--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 08:49:48 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1116/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -768.57 -773.49
2 -768.56 -771.99
--------------------------------------
TOTAL -768.56 -773.00
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890748 0.087855 0.361312 1.463604 0.855954 1265.96 1383.48 1.000
r(A<->C){all} 0.163870 0.018522 0.000009 0.438888 0.128123 218.35 238.03 1.003
r(A<->G){all} 0.164656 0.019043 0.000032 0.438647 0.127987 126.53 181.88 1.002
r(A<->T){all} 0.176172 0.022958 0.000129 0.492756 0.134067 237.91 292.19 1.000
r(C<->G){all} 0.165852 0.020204 0.000070 0.446225 0.127658 176.24 219.00 1.003
r(C<->T){all} 0.170433 0.020640 0.000014 0.470250 0.132524 108.08 184.42 1.004
r(G<->T){all} 0.159017 0.019429 0.000016 0.440817 0.120700 380.58 411.47 1.001
pi(A){all} 0.192845 0.000271 0.162477 0.226009 0.192480 1192.37 1228.17 1.000
pi(C){all} 0.259207 0.000337 0.224414 0.295955 0.258850 1010.79 1189.37 1.000
pi(G){all} 0.325008 0.000386 0.285737 0.360674 0.325183 948.87 1051.17 1.000
pi(T){all} 0.222940 0.000322 0.187893 0.259638 0.222836 1118.12 1237.35 1.000
alpha{1,2} 0.432717 0.243387 0.000121 1.392807 0.267905 840.63 1034.31 1.000
alpha{3} 0.461335 0.241727 0.000163 1.426690 0.300769 1337.01 1419.00 1.000
pinvar{all} 0.997253 0.000010 0.991265 0.999999 0.998297 1408.74 1440.23 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -739.178814
Model 2: PositiveSelection -739.178919
Model 0: one-ratio -739.178814
Model 7: beta -739.178814
Model 8: beta&w>1 -739.178913
Model 0 vs 1 0.0
Model 2 vs 1 2.0999999992454832E-4
Model 8 vs 7 1.979999999548454E-4
>C1
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C2
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C3
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C4
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C5
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C6
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=187
C1 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C2 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C3 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C4 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C5 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C6 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
**************************************************
C1 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C2 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C3 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C4 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C5 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C6 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
**************************************************
C1 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C2 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C3 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C4 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C5 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C6 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
**************************************************
C1 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C2 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C3 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C4 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C5 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C6 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
*************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 187 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 187 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5610]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5610]--->[5610]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.477 Mb, Max= 30.728 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C2 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C3 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C4 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C5 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
C6 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
**************************************************
C1 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C2 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C3 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C4 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C5 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
C6 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
**************************************************
C1 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C2 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C3 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C4 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C5 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
C6 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
**************************************************
C1 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C2 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C3 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C4 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C5 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
C6 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
*************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
C2 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
C3 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
C4 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
C5 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
C6 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
**************************************************
C1 GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
C2 GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
C3 GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
C4 GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
C5 GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
C6 GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
**************************************************
C1 GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
C2 GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
C3 GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
C4 GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
C5 GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
C6 GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
**************************************************
C1 CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
C2 CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
C3 CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
C4 CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
C5 CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
C6 CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
**************************************************
C1 CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
C2 CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
C3 CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
C4 CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
C5 CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
C6 CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
**************************************************
C1 TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
C2 TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
C3 TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
C4 TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
C5 TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
C6 TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
**************************************************
C1 GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
C2 GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
C3 GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
C4 GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
C5 GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
C6 GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
**************************************************
C1 GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
C2 GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
C3 GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
C4 GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
C5 GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
C6 GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
**************************************************
C1 TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
C2 TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
C3 TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
C4 TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
C5 TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
C6 TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
**************************************************
C1 GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
C2 GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
