG 36 | GAG 54 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16364 C:0.24545 A:0.17727 G:0.41364
position 2: T:0.28636 C:0.20455 A:0.29545 G:0.21364
position 3: T:0.15909 C:0.38636 A:0.12273 G:0.33182
Average T:0.20303 C:0.27879 A:0.19848 G:0.31970
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -867.301536 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.642449 1.227279
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322633_1_1206_MLBR_RS05675: 0.000004, NC_002677_1_NP_301846_1_718_ML1155: 0.000004, NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315: 0.000004, NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370: 0.000004, NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230: 0.000004, NZ_AP014567_1_WP_111481006_1_1252_nucS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.64245
omega (dN/dS) = 1.22728
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 518.1 141.9 1.2273 0.0000 0.0000 0.0 0.0
7..2 0.000 518.1 141.9 1.2273 0.0000 0.0000 0.0 0.0
7..3 0.000 518.1 141.9 1.2273 0.0000 0.0000 0.0 0.0
7..4 0.000 518.1 141.9 1.2273 0.0000 0.0000 0.0 0.0
7..5 0.000 518.1 141.9 1.2273 0.0000 0.0000 0.0 0.0
7..6 0.000 518.1 141.9 1.2273 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -867.301119 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322633_1_1206_MLBR_RS05675: 0.000004, NC_002677_1_NP_301846_1_718_ML1155: 0.000004, NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315: 0.000004, NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370: 0.000004, NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230: 0.000004, NZ_AP014567_1_WP_111481006_1_1252_nucS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -867.301119 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322633_1_1206_MLBR_RS05675: 0.000004, NC_002677_1_NP_301846_1_718_ML1155: 0.000004, NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315: 0.000004, NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370: 0.000004, NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230: 0.000004, NZ_AP014567_1_WP_111481006_1_1252_nucS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041322633_1_1206_MLBR_RS05675)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.009 0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -867.301119 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.903659
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322633_1_1206_MLBR_RS05675: 0.000004, NC_002677_1_NP_301846_1_718_ML1155: 0.000004, NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315: 0.000004, NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370: 0.000004, NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230: 0.000004, NZ_AP014567_1_WP_111481006_1_1252_nucS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.90366
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -867.301119 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.673538 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_041322633_1_1206_MLBR_RS05675: 0.000004, NC_002677_1_NP_301846_1_718_ML1155: 0.000004, NZ_LVXE01000005_1_WP_041322633_1_2046_A3216_RS03315: 0.000004, NZ_LYPH01000088_1_WP_041322633_1_2775_A8144_RS13370: 0.000004, NZ_CP029543_1_WP_111481006_1_1227_DIJ64_RS06230: 0.000004, NZ_AP014567_1_WP_111481006_1_1252_nucS: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.67354
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 534.3 125.7 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_041322633_1_1206_MLBR_RS05675)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.095 0.096 0.097 0.098 0.099 0.101 0.102 0.103 0.104 0.106
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.105 0.104 0.103 0.102 0.100 0.099 0.098 0.097 0.096 0.095
Time used: 0:21
Model 1: NearlyNeutral -867.301119 Model 2: PositiveSelection -867.301119 Model 0: one-ratio -867.301536 Model 7: beta -867.301119 Model 8: beta&w>1 -867.301119 Model 0 vs 1 8.340000001680892E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