C3 GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
C4 GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
C5 GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
C6 GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
**************************************************
C1 CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
C2 CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
C3 CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
C4 CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
C5 CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
C6 CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
**************************************************
C1 CTACCAACTCC
C2 CTACCAACTCC
C3 CTACCAACTCC
C4 CTACCAACTCC
C5 CTACCAACTCC
C6 CTACCAACTCC
***********
>C1
ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
CTACCAACTCC
>C2
ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
CTACCAACTCC
>C3
ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
CTACCAACTCC
>C4
ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
CTACCAACTCC
>C5
ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
CTACCAACTCC
>C6
ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT
GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG
GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC
CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA
CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT
TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC
GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA
GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG
TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC
GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC
CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG
CTACCAACTCC
>C1
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C2
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C3
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C4
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C5
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
>C6
MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 561 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579855702
Setting output file names to "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1169611767
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5671801812
Seed = 1131308555
Swapseed = 1579855702
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1255.544819 -- -24.965149
Chain 2 -- -1255.544819 -- -24.965149
Chain 3 -- -1255.544892 -- -24.965149
Chain 4 -- -1255.544892 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1255.544819 -- -24.965149
Chain 2 -- -1255.544701 -- -24.965149
Chain 3 -- -1255.544819 -- -24.965149
Chain 4 -- -1255.544701 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1255.545] (-1255.545) (-1255.545) (-1255.545) * [-1255.545] (-1255.545) (-1255.545) (-1255.545)
500 -- (-784.623) (-785.777) [-776.834] (-777.161) * (-783.322) [-775.582] (-781.219) (-779.596) -- 0:00:00
1000 -- (-778.404) (-775.515) (-777.652) [-782.808] * (-777.821) [-771.486] (-787.785) (-781.808) -- 0:00:00
1500 -- [-772.397] (-782.517) (-778.667) (-779.464) * [-776.538] (-784.293) (-784.656) (-783.296) -- 0:11:05
2000 -- (-779.618) [-776.093] (-778.328) (-778.347) * (-773.627) [-781.726] (-780.830) (-775.272) -- 0:08:19
2500 -- (-779.472) [-778.295] (-780.801) (-783.594) * (-776.890) [-774.235] (-779.297) (-772.110) -- 0:06:39
3000 -- [-780.053] (-773.599) (-783.138) (-782.290) * (-778.350) (-781.305) [-776.618] (-777.955) -- 0:05:32
3500 -- (-778.699) [-781.714] (-775.610) (-773.811) * (-784.173) [-781.348] (-780.768) (-772.001) -- 0:04:44
4000 -- (-779.697) (-774.705) (-786.496) [-776.499] * (-783.865) (-780.075) (-774.019) [-772.564] -- 0:04:09
4500 -- [-773.496] (-778.736) (-779.591) (-779.210) * [-775.548] (-778.823) (-786.335) (-774.598) -- 0:03:41
5000 -- (-772.510) [-774.360] (-774.398) (-782.389) * [-775.350] (-780.514) (-779.159) (-781.959) -- 0:03:19
Average standard deviation of split frequencies: 0.078567
5500 -- [-779.721] (-776.936) (-778.169) (-780.681) * (-786.165) (-775.325) [-781.549] (-778.631) -- 0:03:00
6000 -- (-770.930) [-780.719] (-778.629) (-778.334) * [-783.443] (-782.922) (-775.894) (-776.168) -- 0:02:45
6500 -- (-789.948) (-778.890) [-776.609] (-780.052) * (-785.523) [-778.507] (-788.587) (-775.786) -- 0:02:32
7000 -- [-777.485] (-777.935) (-783.578) (-779.931) * (-803.178) (-780.070) (-772.328) [-778.034] -- 0:02:21
7500 -- (-772.616) (-784.533) [-777.445] (-779.661) * (-778.825) (-788.738) (-774.114) [-783.431] -- 0:02:12
8000 -- (-782.268) (-773.916) [-781.098] (-778.977) * (-773.793) (-776.955) [-781.469] (-778.614) -- 0:02:04
8500 -- (-779.827) (-772.379) [-777.450] (-779.657) * (-777.038) (-791.055) [-775.485] (-778.304) -- 0:01:56
9000 -- [-782.193] (-780.615) (-777.270) (-777.944) * (-775.060) (-769.950) (-783.924) [-773.982] -- 0:01:50
9500 -- (-782.104) [-778.612] (-777.141) (-773.912) * (-773.208) (-772.086) (-793.427) [-786.315] -- 0:01:44
10000 -- (-790.920) [-776.089] (-774.055) (-777.072) * (-774.160) (-772.063) (-778.199) [-778.637] -- 0:01:39
Average standard deviation of split frequencies: 0.088388
10500 -- (-779.057) (-780.734) [-779.275] (-775.033) * (-771.506) [-770.464] (-781.583) (-778.952) -- 0:01:34
11000 -- (-777.730) (-775.579) [-778.806] (-778.205) * [-769.121] (-772.414) (-777.370) (-784.575) -- 0:01:29
11500 -- [-769.520] (-775.195) (-776.652) (-774.622) * (-767.488) (-769.738) [-783.423] (-775.225) -- 0:01:25
12000 -- (-769.933) (-784.492) [-775.664] (-783.947) * (-768.351) (-769.725) [-779.467] (-778.923) -- 0:01:22
12500 -- (-768.278) [-778.083] (-783.760) (-780.219) * [-768.504] (-769.050) (-780.900) (-787.163) -- 0:01:19
13000 -- (-770.181) (-781.861) (-780.841) [-772.606] * (-775.647) [-770.086] (-777.488) (-778.643) -- 0:01:15
13500 -- [-767.552] (-779.572) (-780.969) (-774.982) * (-771.124) (-767.996) (-776.213) [-773.028] -- 0:01:13
14000 -- (-768.568) (-791.777) (-778.619) [-780.545] * (-767.907) (-771.275) [-770.997] (-784.773) -- 0:01:10
14500 -- (-767.182) (-774.211) [-778.021] (-783.557) * (-768.698) [-768.639] (-773.714) (-777.977) -- 0:01:07
15000 -- (-769.444) [-774.223] (-783.216) (-778.481) * (-767.864) (-770.268) (-789.247) [-776.695] -- 0:01:05
Average standard deviation of split frequencies: 0.064818
15500 -- (-772.597) [-781.094] (-784.785) (-781.149) * [-769.488] (-771.429) (-774.657) (-777.848) -- 0:01:03
16000 -- (-768.506) (-776.219) (-777.539) [-772.819] * [-773.628] (-772.257) (-776.564) (-780.866) -- 0:01:01
16500 -- [-768.039] (-775.150) (-778.142) (-776.797) * [-771.574] (-770.476) (-775.784) (-771.913) -- 0:01:59
17000 -- [-769.094] (-781.455) (-777.092) (-775.295) * (-769.003) (-770.596) [-771.996] (-779.143) -- 0:01:55
17500 -- (-769.035) (-777.180) [-774.934] (-778.150) * (-770.055) (-768.244) [-782.460] (-792.154) -- 0:01:52
18000 -- [-766.906] (-773.237) (-780.534) (-777.982) * [-768.573] (-768.544) (-781.460) (-784.464) -- 0:01:49
18500 -- [-767.483] (-779.398) (-785.957) (-775.319) * (-772.491) (-767.490) [-786.690] (-767.641) -- 0:01:46
19000 -- (-772.692) [-780.537] (-775.188) (-781.189) * (-768.965) (-770.172) (-786.367) [-767.590] -- 0:01:43
19500 -- (-770.849) (-782.247) (-790.113) [-779.554] * [-767.921] (-768.474) (-781.156) (-770.244) -- 0:01:40
20000 -- (-773.742) (-775.056) [-785.691] (-778.704) * (-767.242) (-767.021) [-780.506] (-769.271) -- 0:01:38
Average standard deviation of split frequencies: 0.069771
20500 -- (-769.765) (-782.334) (-787.941) [-778.490] * (-769.642) (-767.901) (-780.403) [-769.706] -- 0:01:35
21000 -- (-772.323) (-776.111) [-775.521] (-778.877) * [-773.132] (-767.941) (-784.623) (-767.733) -- 0:01:33
21500 -- (-769.982) (-780.639) [-781.189] (-784.249) * [-767.057] (-769.939) (-783.394) (-768.676) -- 0:01:31
22000 -- (-774.144) [-782.709] (-777.338) (-778.187) * (-774.900) (-769.349) (-778.175) [-768.615] -- 0:01:28
22500 -- (-768.780) (-783.927) (-775.396) [-784.586] * [-770.897] (-770.010) (-783.682) (-769.421) -- 0:01:26
23000 -- (-767.447) (-780.134) [-774.429] (-780.637) * [-769.835] (-772.453) (-779.431) (-770.459) -- 0:01:24
23500 -- (-767.938) (-777.835) (-783.868) [-780.365] * (-770.664) (-771.020) [-777.927] (-768.834) -- 0:01:23
24000 -- (-768.931) (-783.617) [-782.436] (-788.349) * (-772.385) [-769.814] (-776.654) (-770.441) -- 0:01:21
24500 -- (-768.179) (-780.903) (-776.589) [-776.239] * (-774.721) (-770.394) (-782.560) [-767.445] -- 0:01:19
25000 -- [-767.539] (-775.117) (-784.327) (-779.500) * (-776.821) (-770.868) [-778.467] (-767.949) -- 0:01:18
Average standard deviation of split frequencies: 0.050939
25500 -- (-768.697) (-775.519) [-767.814] (-780.661) * [-768.198] (-769.820) (-785.026) (-771.439) -- 0:01:16
26000 -- (-766.867) (-775.263) [-771.072] (-780.550) * [-769.337] (-767.658) (-776.558) (-771.908) -- 0:01:14
26500 -- (-770.386) [-780.760] (-773.917) (-779.252) * (-769.197) [-768.549] (-779.325) (-768.560) -- 0:01:13
27000 -- (-769.591) [-773.658] (-769.648) (-786.885) * (-770.114) (-767.737) (-778.005) [-772.331] -- 0:01:12
27500 -- (-772.360) [-772.677] (-768.643) (-781.423) * (-772.014) [-768.388] (-782.366) (-769.190) -- 0:01:10
28000 -- (-772.547) (-774.805) (-770.343) [-776.905] * (-770.719) (-770.152) [-778.047] (-767.660) -- 0:01:09
28500 -- (-770.665) (-778.674) [-769.237] (-786.494) * [-767.414] (-773.451) (-778.340) (-768.587) -- 0:01:08
29000 -- (-768.885) (-784.192) [-769.661] (-774.926) * (-768.718) [-768.772] (-782.007) (-771.344) -- 0:01:06
29500 -- (-770.225) (-773.902) (-768.978) [-775.299] * (-768.658) (-768.370) (-777.684) [-768.975] -- 0:01:05
30000 -- [-770.225] (-775.107) (-767.307) (-775.019) * [-768.322] (-768.052) (-780.431) (-767.421) -- 0:01:04
Average standard deviation of split frequencies: 0.048212
30500 -- (-769.962) (-786.065) [-767.748] (-778.788) * (-769.849) [-768.179] (-783.254) (-769.133) -- 0:01:35
31000 -- [-769.564] (-781.052) (-767.606) (-781.235) * (-770.853) (-768.761) [-777.223] (-768.578) -- 0:01:33
31500 -- (-770.650) (-776.243) (-767.477) [-777.067] * (-768.482) (-769.221) [-773.115] (-769.557) -- 0:01:32
32000 -- (-773.119) (-789.660) [-767.749] (-781.659) * [-769.957] (-772.163) (-780.188) (-770.994) -- 0:01:30
32500 -- (-767.623) (-784.722) [-769.092] (-783.005) * (-769.094) (-770.893) (-785.974) [-769.086] -- 0:01:29
33000 -- [-768.034] (-772.811) (-767.783) (-778.192) * (-768.525) (-769.724) (-776.413) [-767.582] -- 0:01:27
33500 -- (-770.754) (-770.430) (-768.305) [-777.587] * (-768.820) (-769.223) (-778.736) [-767.745] -- 0:01:26
34000 -- [-770.320] (-772.229) (-769.664) (-776.535) * (-768.331) [-767.872] (-774.763) (-768.486) -- 0:01:25
34500 -- (-772.268) [-768.155] (-773.059) (-776.709) * (-767.427) (-769.265) [-775.535] (-770.831) -- 0:01:23
35000 -- (-767.743) (-769.489) [-769.323] (-774.646) * (-769.381) [-769.654] (-781.955) (-768.981) -- 0:01:22
Average standard deviation of split frequencies: 0.046143
35500 -- (-767.055) [-768.023] (-767.242) (-779.974) * (-767.946) [-769.617] (-774.811) (-767.799) -- 0:01:21
36000 -- [-768.628] (-769.613) (-767.837) (-775.387) * (-770.749) [-769.200] (-779.515) (-770.598) -- 0:01:20
36500 -- [-771.977] (-770.217) (-767.981) (-778.248) * [-771.765] (-768.869) (-779.468) (-769.749) -- 0:01:19
37000 -- (-774.002) (-774.307) [-767.352] (-780.365) * (-770.776) (-769.064) (-790.906) [-767.563] -- 0:01:18
37500 -- (-773.363) (-770.583) [-768.878] (-777.310) * (-772.079) (-770.014) [-776.173] (-769.871) -- 0:01:17
38000 -- (-770.813) [-768.647] (-769.326) (-776.277) * (-768.531) (-773.233) [-776.213] (-770.421) -- 0:01:15
38500 -- (-769.884) (-769.626) (-767.986) [-784.558] * (-768.545) [-770.200] (-781.181) (-776.921) -- 0:01:14
39000 -- (-769.726) [-768.691] (-767.848) (-776.312) * (-768.287) (-768.009) [-779.340] (-775.552) -- 0:01:13
39500 -- (-776.553) (-768.029) [-767.245] (-786.131) * [-770.664] (-767.905) (-778.480) (-771.591) -- 0:01:12
40000 -- (-769.614) [-771.672] (-771.466) (-785.261) * (-769.226) (-767.330) (-781.349) [-767.463] -- 0:01:12
Average standard deviation of split frequencies: 0.045788
40500 -- [-768.599] (-775.962) (-769.395) (-785.282) * (-770.978) (-769.655) (-783.084) [-767.813] -- 0:01:11
41000 -- [-770.076] (-771.505) (-769.267) (-774.244) * (-771.127) [-771.755] (-780.677) (-768.753) -- 0:01:10
41500 -- [-770.852] (-769.590) (-768.403) (-777.434) * (-767.832) (-768.551) (-781.732) [-767.860] -- 0:01:09
42000 -- (-768.887) [-770.470] (-769.579) (-777.114) * [-768.868] (-767.042) (-782.565) (-768.529) -- 0:01:08
42500 -- [-769.039] (-772.420) (-768.869) (-777.915) * (-770.373) [-768.361] (-777.369) (-771.062) -- 0:01:07
43000 -- (-768.129) (-768.007) [-773.775] (-788.052) * (-768.219) (-769.860) (-784.197) [-768.177] -- 0:01:06
43500 -- (-770.804) [-768.475] (-768.210) (-776.417) * (-768.062) [-771.435] (-774.464) (-768.436) -- 0:01:05
44000 -- [-768.694] (-767.789) (-773.497) (-776.177) * (-770.446) (-769.690) [-773.835] (-768.309) -- 0:01:05
44500 -- (-768.571) [-769.052] (-768.748) (-787.071) * (-774.359) (-773.684) (-785.962) [-768.131] -- 0:01:04
45000 -- (-767.824) (-770.161) (-767.839) [-776.208] * (-771.535) (-774.576) (-785.648) [-767.060] -- 0:01:03
Average standard deviation of split frequencies: 0.047824
45500 -- (-768.158) (-768.293) (-771.243) [-779.758] * [-769.521] (-772.739) (-779.455) (-770.284) -- 0:01:23
46000 -- (-768.106) [-769.160] (-770.940) (-794.604) * (-769.118) (-770.197) (-779.173) [-772.982] -- 0:01:22
46500 -- [-773.455] (-767.789) (-768.058) (-783.404) * (-767.691) (-768.446) (-782.207) [-769.559] -- 0:01:22
47000 -- (-768.917) (-769.777) [-767.607] (-778.948) * (-774.464) [-768.089] (-783.918) (-771.656) -- 0:01:21
47500 -- [-772.937] (-775.530) (-770.169) (-773.467) * (-767.049) [-770.613] (-785.860) (-776.906) -- 0:01:20
48000 -- (-769.292) [-773.064] (-770.288) (-771.207) * (-769.673) (-773.787) [-769.551] (-769.512) -- 0:01:19
48500 -- [-768.102] (-769.929) (-768.988) (-767.643) * (-770.077) [-773.793] (-768.747) (-769.463) -- 0:01:18
49000 -- [-769.673] (-769.637) (-768.524) (-769.834) * (-769.522) [-772.394] (-768.752) (-769.088) -- 0:01:17
49500 -- (-768.155) [-769.968] (-768.325) (-768.070) * (-767.765) [-769.737] (-766.937) (-770.320) -- 0:01:16
50000 -- (-768.970) (-771.640) [-770.995] (-767.685) * [-767.919] (-771.410) (-773.316) (-767.973) -- 0:01:16
Average standard deviation of split frequencies: 0.043729
50500 -- (-769.258) [-770.570] (-770.943) (-773.822) * (-771.685) [-767.485] (-767.658) (-771.269) -- 0:01:15
51000 -- (-769.374) (-767.960) (-767.925) [-768.076] * (-771.074) [-769.922] (-767.578) (-769.739) -- 0:01:14
51500 -- (-768.222) [-769.277] (-767.707) (-768.750) * (-771.913) [-767.627] (-767.594) (-769.741) -- 0:01:13
52000 -- [-768.437] (-768.832) (-767.990) (-779.244) * (-769.478) (-768.651) (-768.518) [-771.398] -- 0:01:12
52500 -- (-767.515) [-770.733] (-770.562) (-769.868) * (-768.661) (-768.132) [-768.733] (-767.530) -- 0:01:12
53000 -- (-767.295) [-769.177] (-768.657) (-769.248) * [-768.563] (-770.774) (-769.608) (-770.857) -- 0:01:11
53500 -- (-767.947) [-768.447] (-772.228) (-771.423) * (-770.197) (-771.134) (-767.732) [-769.511] -- 0:01:10
54000 -- (-769.475) [-767.785] (-768.783) (-771.045) * (-773.236) [-771.318] (-771.185) (-770.058) -- 0:01:10
54500 -- (-767.073) [-768.434] (-769.014) (-767.831) * [-769.547] (-771.995) (-770.701) (-768.150) -- 0:01:09
55000 -- (-770.156) (-767.983) [-769.165] (-768.198) * (-769.064) [-770.176] (-768.587) (-768.455) -- 0:01:08
Average standard deviation of split frequencies: 0.040827
55500 -- [-768.929] (-768.809) (-769.832) (-770.975) * (-771.469) [-768.700] (-770.194) (-770.155) -- 0:01:08
56000 -- [-772.019] (-772.035) (-768.812) (-770.788) * (-769.190) (-769.489) (-770.525) [-768.869] -- 0:01:07
56500 -- (-772.516) (-771.565) (-770.269) [-770.552] * [-771.251] (-770.207) (-771.030) (-767.570) -- 0:01:06
57000 -- (-768.279) [-769.948] (-769.129) (-770.381) * [-772.412] (-769.443) (-768.977) (-775.338) -- 0:01:06
57500 -- [-770.323] (-773.471) (-769.571) (-767.799) * (-770.714) [-770.182] (-769.157) (-771.094) -- 0:01:05
58000 -- (-770.824) [-768.541] (-768.963) (-767.497) * (-770.136) [-767.627] (-768.084) (-768.365) -- 0:01:04
58500 -- (-768.799) (-768.933) (-768.063) [-769.833] * (-767.774) [-769.171] (-769.488) (-768.354) -- 0:01:04
59000 -- (-770.432) (-769.104) (-768.040) [-768.251] * (-767.024) (-769.774) (-767.922) [-766.877] -- 0:01:03
59500 -- [-768.854] (-769.939) (-768.323) (-768.987) * (-767.049) (-768.502) (-773.373) [-766.880] -- 0:01:03
60000 -- [-768.468] (-773.448) (-770.217) (-767.517) * (-766.991) (-768.287) (-772.517) [-767.136] -- 0:01:02
Average standard deviation of split frequencies: 0.034782
60500 -- (-768.612) [-767.997] (-769.261) (-770.621) * [-769.146] (-767.907) (-775.318) (-769.261) -- 0:01:17
61000 -- [-768.225] (-769.538) (-767.395) (-769.606) * [-767.234] (-768.197) (-775.397) (-770.028) -- 0:01:16
61500 -- [-771.103] (-768.105) (-767.725) (-769.886) * [-767.459] (-767.928) (-767.549) (-770.444) -- 0:01:16
62000 -- (-771.842) [-770.917] (-768.331) (-770.312) * (-769.015) [-768.590] (-767.350) (-772.951) -- 0:01:15
62500 -- [-767.324] (-768.921) (-767.723) (-768.028) * [-768.920] (-768.218) (-767.714) (-769.170) -- 0:01:15
63000 -- (-770.997) (-770.344) (-770.026) [-768.064] * [-771.489] (-767.225) (-768.541) (-768.864) -- 0:01:14
63500 -- [-768.420] (-769.181) (-770.680) (-771.453) * (-767.606) (-768.457) (-768.614) [-768.759] -- 0:01:13
64000 -- [-769.722] (-771.940) (-770.824) (-769.720) * [-767.449] (-770.725) (-771.854) (-768.768) -- 0:01:13
64500 -- (-771.625) [-769.114] (-771.167) (-769.348) * [-769.365] (-770.268) (-775.931) (-772.345) -- 0:01:12
65000 -- (-768.846) [-773.283] (-767.671) (-771.013) * (-769.607) (-771.519) [-770.908] (-769.471) -- 0:01:11
Average standard deviation of split frequencies: 0.035388
65500 -- [-769.468] (-769.234) (-767.779) (-774.664) * (-769.203) (-771.554) [-771.183] (-769.217) -- 0:01:11
66000 -- [-768.529] (-774.978) (-768.077) (-770.239) * (-768.890) [-770.071] (-771.896) (-770.279) -- 0:01:10
66500 -- (-768.437) (-768.387) (-767.039) [-769.175] * (-768.402) (-771.827) [-770.537] (-769.989) -- 0:01:10
67000 -- (-768.709) [-768.967] (-768.310) (-770.138) * (-769.155) [-769.995] (-769.569) (-769.647) -- 0:01:09
67500 -- (-769.030) [-770.109] (-768.788) (-771.854) * (-772.226) (-767.398) (-771.222) [-771.130] -- 0:01:09
68000 -- [-770.501] (-769.751) (-769.067) (-768.077) * (-767.967) (-769.052) (-768.297) [-771.245] -- 0:01:08
68500 -- (-769.632) (-771.663) (-768.979) [-769.025] * [-767.240] (-771.049) (-775.239) (-772.563) -- 0:01:07
69000 -- (-769.079) (-771.526) [-767.875] (-768.162) * (-770.161) (-767.952) (-769.054) [-768.143] -- 0:01:07
69500 -- (-768.399) (-768.794) (-767.149) [-770.636] * (-770.337) (-769.432) (-767.459) [-768.037] -- 0:01:06
70000 -- [-768.139] (-770.807) (-768.746) (-768.562) * (-769.791) (-770.719) [-770.999] (-770.422) -- 0:01:06
Average standard deviation of split frequencies: 0.028685
70500 -- (-770.063) (-770.230) [-768.321] (-768.938) * [-768.920] (-770.321) (-768.731) (-770.546) -- 0:01:05
71000 -- (-767.968) (-770.237) (-768.221) [-771.640] * (-770.328) (-770.421) [-767.578] (-768.085) -- 0:01:05
71500 -- (-767.649) (-768.880) (-770.683) [-770.225] * (-771.564) (-769.077) [-767.689] (-767.605) -- 0:01:04
72000 -- (-768.946) (-768.880) [-769.868] (-772.842) * (-773.746) (-771.667) (-769.768) [-770.036] -- 0:01:04
72500 -- [-767.887] (-767.796) (-771.643) (-774.286) * (-770.406) (-768.607) (-770.203) [-768.135] -- 0:01:03
73000 -- (-769.416) [-769.511] (-769.343) (-770.750) * (-771.199) (-770.126) [-769.903] (-768.237) -- 0:01:03
73500 -- (-769.335) (-773.225) [-773.014] (-767.703) * (-770.605) [-768.551] (-770.903) (-771.131) -- 0:01:03
74000 -- (-771.541) (-767.826) (-770.449) [-768.120] * (-769.469) (-769.956) [-768.607] (-769.748) -- 0:01:02
74500 -- (-770.327) [-767.966] (-767.929) (-767.778) * [-770.285] (-771.133) (-768.252) (-767.969) -- 0:01:02
75000 -- [-768.491] (-768.009) (-767.187) (-769.306) * (-768.680) (-772.760) [-774.736] (-768.850) -- 0:01:01
Average standard deviation of split frequencies: 0.027422
75500 -- (-768.437) (-768.221) (-773.796) [-769.678] * (-767.901) (-773.531) [-771.510] (-769.468) -- 0:01:13
76000 -- (-767.811) [-769.059] (-770.723) (-772.959) * (-770.941) [-770.689] (-770.826) (-769.019) -- 0:01:12
76500 -- [-767.952] (-769.948) (-769.635) (-772.668) * (-772.511) [-768.214] (-767.715) (-771.627) -- 0:01:12
77000 -- [-767.599] (-769.169) (-770.361) (-768.498) * (-771.243) (-768.156) [-767.509] (-771.305) -- 0:01:11
77500 -- (-767.218) (-769.179) (-771.224) [-769.793] * (-768.521) (-767.333) [-767.693] (-770.792) -- 0:01:11
78000 -- (-767.848) (-773.626) [-770.212] (-769.905) * (-768.896) [-768.455] (-772.693) (-770.564) -- 0:01:10
78500 -- (-767.869) (-768.499) [-768.545] (-768.190) * (-768.382) (-770.943) (-768.480) [-767.923] -- 0:01:10
79000 -- (-768.662) (-772.106) [-768.713] (-771.417) * (-770.210) (-770.861) [-770.389] (-768.326) -- 0:01:09
79500 -- (-768.699) [-770.048] (-769.166) (-770.509) * (-768.772) (-767.765) (-771.811) [-769.095] -- 0:01:09
80000 -- [-767.926] (-770.381) (-767.236) (-768.187) * (-767.618) (-769.344) (-767.735) [-770.055] -- 0:01:09
Average standard deviation of split frequencies: 0.019992
80500 -- (-767.328) [-771.335] (-769.518) (-768.076) * (-768.585) (-768.787) [-768.688] (-772.373) -- 0:01:08
81000 -- (-769.774) (-769.217) (-771.386) [-767.700] * (-769.716) (-770.213) [-772.013] (-771.468) -- 0:01:08
81500 -- (-768.300) (-772.160) (-771.521) [-768.668] * (-771.956) (-772.199) (-769.349) [-768.339] -- 0:01:07
82000 -- (-773.763) (-768.740) [-769.122] (-767.483) * (-772.406) [-767.247] (-768.022) (-771.179) -- 0:01:07
82500 -- (-771.477) [-769.443] (-768.864) (-769.044) * [-770.397] (-767.228) (-770.748) (-770.984) -- 0:01:06
83000 -- (-771.606) [-770.356] (-769.427) (-769.922) * [-767.357] (-768.849) (-767.677) (-769.624) -- 0:01:06
83500 -- (-767.692) (-768.614) [-770.231] (-769.966) * [-767.475] (-768.683) (-768.262) (-768.292) -- 0:01:05
84000 -- [-767.928] (-772.491) (-768.687) (-770.983) * (-768.600) (-770.104) [-768.447] (-767.825) -- 0:01:05
84500 -- [-767.964] (-769.221) (-771.574) (-768.328) * (-768.606) (-768.455) [-771.944] (-770.109) -- 0:01:05
85000 -- (-769.580) (-768.043) [-771.365] (-768.843) * (-768.223) [-767.715] (-769.546) (-768.234) -- 0:01:04
Average standard deviation of split frequencies: 0.018363
85500 -- (-769.240) (-767.387) (-768.073) [-770.763] * (-768.695) [-767.699] (-771.198) (-770.437) -- 0:01:04
86000 -- (-769.037) [-767.656] (-769.454) (-771.546) * (-774.347) (-768.963) (-769.586) [-768.701] -- 0:01:03
86500 -- (-769.007) (-768.757) [-769.121] (-768.643) * (-770.237) (-769.089) [-768.148] (-771.104) -- 0:01:03
87000 -- (-768.103) (-771.793) [-767.752] (-770.183) * (-770.601) (-769.722) [-768.357] (-770.229) -- 0:01:02
87500 -- (-767.981) (-768.350) [-774.473] (-768.597) * (-769.273) (-769.657) [-768.900] (-769.459) -- 0:01:02
88000 -- (-768.225) (-769.930) [-769.869] (-767.882) * (-769.628) (-768.149) (-770.011) [-768.300] -- 0:01:02
88500 -- (-768.325) (-767.813) (-768.419) [-769.184] * (-772.791) (-767.947) (-768.906) [-771.466] -- 0:01:01
89000 -- (-769.632) (-767.569) (-773.299) [-767.340] * (-771.148) [-767.285] (-770.737) (-771.971) -- 0:01:01
89500 -- (-768.691) [-767.623] (-772.026) (-769.276) * (-769.308) (-770.388) (-769.883) [-768.597] -- 0:01:01
90000 -- (-767.611) (-768.140) (-768.659) [-768.964] * (-770.452) (-767.539) [-770.355] (-768.368) -- 0:01:00
Average standard deviation of split frequencies: 0.019497
90500 -- [-772.006] (-774.821) (-770.663) (-767.779) * (-772.157) (-771.190) [-772.366] (-768.023) -- 0:01:00
91000 -- (-769.891) [-771.458] (-769.092) (-771.628) * (-769.405) [-769.131] (-770.494) (-770.650) -- 0:01:09
91500 -- (-771.086) (-770.208) (-770.357) [-768.964] * (-768.229) (-768.668) [-770.362] (-773.463) -- 0:01:09
92000 -- (-769.377) [-770.116] (-768.536) (-768.358) * (-770.344) [-767.165] (-769.117) (-771.443) -- 0:01:09
92500 -- (-769.032) (-769.835) [-773.758] (-768.923) * (-767.136) (-767.729) [-768.993] (-770.257) -- 0:01:08
93000 -- (-774.997) [-768.964] (-771.060) (-770.345) * (-771.698) (-770.303) [-768.675] (-771.056) -- 0:01:08
93500 -- (-768.872) (-769.539) [-770.814] (-769.749) * [-769.066] (-767.348) (-770.047) (-768.019) -- 0:01:07
94000 -- (-769.586) (-769.563) (-768.592) [-768.817] * [-767.987] (-769.341) (-769.237) (-767.863) -- 0:01:07
94500 -- [-769.567] (-768.343) (-773.298) (-768.555) * (-773.582) [-768.560] (-775.978) (-768.135) -- 0:01:07
95000 -- (-768.671) (-770.628) [-768.864] (-769.261) * (-767.822) (-768.326) (-770.201) [-770.215] -- 0:01:06
Average standard deviation of split frequencies: 0.021651
95500 -- (-769.947) [-769.503] (-771.013) (-769.399) * [-768.015] (-770.228) (-768.616) (-769.004) -- 0:01:06
96000 -- [-768.559] (-769.113) (-769.489) (-770.774) * (-772.607) [-770.254] (-771.121) (-769.259) -- 0:01:05
96500 -- (-771.304) (-770.655) [-769.354] (-767.262) * (-770.964) [-772.219] (-771.645) (-769.334) -- 0:01:05
97000 -- (-769.824) [-768.796] (-767.160) (-769.591) * (-768.040) (-773.136) (-772.821) [-771.462] -- 0:01:05
97500 -- (-772.987) [-770.066] (-768.316) (-770.952) * (-771.233) (-776.314) (-769.113) [-768.409] -- 0:01:04
98000 -- (-771.696) (-773.931) (-769.743) [-769.687] * (-768.667) (-773.771) (-771.335) [-768.973] -- 0:01:04
98500 -- [-774.084] (-770.579) (-771.498) (-769.943) * (-769.170) (-770.854) [-769.432] (-767.840) -- 0:01:04
99000 -- (-773.422) (-768.199) (-773.729) [-770.431] * [-768.682] (-772.767) (-767.773) (-769.351) -- 0:01:03
99500 -- (-770.315) [-771.050] (-774.915) (-771.358) * (-770.102) (-770.330) (-767.996) [-769.652] -- 0:01:03
100000 -- (-769.309) [-768.643] (-769.707) (-769.568) * (-768.622) (-772.179) (-767.745) [-770.073] -- 0:01:02
Average standard deviation of split frequencies: 0.019717
100500 -- (-768.725) (-768.221) [-768.905] (-768.589) * (-768.459) (-773.178) (-769.396) [-768.986] -- 0:01:02
101000 -- (-768.952) [-767.513] (-768.491) (-768.379) * (-771.546) (-771.345) [-767.926] (-768.369) -- 0:01:02
101500 -- (-767.864) [-767.774] (-772.301) (-770.528) * [-770.084] (-770.392) (-767.964) (-768.876) -- 0:01:01
102000 -- (-769.223) (-769.714) (-768.638) [-769.138] * (-776.912) (-768.422) (-768.296) [-769.075] -- 0:01:01
102500 -- (-773.651) [-768.495] (-767.718) (-771.623) * (-775.266) [-768.447] (-767.342) (-767.551) -- 0:01:01
103000 -- (-772.310) [-768.719] (-770.640) (-772.853) * (-771.596) (-769.285) (-767.319) [-770.489] -- 0:01:00
103500 -- (-767.744) (-769.732) [-768.430] (-774.781) * (-768.204) (-768.891) [-767.783] (-768.743) -- 0:01:00
104000 -- (-767.744) [-767.669] (-768.242) (-771.388) * (-770.576) [-768.289] (-768.890) (-768.275) -- 0:01:00
104500 -- (-767.941) (-770.080) [-768.502] (-769.786) * (-770.707) (-768.468) (-769.019) [-769.976] -- 0:00:59
105000 -- (-768.386) (-770.386) [-771.304] (-772.817) * (-774.332) (-767.631) (-769.617) [-768.781] -- 0:00:59
Average standard deviation of split frequencies: 0.020457
105500 -- (-767.860) [-771.233] (-769.645) (-770.613) * [-768.513] (-768.849) (-770.514) (-777.706) -- 0:00:59
106000 -- (-767.772) (-769.272) (-769.504) [-771.060] * (-769.451) [-768.274] (-774.012) (-772.171) -- 0:00:59
106500 -- (-773.383) (-768.880) (-769.406) [-773.012] * (-769.329) (-770.354) [-770.392] (-767.872) -- 0:01:07
107000 -- [-771.065] (-767.652) (-770.017) (-783.746) * [-770.748] (-773.761) (-772.633) (-767.822) -- 0:01:06
107500 -- (-768.073) [-767.490] (-769.260) (-770.939) * (-771.632) (-770.821) (-770.928) [-769.247] -- 0:01:06
108000 -- [-768.567] (-770.154) (-772.635) (-774.550) * (-772.231) (-772.202) (-768.614) [-767.423] -- 0:01:06
108500 -- [-769.052] (-770.097) (-769.492) (-774.582) * (-772.325) [-770.460] (-771.634) (-771.380) -- 0:01:05
109000 -- [-768.851] (-769.690) (-766.961) (-768.626) * [-769.031] (-770.370) (-771.947) (-770.335) -- 0:01:05
109500 -- (-769.338) (-770.849) [-770.703] (-768.339) * [-768.426] (-767.840) (-772.677) (-769.538) -- 0:01:05
110000 -- (-767.772) (-769.376) (-770.366) [-769.535] * (-768.750) [-769.707] (-774.400) (-769.234) -- 0:01:04
Average standard deviation of split frequencies: 0.019505
110500 -- (-768.615) (-767.397) (-767.511) [-769.935] * (-769.565) [-768.812] (-773.526) (-767.758) -- 0:01:04
111000 -- (-767.232) (-770.128) [-768.256] (-768.063) * (-768.360) [-769.087] (-774.636) (-767.512) -- 0:01:04
111500 -- [-768.177] (-768.619) (-768.234) (-768.457) * (-768.395) (-768.634) [-771.480] (-768.035) -- 0:01:03
112000 -- [-768.684] (-767.194) (-768.383) (-767.667) * (-769.962) (-768.213) [-770.689] (-767.772) -- 0:01:03
112500 -- (-769.137) (-767.898) (-770.700) [-767.075] * (-769.183) (-774.103) [-769.160] (-767.883) -- 0:01:03
113000 -- (-768.802) (-770.036) [-770.070] (-769.524) * [-767.937] (-774.342) (-770.750) (-771.893) -- 0:01:02
113500 -- (-767.820) (-773.260) [-770.498] (-769.898) * [-769.848] (-772.456) (-768.930) (-771.745) -- 0:01:02
114000 -- (-768.003) [-772.112] (-770.156) (-767.463) * (-768.626) [-767.834] (-771.120) (-772.292) -- 0:01:02
114500 -- (-768.873) (-770.928) [-768.366] (-767.862) * (-767.871) (-767.291) (-767.476) [-770.220] -- 0:01:01
115000 -- [-768.865] (-770.557) (-769.021) (-769.118) * [-768.684] (-768.973) (-771.782) (-772.338) -- 0:01:01
Average standard deviation of split frequencies: 0.017753
115500 -- (-770.885) [-767.605] (-770.192) (-772.621) * (-772.701) (-768.028) [-770.211] (-772.331) -- 0:01:01
116000 -- (-771.903) [-768.965] (-768.709) (-771.290) * (-769.877) (-768.622) (-768.792) [-769.070] -- 0:01:00
116500 -- (-768.861) [-768.196] (-771.449) (-769.449) * (-771.841) [-767.235] (-769.818) (-772.469) -- 0:01:00
117000 -- [-768.917] (-768.960) (-768.773) (-768.566) * (-773.857) (-769.515) (-767.735) [-771.282] -- 0:01:00
117500 -- (-771.418) [-767.525] (-772.017) (-770.164) * (-767.532) (-769.426) (-769.603) [-770.499] -- 0:01:00
118000 -- (-768.176) [-768.605] (-769.924) (-777.634) * [-768.991] (-771.867) (-768.206) (-772.208) -- 0:00:59
118500 -- (-769.185) [-771.512] (-769.024) (-777.666) * (-768.676) [-771.021] (-770.196) (-778.830) -- 0:00:59
119000 -- (-773.287) (-769.823) (-768.000) [-770.937] * [-768.769] (-769.819) (-771.655) (-767.905) -- 0:00:59
119500 -- (-768.127) (-769.963) (-770.738) [-767.828] * [-767.842] (-768.278) (-768.002) (-769.956) -- 0:00:58
120000 -- (-768.538) [-768.791] (-768.368) (-767.447) * (-767.813) (-770.467) [-768.169] (-769.879) -- 0:00:58
Average standard deviation of split frequencies: 0.017477
120500 -- (-768.181) [-769.629] (-776.558) (-767.873) * (-767.910) (-769.165) (-768.813) [-770.794] -- 0:00:58
121000 -- (-770.534) (-767.359) (-776.094) [-767.101] * (-768.795) (-768.848) [-768.907] (-773.618) -- 0:01:05
121500 -- (-767.756) (-767.975) (-771.629) [-770.344] * [-768.731] (-767.923) (-770.513) (-767.796) -- 0:01:05
122000 -- (-767.550) [-768.374] (-770.988) (-772.211) * (-769.094) (-769.090) [-768.019] (-769.802) -- 0:01:04
122500 -- [-768.004] (-771.119) (-773.517) (-774.492) * (-770.316) (-769.899) [-771.213] (-768.853) -- 0:01:04
123000 -- [-768.145] (-768.989) (-770.771) (-770.577) * [-768.847] (-768.028) (-768.986) (-773.275) -- 0:01:04
123500 -- (-768.241) (-770.284) (-769.887) [-773.721] * (-769.841) (-770.707) (-772.757) [-771.712] -- 0:01:03
124000 -- (-768.741) (-769.214) (-773.850) [-769.259] * (-769.342) (-769.521) (-769.352) [-767.657] -- 0:01:03
124500 -- (-768.810) (-768.690) (-768.439) [-768.304] * [-768.029] (-767.254) (-768.851) (-768.827) -- 0:01:03
125000 -- (-768.129) (-768.289) [-767.558] (-768.765) * (-770.542) [-767.304] (-767.283) (-768.283) -- 0:01:03
Average standard deviation of split frequencies: 0.014778
125500 -- [-769.469] (-776.703) (-767.755) (-771.501) * (-769.633) (-774.497) [-768.265] (-771.355) -- 0:01:02
126000 -- (-771.791) (-771.536) [-768.350] (-768.312) * (-769.939) [-771.406] (-768.875) (-770.260) -- 0:01:02
126500 -- (-772.496) (-767.574) [-769.137] (-770.110) * (-769.150) (-768.570) [-768.484] (-769.070) -- 0:01:02
127000 -- (-768.246) [-768.989] (-769.315) (-774.300) * (-771.725) (-768.407) [-767.609] (-769.197) -- 0:01:01
127500 -- (-771.053) [-770.031] (-770.373) (-770.959) * [-769.968] (-768.186) (-768.005) (-774.842) -- 0:01:01
128000 -- [-767.830] (-772.436) (-769.129) (-770.709) * [-769.722] (-769.328) (-768.033) (-770.788) -- 0:01:01
128500 -- [-768.743] (-767.599) (-769.061) (-770.606) * [-771.236] (-771.921) (-769.536) (-770.151) -- 0:01:01
129000 -- (-769.825) (-768.070) (-767.655) [-771.878] * [-767.947] (-774.450) (-771.364) (-768.316) -- 0:01:00
129500 -- (-767.868) (-771.637) [-767.728] (-771.504) * [-770.101] (-775.522) (-773.530) (-770.852) -- 0:01:00
130000 -- [-767.699] (-775.367) (-767.213) (-771.636) * [-768.957] (-772.917) (-772.088) (-771.498) -- 0:01:00
Average standard deviation of split frequencies: 0.016519
130500 -- (-770.087) (-767.569) [-767.251] (-769.510) * (-770.373) (-769.301) [-768.523] (-770.566) -- 0:00:59
131000 -- (-769.242) (-767.705) (-770.380) [-770.339] * [-767.895] (-771.760) (-771.766) (-769.018) -- 0:00:59
131500 -- (-767.884) (-768.304) (-770.926) [-772.646] * (-771.174) (-771.457) [-769.271] (-768.719) -- 0:00:59
132000 -- (-773.022) [-770.710] (-770.446) (-769.570) * (-768.252) (-769.456) (-768.835) [-768.043] -- 0:00:59
132500 -- (-770.255) (-771.518) (-771.614) [-767.825] * (-767.465) (-775.288) (-769.998) [-767.264] -- 0:00:58
133000 -- (-769.141) (-771.542) [-770.409] (-769.080) * (-768.016) (-775.275) (-769.412) [-767.486] -- 0:00:58
133500 -- [-770.327] (-767.598) (-770.745) (-773.309) * (-768.661) (-769.308) (-768.863) [-767.135] -- 0:00:58
134000 -- (-771.918) (-767.470) (-769.729) [-768.148] * (-769.308) [-768.336] (-767.643) (-769.561) -- 0:00:58
134500 -- (-768.253) (-766.840) [-768.912] (-770.309) * [-767.963] (-772.262) (-775.320) (-768.376) -- 0:00:57
135000 -- (-768.127) (-767.775) [-768.315] (-767.946) * [-768.009] (-773.707) (-770.259) (-770.021) -- 0:00:57
Average standard deviation of split frequencies: 0.015405
135500 -- (-773.629) [-769.086] (-768.213) (-767.664) * (-771.289) (-774.548) (-769.057) [-768.125] -- 0:00:57
136000 -- (-769.997) (-772.885) (-769.783) [-767.457] * (-768.735) (-766.901) [-770.823] (-771.251) -- 0:01:03
136500 -- (-770.526) (-772.932) [-767.915] (-769.920) * (-772.701) (-767.113) [-770.095] (-771.227) -- 0:01:03
137000 -- (-772.466) [-768.647] (-770.639) (-770.020) * (-770.338) [-768.099] (-767.479) (-771.095) -- 0:01:02
137500 -- (-773.615) [-769.570] (-768.764) (-774.257) * (-768.954) [-768.030] (-767.817) (-768.678) -- 0:01:02
138000 -- (-770.678) (-774.102) [-769.059] (-772.209) * (-771.676) [-768.107] (-767.653) (-768.915) -- 0:01:02
138500 -- (-770.049) (-767.711) (-768.263) [-769.143] * (-774.454) (-768.966) [-768.202] (-770.337) -- 0:01:02
139000 -- [-770.596] (-767.705) (-768.158) (-772.348) * [-769.028] (-770.204) (-770.859) (-767.371) -- 0:01:01
139500 -- (-776.336) [-767.706] (-768.426) (-775.174) * (-768.795) (-768.209) [-768.957] (-768.381) -- 0:01:01
140000 -- (-770.898) [-768.407] (-768.673) (-769.684) * [-769.479] (-769.172) (-771.029) (-771.940) -- 0:01:01
Average standard deviation of split frequencies: 0.014287
140500 -- (-768.508) [-767.948] (-768.844) (-771.422) * (-771.782) (-772.254) [-767.473] (-770.141) -- 0:01:01
141000 -- [-768.368] (-771.007) (-770.118) (-771.006) * [-769.856] (-768.696) (-770.365) (-768.017) -- 0:01:00
141500 -- [-767.576] (-773.902) (-769.811) (-772.331) * (-768.305) [-767.963] (-769.963) (-771.454) -- 0:01:00
142000 -- (-768.379) (-769.950) [-768.586] (-769.868) * (-768.078) (-768.376) [-769.336] (-768.376) -- 0:01:00
142500 -- (-769.309) (-768.624) (-768.850) [-767.615] * [-768.982] (-769.469) (-770.303) (-768.947) -- 0:01:00
143000 -- (-769.082) (-767.510) (-768.354) [-768.129] * (-771.855) [-769.868] (-770.503) (-767.665) -- 0:00:59
143500 -- (-771.283) (-767.324) (-767.986) [-769.396] * (-771.356) (-771.859) [-769.493] (-767.343) -- 0:00:59
144000 -- (-767.307) (-767.919) (-768.816) [-767.164] * (-775.971) [-768.614] (-768.082) (-769.568) -- 0:00:59
144500 -- (-768.333) (-768.125) [-767.735] (-767.917) * (-771.732) [-767.810] (-768.882) (-767.965) -- 0:00:59
145000 -- (-772.110) (-769.442) (-769.996) [-768.615] * (-767.989) (-768.296) [-767.931] (-768.464) -- 0:00:58
Average standard deviation of split frequencies: 0.013884
145500 -- (-767.752) (-769.297) [-769.068] (-769.173) * [-768.721] (-773.061) (-770.153) (-769.989) -- 0:00:58
146000 -- (-768.848) (-767.706) (-768.920) [-768.148] * (-770.122) (-772.694) (-768.954) [-770.227] -- 0:00:58
146500 -- (-770.070) [-767.779] (-770.468) (-773.356) * (-772.327) [-770.148] (-768.057) (-771.102) -- 0:00:58
147000 -- (-768.207) (-769.382) [-768.034] (-771.288) * (-769.649) [-767.899] (-770.446) (-768.559) -- 0:00:58
147500 -- [-769.308] (-774.656) (-770.059) (-770.413) * (-771.036) (-769.195) [-768.857] (-768.936) -- 0:00:57
148000 -- (-768.665) (-770.871) [-767.770] (-770.849) * (-770.678) (-769.735) (-769.202) [-767.135] -- 0:00:57
148500 -- [-771.865] (-769.498) (-768.610) (-769.756) * [-773.216] (-769.686) (-773.269) (-769.133) -- 0:00:57
149000 -- (-769.607) (-770.281) (-767.936) [-768.007] * (-769.464) (-774.442) (-768.239) [-768.635] -- 0:00:57
149500 -- (-769.094) [-769.960] (-777.474) (-767.804) * (-768.344) [-767.106] (-767.495) (-769.346) -- 0:00:56
150000 -- (-767.760) (-767.821) (-772.273) [-768.730] * (-768.420) [-770.363] (-769.522) (-772.709) -- 0:00:56
Average standard deviation of split frequencies: 0.014327
150500 -- [-769.133] (-768.566) (-771.901) (-768.621) * (-768.052) (-768.609) (-769.735) [-770.676] -- 0:00:56
151000 -- [-768.267] (-771.180) (-774.337) (-769.305) * (-768.910) [-768.468] (-768.704) (-770.841) -- 0:00:56
151500 -- [-767.879] (-768.876) (-768.734) (-772.093) * [-768.623] (-767.190) (-767.035) (-780.087) -- 0:00:56
152000 -- (-771.117) (-769.610) [-768.512] (-768.336) * (-769.090) [-766.875] (-769.908) (-769.309) -- 0:01:01
152500 -- (-776.408) (-769.639) [-772.871] (-773.143) * (-768.336) (-770.982) (-769.974) [-767.592] -- 0:01:01
153000 -- (-777.871) (-768.417) (-768.772) [-774.488] * (-768.523) [-770.711] (-772.629) (-768.191) -- 0:01:00
153500 -- (-767.531) [-771.476] (-771.573) (-769.024) * [-768.166] (-769.314) (-767.940) (-768.957) -- 0:01:00
154000 -- (-772.901) (-769.283) (-771.612) [-768.161] * (-771.166) [-771.444] (-767.539) (-767.788) -- 0:01:00
154500 -- (-771.606) [-769.245] (-773.202) (-772.243) * (-768.006) (-771.513) [-767.895] (-770.129) -- 0:01:00
155000 -- (-768.599) (-767.418) (-769.826) [-770.545] * (-769.326) (-769.038) (-767.577) [-766.941] -- 0:00:59
Average standard deviation of split frequencies: 0.015268
155500 -- (-769.183) [-769.623] (-769.360) (-769.338) * (-769.582) (-768.810) (-771.200) [-767.493] -- 0:00:59
156000 -- (-768.628) (-773.348) (-770.147) [-768.974] * (-768.095) [-768.093] (-768.396) (-768.340) -- 0:00:59
156500 -- [-768.507] (-771.203) (-769.188) (-770.826) * (-767.948) [-768.596] (-777.088) (-769.845) -- 0:00:59
157000 -- (-770.026) [-769.128] (-769.631) (-770.713) * [-773.430] (-770.086) (-768.307) (-773.930) -- 0:00:59
157500 -- (-767.796) (-770.292) (-769.388) [-772.653] * (-770.612) (-767.892) [-772.086] (-768.512) -- 0:00:58
158000 -- (-768.346) (-771.931) (-769.577) [-768.582] * [-770.222] (-767.530) (-768.860) (-772.420) -- 0:00:58
158500 -- (-772.210) (-771.236) (-770.128) [-769.744] * (-770.044) [-767.991] (-767.819) (-768.386) -- 0:00:58
159000 -- [-770.178] (-770.628) (-768.795) (-770.700) * [-768.065] (-767.751) (-768.866) (-769.115) -- 0:00:58
159500 -- (-772.172) (-770.227) [-768.959] (-771.836) * [-769.413] (-767.538) (-770.576) (-771.277) -- 0:00:57
160000 -- (-770.255) (-769.303) [-768.371] (-771.361) * (-771.931) (-769.004) [-767.884] (-771.948) -- 0:00:57
Average standard deviation of split frequencies: 0.016369
160500 -- [-768.817] (-767.990) (-767.086) (-769.189) * (-770.368) (-771.356) (-767.914) [-768.454] -- 0:00:57
161000 -- [-768.765] (-772.626) (-768.297) (-770.407) * [-769.773] (-768.345) (-768.453) (-768.898) -- 0:00:57
161500 -- (-771.831) (-769.853) [-768.522] (-772.143) * (-769.749) [-770.590] (-768.034) (-766.998) -- 0:00:57
162000 -- [-767.471] (-769.798) (-773.029) (-768.694) * (-769.029) [-771.098] (-770.889) (-772.501) -- 0:00:56
162500 -- (-769.836) (-768.713) (-770.405) [-768.066] * (-767.793) [-768.873] (-769.834) (-773.858) -- 0:00:56
163000 -- [-767.998] (-768.242) (-774.012) (-767.919) * (-769.484) [-768.697] (-768.231) (-770.736) -- 0:00:56
163500 -- (-769.881) [-767.120] (-773.319) (-771.233) * [-768.685] (-768.830) (-768.004) (-774.438) -- 0:00:56
164000 -- (-769.069) (-771.225) (-768.909) [-771.748] * (-771.683) (-772.752) [-768.985] (-768.176) -- 0:00:56
164500 -- (-773.321) (-770.530) (-769.780) [-769.236] * (-769.343) [-769.862] (-768.342) (-768.016) -- 0:00:55
165000 -- (-767.223) (-769.380) (-769.238) [-768.207] * (-768.114) [-772.709] (-769.430) (-768.839) -- 0:00:55
Average standard deviation of split frequencies: 0.015193
165500 -- [-771.130] (-769.605) (-769.579) (-768.118) * (-767.271) (-772.113) (-769.995) [-774.468] -- 0:00:55
166000 -- [-770.929] (-771.329) (-769.600) (-769.019) * [-769.579] (-770.554) (-771.871) (-777.267) -- 0:00:55
166500 -- (-771.456) (-773.255) (-767.968) [-769.649] * (-768.190) [-771.982] (-772.064) (-769.671) -- 0:00:55
167000 -- [-770.359] (-770.689) (-769.759) (-769.107) * (-767.298) [-771.508] (-773.925) (-768.100) -- 0:00:54
167500 -- (-766.943) (-771.471) [-769.325] (-769.620) * (-770.163) (-769.814) [-770.729] (-777.729) -- 0:00:54
168000 -- [-768.076] (-772.481) (-769.793) (-768.667) * (-768.901) (-770.966) [-770.652] (-767.863) -- 0:00:54
168500 -- (-775.067) (-771.675) (-768.267) [-769.357] * [-769.536] (-769.320) (-772.639) (-767.512) -- 0:00:59
169000 -- (-770.799) [-770.789] (-769.187) (-767.505) * (-768.502) [-772.629] (-770.729) (-770.967) -- 0:00:59
169500 -- (-770.281) (-772.308) (-772.280) [-767.465] * [-767.585] (-769.427) (-774.529) (-772.247) -- 0:00:58
170000 -- (-768.855) [-770.191] (-770.555) (-767.951) * (-769.693) [-773.812] (-774.227) (-767.871) -- 0:00:58
Average standard deviation of split frequencies: 0.017009
170500 -- [-769.947] (-768.975) (-770.806) (-768.474) * (-770.183) (-771.140) (-769.538) [-769.195] -- 0:00:58
171000 -- [-769.116] (-770.486) (-768.629) (-767.221) * (-769.045) (-771.724) [-769.186] (-767.684) -- 0:00:58
171500 -- (-769.033) [-768.159] (-769.831) (-769.729) * (-769.475) (-769.541) (-768.665) [-770.366] -- 0:00:57
172000 -- (-769.779) (-768.062) (-769.684) [-770.046] * (-772.729) (-768.735) [-769.256] (-772.363) -- 0:00:57
172500 -- [-772.294] (-770.634) (-772.391) (-770.586) * [-771.266] (-768.223) (-768.665) (-767.447) -- 0:00:57
173000 -- (-769.167) (-772.109) (-773.758) [-768.187] * (-768.072) (-769.242) (-768.571) [-768.135] -- 0:00:57
173500 -- (-767.708) (-768.910) [-772.701] (-767.806) * (-768.888) [-768.695] (-768.747) (-775.145) -- 0:00:57
174000 -- (-769.151) (-768.219) (-767.381) [-767.219] * (-768.963) (-771.356) (-768.708) [-772.024] -- 0:00:56
174500 -- [-769.904] (-768.605) (-773.661) (-767.942) * (-769.983) [-768.464] (-771.647) (-767.676) -- 0:00:56
175000 -- (-771.486) (-770.471) (-768.620) [-769.629] * (-767.848) (-770.881) (-774.652) [-769.230] -- 0:00:56
Average standard deviation of split frequencies: 0.016368
175500 -- (-769.060) (-771.474) (-768.890) [-768.845] * (-768.005) (-773.172) (-767.681) [-770.488] -- 0:00:56
176000 -- [-767.978] (-768.090) (-771.454) (-771.175) * [-767.297] (-773.843) (-768.190) (-768.080) -- 0:00:56
176500 -- (-770.132) (-769.420) [-768.900] (-773.278) * (-771.122) (-767.977) [-767.871] (-768.462) -- 0:00:55
177000 -- (-771.623) [-770.055] (-769.267) (-769.258) * (-769.978) (-767.698) (-767.216) [-767.791] -- 0:00:55
177500 -- (-767.102) (-770.615) (-767.563) [-768.441] * (-768.490) (-769.975) (-768.635) [-768.057] -- 0:00:55
178000 -- (-767.737) [-767.794] (-767.820) (-767.659) * [-768.773] (-770.080) (-773.406) (-767.425) -- 0:00:55
178500 -- [-767.677] (-771.063) (-767.516) (-771.944) * (-769.052) (-768.471) (-768.175) [-767.399] -- 0:00:55
179000 -- (-768.593) (-768.129) (-767.457) [-769.393] * (-768.813) (-768.700) (-769.186) [-768.545] -- 0:00:55
179500 -- (-769.869) [-769.493] (-768.167) (-769.045) * [-768.779] (-768.280) (-767.908) (-768.446) -- 0:00:54
180000 -- (-767.907) [-768.477] (-767.699) (-768.506) * (-769.319) (-769.307) (-770.637) [-769.582] -- 0:00:54
Average standard deviation of split frequencies: 0.017105
180500 -- [-767.343] (-769.159) (-768.293) (-769.466) * (-768.004) (-768.796) (-772.943) [-768.459] -- 0:00:54
181000 -- (-767.974) [-769.441] (-772.838) (-768.134) * (-770.332) [-768.151] (-768.723) (-769.442) -- 0:00:54
181500 -- (-768.591) (-768.883) [-767.870] (-767.986) * (-772.572) [-768.946] (-768.572) (-768.242) -- 0:00:54
182000 -- (-767.359) (-768.312) (-767.956) [-767.841] * (-771.254) (-768.472) (-769.618) [-770.082] -- 0:00:53
182500 -- (-772.140) [-769.568] (-771.506) (-768.334) * (-770.345) (-774.397) (-768.622) [-768.224] -- 0:00:53
183000 -- [-773.891] (-769.457) (-770.404) (-769.154) * (-769.727) (-768.043) [-767.850] (-769.470) -- 0:00:53
183500 -- [-769.892] (-770.087) (-767.892) (-770.858) * (-770.873) [-769.992] (-772.742) (-775.042) -- 0:00:53
184000 -- (-772.303) [-772.397] (-768.362) (-771.880) * [-771.403] (-767.185) (-768.670) (-770.587) -- 0:00:53
184500 -- (-769.704) (-768.161) [-769.692] (-772.272) * (-771.093) [-767.125] (-769.348) (-768.047) -- 0:00:53
185000 -- (-767.786) [-768.664] (-770.776) (-767.911) * (-773.625) [-769.121] (-770.902) (-769.523) -- 0:00:52
Average standard deviation of split frequencies: 0.017074
185500 -- [-767.571] (-770.007) (-771.848) (-768.203) * (-769.917) (-768.825) [-769.536] (-769.652) -- 0:00:57
186000 -- (-772.028) (-770.398) (-768.990) [-769.278] * [-769.024] (-772.273) (-769.956) (-771.927) -- 0:00:56
186500 -- (-771.513) [-769.127] (-769.178) (-768.294) * (-766.975) [-768.727] (-768.692) (-771.811) -- 0:00:56
187000 -- (-770.363) [-768.677] (-771.139) (-769.835) * (-775.453) (-768.036) [-767.524] (-767.431) -- 0:00:56
187500 -- [-767.791] (-769.693) (-775.097) (-775.750) * [-767.984] (-768.716) (-770.303) (-774.278) -- 0:00:56
188000 -- (-768.128) (-768.223) (-770.167) [-768.967] * (-769.138) (-769.263) (-769.792) [-769.581] -- 0:00:56
188500 -- (-769.090) (-769.955) [-769.829] (-770.064) * [-771.080] (-774.903) (-769.010) (-768.671) -- 0:00:55
189000 -- (-772.594) [-768.266] (-771.364) (-769.735) * [-770.621] (-771.254) (-768.493) (-770.279) -- 0:00:55
189500 -- (-770.580) (-768.137) [-770.128] (-767.986) * (-767.875) (-770.730) (-769.923) [-771.151] -- 0:00:55
190000 -- (-769.203) (-768.623) [-770.063] (-770.815) * [-768.036] (-768.585) (-771.370) (-770.708) -- 0:00:55
Average standard deviation of split frequencies: 0.016434
190500 -- [-767.374] (-768.768) (-770.212) (-768.478) * (-767.802) [-768.604] (-773.346) (-770.479) -- 0:00:55
191000 -- (-767.526) [-768.386] (-770.369) (-769.650) * (-769.500) (-772.496) (-773.992) [-768.357] -- 0:00:55
191500 -- (-768.171) [-767.743] (-768.934) (-768.623) * (-770.266) [-769.254] (-767.965) (-769.110) -- 0:00:54
192000 -- [-768.395] (-768.668) (-769.300) (-768.713) * (-770.908) (-768.804) [-767.389] (-770.656) -- 0:00:54
192500 -- (-770.754) (-768.840) (-768.310) [-768.633] * [-770.456] (-770.638) (-768.938) (-769.861) -- 0:00:54
193000 -- (-767.948) (-771.362) (-768.045) [-769.502] * (-768.127) (-769.015) (-768.129) [-767.666] -- 0:00:54
193500 -- (-771.054) (-770.069) (-767.683) [-771.478] * (-769.022) (-773.642) [-768.180] (-767.966) -- 0:00:54
194000 -- (-769.868) (-768.886) (-769.058) [-768.684] * [-767.818] (-769.184) (-768.708) (-767.521) -- 0:00:54
194500 -- (-771.579) (-768.893) [-767.986] (-768.544) * [-769.719] (-775.336) (-769.720) (-767.557) -- 0:00:53
195000 -- (-775.696) (-768.035) (-768.521) [-769.507] * (-767.426) [-767.670] (-769.345) (-768.231) -- 0:00:53
Average standard deviation of split frequencies: 0.016553
195500 -- (-772.542) (-770.553) [-770.790] (-776.790) * (-770.977) (-769.289) (-769.182) [-771.930] -- 0:00:53
196000 -- (-768.063) (-768.918) (-768.863) [-769.621] * (-767.331) (-767.617) [-771.793] (-768.760) -- 0:00:53
196500 -- (-772.994) [-772.583] (-767.978) (-769.688) * (-767.094) (-769.063) [-768.420] (-767.430) -- 0:00:53
197000 -- (-771.843) [-769.224] (-768.871) (-771.669) * (-771.743) [-770.404] (-769.624) (-769.745) -- 0:00:52
197500 -- (-772.624) (-769.275) [-770.400] (-773.457) * (-768.370) [-768.470] (-771.860) (-770.883) -- 0:00:52
198000 -- [-773.117] (-769.653) (-771.862) (-767.961) * (-771.193) (-770.869) [-772.221] (-767.642) -- 0:00:52
198500 -- [-770.193] (-771.831) (-770.500) (-771.193) * (-767.875) (-772.283) [-772.646] (-768.591) -- 0:00:52
199000 -- (-770.213) (-770.389) (-768.830) [-767.607] * (-772.687) (-769.442) [-768.410] (-768.885) -- 0:00:52
199500 -- (-767.514) (-773.726) (-767.648) [-768.653] * (-768.363) (-767.515) [-768.325] (-770.995) -- 0:00:52
200000 -- [-769.851] (-771.590) (-767.306) (-771.893) * (-768.523) [-768.167] (-768.685) (-768.299) -- 0:00:51
Average standard deviation of split frequencies: 0.016583
200500 -- (-768.469) [-768.977] (-767.649) (-769.168) * (-767.107) (-768.609) [-770.804] (-771.102) -- 0:00:55
201000 -- (-770.429) (-767.835) (-775.428) [-769.181] * [-767.123] (-769.416) (-769.034) (-768.851) -- 0:00:55
201500 -- (-773.968) [-767.189] (-770.023) (-771.920) * (-768.572) [-767.936] (-770.539) (-767.792) -- 0:00:55
202000 -- [-771.212] (-770.301) (-767.226) (-775.001) * (-767.022) (-772.150) [-772.879] (-768.180) -- 0:00:55
202500 -- [-772.257] (-772.799) (-768.389) (-769.464) * [-767.332] (-773.060) (-771.113) (-768.143) -- 0:00:55
203000 -- [-768.524] (-768.520) (-768.948) (-768.017) * (-770.328) (-768.737) [-770.131] (-768.021) -- 0:00:54
203500 -- (-767.753) (-770.046) (-768.532) [-770.056] * [-768.897] (-769.902) (-769.954) (-768.820) -- 0:00:54
204000 -- (-770.045) (-770.478) [-767.600] (-769.827) * (-770.571) (-768.734) [-768.570] (-770.214) -- 0:00:54
204500 -- (-767.846) [-768.682] (-767.209) (-768.788) * (-767.805) (-768.673) [-770.866] (-769.074) -- 0:00:54
205000 -- (-771.877) (-771.605) (-767.843) [-768.288] * [-771.387] (-767.661) (-771.169) (-769.806) -- 0:00:54
Average standard deviation of split frequencies: 0.016153
205500 -- (-772.160) [-767.490] (-768.084) (-767.484) * [-769.178] (-768.600) (-771.987) (-771.156) -- 0:00:54
206000 -- (-770.846) (-769.610) [-768.149] (-770.578) * (-770.163) [-768.116] (-770.670) (-770.603) -- 0:00:53
206500 -- (-767.105) [-769.405] (-767.364) (-769.568) * (-770.979) (-771.281) [-768.738] (-772.140) -- 0:00:53
207000 -- (-771.123) (-769.526) [-773.127] (-768.199) * (-767.567) (-769.124) [-768.299] (-770.037) -- 0:00:53
207500 -- [-768.276] (-771.919) (-775.136) (-768.787) * [-770.425] (-767.866) (-768.966) (-773.504) -- 0:00:53
208000 -- (-768.182) (-770.036) [-768.974] (-767.423) * (-770.688) [-767.112] (-771.480) (-769.818) -- 0:00:53
208500 -- [-769.724] (-769.145) (-769.731) (-768.008) * (-767.195) (-768.049) [-772.143] (-771.429) -- 0:00:53
209000 -- (-771.598) [-770.970] (-771.162) (-769.090) * (-768.308) [-768.226] (-770.793) (-769.708) -- 0:00:52
209500 -- (-769.173) [-768.333] (-767.295) (-769.411) * (-770.781) [-769.573] (-768.418) (-768.511) -- 0:00:52
210000 -- (-768.010) (-771.828) (-767.105) [-768.866] * [-767.980] (-767.807) (-767.573) (-775.288) -- 0:00:52
Average standard deviation of split frequencies: 0.016488
210500 -- [-768.383] (-772.957) (-767.104) (-770.683) * (-769.948) (-768.045) (-771.264) [-770.744] -- 0:00:52
211000 -- (-768.383) [-768.024] (-770.513) (-767.776) * (-767.907) [-768.536] (-768.257) (-775.848) -- 0:00:52
211500 -- (-769.034) (-767.636) [-773.674] (-770.290) * (-771.557) [-772.569] (-770.912) (-770.998) -- 0:00:52
212000 -- (-769.613) [-767.128] (-769.387) (-767.474) * (-770.604) (-769.703) [-769.153] (-768.436) -- 0:00:52
212500 -- (-769.684) (-773.291) (-767.588) [-770.236] * [-769.114] (-768.614) (-771.594) (-767.599) -- 0:00:51
213000 -- [-768.341] (-769.174) (-771.340) (-769.150) * [-768.207] (-767.832) (-769.982) (-769.280) -- 0:00:51
213500 -- [-767.228] (-771.145) (-775.530) (-768.853) * (-769.224) [-770.307] (-769.989) (-767.687) -- 0:00:51
214000 -- [-767.926] (-771.470) (-774.255) (-767.576) * (-771.713) [-769.158] (-771.224) (-767.539) -- 0:00:51
214500 -- (-769.597) [-767.114] (-768.484) (-768.084) * (-769.655) (-768.611) [-769.368] (-768.322) -- 0:00:51
215000 -- (-768.708) [-770.340] (-767.287) (-767.703) * (-767.836) (-772.250) [-770.294] (-770.033) -- 0:00:51
Average standard deviation of split frequencies: 0.015932
215500 -- [-768.100] (-770.318) (-768.723) (-767.671) * [-769.002] (-769.772) (-772.306) (-769.744) -- 0:00:54
216000 -- (-771.663) [-770.176] (-768.263) (-767.311) * (-770.633) (-767.668) (-772.325) [-768.876] -- 0:00:54
216500 -- (-768.431) (-768.356) (-768.718) [-767.236] * (-767.652) (-768.541) (-770.301) [-767.826] -- 0:00:54
217000 -- (-767.429) (-770.196) (-774.417) [-766.899] * (-768.195) [-769.609] (-768.104) (-769.503) -- 0:00:54
217500 -- [-768.703] (-772.498) (-774.570) (-768.981) * [-767.185] (-768.165) (-768.737) (-767.728) -- 0:00:53
218000 -- (-769.431) (-773.627) [-768.057] (-770.352) * (-769.102) (-768.245) (-769.084) [-767.964] -- 0:00:53
218500 -- (-768.174) (-769.213) [-770.989] (-770.857) * (-770.520) [-768.157] (-771.609) (-769.063) -- 0:00:53
219000 -- (-767.177) [-768.988] (-769.999) (-768.094) * [-773.768] (-768.741) (-773.303) (-768.539) -- 0:00:53
219500 -- (-767.219) (-769.314) (-769.618) [-767.686] * (-768.693) (-769.351) (-771.282) [-767.925] -- 0:00:53
220000 -- (-772.011) (-769.165) [-771.232] (-767.334) * [-767.379] (-768.228) (-768.139) (-769.927) -- 0:00:53
Average standard deviation of split frequencies: 0.014954
220500 -- (-771.552) [-769.818] (-767.844) (-769.572) * (-769.160) (-769.932) [-767.835] (-769.157) -- 0:00:53
221000 -- (-771.131) (-770.031) [-767.403] (-769.948) * (-768.552) (-767.376) [-767.521] (-769.020) -- 0:00:52
221500 -- (-773.660) (-768.438) (-768.566) [-767.535] * (-769.471) (-771.321) (-769.238) [-767.177] -- 0:00:52
222000 -- [-768.525] (-774.755) (-767.861) (-767.957) * (-768.907) (-768.274) (-769.326) [-770.870] -- 0:00:52
222500 -- (-769.573) (-766.877) [-768.794] (-767.536) * [-769.668] (-769.356) (-773.433) (-772.280) -- 0:00:52
223000 -- (-767.383) (-766.902) (-767.753) [-767.775] * [-767.178] (-767.859) (-768.481) (-768.992) -- 0:00:52
223500 -- (-770.852) (-766.910) (-767.828) [-767.924] * (-770.373) (-768.836) [-770.985] (-768.609) -- 0:00:52
224000 -- (-769.849) [-767.364] (-769.116) (-768.299) * (-769.983) [-769.461] (-770.139) (-770.485) -- 0:00:51
224500 -- [-770.168] (-769.124) (-770.525) (-768.085) * (-769.102) (-768.910) (-768.960) [-768.829] -- 0:00:51
225000 -- (-769.296) [-768.483] (-768.025) (-769.891) * (-769.379) (-770.793) (-770.199) [-770.289] -- 0:00:51
Average standard deviation of split frequencies: 0.014717
225500 -- [-767.908] (-768.167) (-767.745) (-769.013) * (-768.126) (-770.393) (-768.280) [-769.269] -- 0:00:51
226000 -- (-770.167) [-769.089] (-767.876) (-767.853) * (-768.213) (-771.737) [-768.666] (-769.396) -- 0:00:51
226500 -- (-769.230) (-768.915) [-767.521] (-769.577) * (-768.460) (-770.120) (-768.744) [-766.919] -- 0:00:51
227000 -- (-769.607) (-768.897) [-767.878] (-769.558) * (-768.461) (-769.016) (-771.616) [-769.129] -- 0:00:51
227500 -- (-770.769) (-769.212) [-771.387] (-771.834) * [-768.283] (-771.754) (-769.010) (-768.464) -- 0:00:50
228000 -- (-770.720) (-768.405) [-770.686] (-769.088) * (-768.902) (-770.224) (-768.125) [-767.235] -- 0:00:50
228500 -- (-770.558) (-767.576) (-769.957) [-768.528] * (-770.266) (-768.692) (-769.007) [-771.291] -- 0:00:50
229000 -- (-768.088) (-767.277) (-767.836) [-768.782] * (-769.331) [-770.877] (-767.775) (-772.645) -- 0:00:50
229500 -- (-772.013) (-767.343) (-767.492) [-768.842] * (-771.756) [-769.578] (-767.253) (-769.910) -- 0:00:50
230000 -- (-769.519) [-769.773] (-771.876) (-769.611) * (-770.680) [-768.451] (-770.019) (-772.759) -- 0:00:53
Average standard deviation of split frequencies: 0.013851
230500 -- (-767.732) [-769.677] (-767.457) (-776.119) * [-768.253] (-770.390) (-769.488) (-769.556) -- 0:00:53
231000 -- (-767.653) (-769.531) (-769.971) [-769.772] * (-768.884) (-771.995) [-768.874] (-769.380) -- 0:00:53
231500 -- (-769.713) (-767.802) [-768.483] (-770.170) * (-767.949) (-772.169) [-769.388] (-768.616) -- 0:00:53
232000 -- [-767.773] (-769.999) (-767.541) (-768.633) * [-767.595] (-767.810) (-768.891) (-767.736) -- 0:00:52
232500 -- (-766.976) (-770.615) (-769.711) [-770.861] * (-767.100) (-770.242) [-767.742] (-769.423) -- 0:00:52
233000 -- (-767.625) [-773.430] (-770.377) (-770.636) * (-767.177) (-768.129) [-768.172] (-773.511) -- 0:00:52
233500 -- (-768.092) [-767.699] (-769.166) (-771.994) * [-768.492] (-769.923) (-770.863) (-769.488) -- 0:00:52
234000 -- [-767.575] (-768.064) (-769.312) (-773.549) * (-770.847) (-770.799) [-768.296] (-772.445) -- 0:00:52
234500 -- (-767.427) (-767.403) (-768.568) [-771.752] * (-768.100) (-771.551) [-768.245] (-770.064) -- 0:00:52
235000 -- (-768.094) (-769.885) (-767.913) [-768.159] * [-769.228] (-768.402) (-776.088) (-768.106) -- 0:00:52
Average standard deviation of split frequencies: 0.015203
235500 -- [-771.032] (-769.697) (-770.773) (-769.394) * (-767.275) (-769.251) (-772.662) [-770.663] -- 0:00:51
236000 -- (-772.798) [-768.335] (-772.075) (-768.955) * (-771.197) [-771.155] (-769.293) (-772.796) -- 0:00:51
236500 -- [-770.716] (-767.759) (-767.848) (-768.595) * (-771.401) (-768.832) [-770.752] (-774.210) -- 0:00:51
237000 -- [-770.872] (-768.486) (-769.940) (-769.365) * [-767.690] (-769.759) (-770.019) (-771.348) -- 0:00:51
237500 -- (-769.208) (-771.343) [-767.223] (-772.066) * [-768.474] (-768.827) (-767.890) (-769.878) -- 0:00:51
238000 -- [-768.688] (-768.474) (-768.929) (-771.639) * [-771.659] (-770.087) (-770.354) (-769.971) -- 0:00:51
238500 -- (-767.725) [-770.011] (-768.934) (-773.255) * (-768.028) (-769.032) [-768.504] (-771.376) -- 0:00:51
239000 -- (-768.149) (-769.015) [-768.892] (-769.493) * (-769.666) (-771.106) [-768.338] (-772.915) -- 0:00:50
239500 -- (-770.115) [-767.513] (-768.985) (-770.432) * (-768.601) (-769.722) (-767.413) [-770.030] -- 0:00:50
240000 -- (-767.619) (-767.490) (-768.970) [-767.949] * (-768.800) [-769.989] (-770.000) (-767.216) -- 0:00:50
Average standard deviation of split frequencies: 0.016289
240500 -- (-768.289) (-770.403) (-772.210) [-771.422] * (-769.224) (-773.128) (-770.919) [-767.576] -- 0:00:50
241000 -- (-770.573) (-770.207) [-767.857] (-770.580) * (-769.621) (-770.593) [-769.256] (-767.358) -- 0:00:50
241500 -- (-771.595) (-772.576) (-768.041) [-770.313] * (-769.002) (-768.359) [-771.251] (-768.411) -- 0:00:50
242000 -- (-767.878) (-767.703) [-767.754] (-768.669) * (-769.515) (-768.947) (-770.966) [-772.828] -- 0:00:50
242500 -- (-771.707) (-768.585) [-768.411] (-772.148) * (-774.735) (-769.239) [-767.769] (-769.518) -- 0:00:49
243000 -- [-770.633] (-775.336) (-776.141) (-769.545) * (-770.338) [-769.222] (-772.976) (-769.105) -- 0:00:49
243500 -- [-768.119] (-774.807) (-769.208) (-770.516) * (-769.532) [-769.046] (-768.917) (-769.548) -- 0:00:49
244000 -- (-771.161) (-769.203) (-769.454) [-773.780] * (-768.569) (-776.725) (-767.662) [-768.934] -- 0:00:52
244500 -- (-770.974) [-769.169] (-768.814) (-774.390) * [-769.856] (-771.389) (-770.641) (-770.187) -- 0:00:52
245000 -- (-770.388) (-767.154) [-768.805] (-771.537) * (-769.986) (-771.406) [-767.502] (-768.406) -- 0:00:52
Average standard deviation of split frequencies: 0.015969
245500 -- (-767.607) (-767.069) [-769.379] (-773.315) * (-770.401) (-770.611) (-768.769) [-767.824] -- 0:00:52
246000 -- [-768.631] (-769.061) (-771.242) (-768.613) * (-772.833) [-768.886] (-769.337) (-767.090) -- 0:00:52
246500 -- (-773.206) (-769.062) (-772.631) [-769.211] * (-770.969) (-770.927) (-767.026) [-768.062] -- 0:00:51
247000 -- (-771.978) (-768.052) [-768.883] (-769.831) * [-771.016] (-768.733) (-772.884) (-768.458) -- 0:00:51
247500 -- (-775.864) [-767.583] (-772.083) (-769.146) * [-769.706] (-771.427) (-773.138) (-769.315) -- 0:00:51
248000 -- [-771.027] (-767.598) (-773.333) (-767.770) * (-771.157) (-770.131) (-769.559) [-767.887] -- 0:00:51
248500 -- (-771.253) [-769.401] (-770.175) (-768.644) * (-769.258) (-769.549) [-770.286] (-771.644) -- 0:00:51
249000 -- (-770.231) (-768.128) (-767.902) [-771.359] * [-769.480] (-770.362) (-772.348) (-772.279) -- 0:00:51
249500 -- (-770.475) (-772.495) (-768.527) [-767.514] * [-773.267] (-769.493) (-773.189) (-780.619) -- 0:00:51
250000 -- [-769.862] (-770.955) (-767.718) (-770.288) * (-771.293) (-777.672) (-767.755) [-769.192] -- 0:00:51
Average standard deviation of split frequencies: 0.015254
250500 -- (-767.652) [-769.691] (-769.014) (-770.818) * (-768.443) (-772.173) [-768.447] (-769.647) -- 0:00:50
251000 -- (-769.504) (-769.298) [-770.793] (-774.045) * (-769.434) (-768.223) (-768.257) [-769.680] -- 0:00:50
251500 -- [-768.679] (-768.423) (-773.235) (-771.642) * [-769.626] (-769.480) (-776.281) (-768.105) -- 0:00:50
252000 -- (-768.765) [-769.321] (-773.698) (-771.793) * (-773.600) (-771.013) (-771.608) [-767.645] -- 0:00:50
252500 -- [-768.361] (-770.814) (-768.232) (-773.181) * (-771.768) [-768.889] (-767.780) (-767.978) -- 0:00:50
253000 -- [-767.103] (-770.352) (-768.304) (-770.474) * (-770.036) [-770.044] (-768.578) (-768.818) -- 0:00:50
253500 -- (-769.462) (-769.983) (-768.547) [-768.893] * (-768.500) (-769.840) [-772.508] (-772.709) -- 0:00:50
254000 -- (-768.636) (-770.205) (-769.426) [-769.618] * [-768.883] (-769.473) (-772.968) (-768.023) -- 0:00:49
254500 -- [-770.964] (-770.632) (-769.039) (-769.364) * (-772.645) [-771.183] (-771.707) (-766.980) -- 0:00:49
255000 -- (-770.998) (-768.136) (-769.326) [-767.959] * (-771.153) (-769.552) [-769.911] (-769.219) -- 0:00:49
Average standard deviation of split frequencies: 0.013299
255500 -- (-767.698) [-769.139] (-771.330) (-773.538) * (-771.669) (-769.095) [-771.198] (-772.695) -- 0:00:49
256000 -- (-769.410) (-768.101) [-769.341] (-771.017) * [-767.600] (-768.159) (-771.850) (-771.969) -- 0:00:49
256500 -- (-769.411) (-767.564) (-770.599) [-770.200] * (-768.381) (-769.195) [-770.361] (-769.832) -- 0:00:49
257000 -- (-771.076) (-770.030) [-771.421] (-773.957) * (-768.662) (-769.441) (-768.931) [-768.229] -- 0:00:49
257500 -- [-768.910] (-768.163) (-769.206) (-769.049) * [-769.313] (-768.738) (-769.059) (-767.491) -- 0:00:49
258000 -- (-768.672) (-768.518) (-767.579) [-771.924] * (-768.701) (-768.551) [-769.554] (-767.902) -- 0:00:48
258500 -- (-768.211) (-777.989) [-768.348] (-770.610) * (-768.022) [-768.311] (-768.854) (-769.097) -- 0:00:51
259000 -- (-768.968) [-772.667] (-770.915) (-771.078) * (-768.380) (-767.278) [-769.701] (-770.041) -- 0:00:51
259500 -- (-769.690) [-768.211] (-768.409) (-771.656) * (-771.049) (-768.535) [-768.285] (-772.174) -- 0:00:51
260000 -- (-770.757) [-769.931] (-767.396) (-767.861) * (-772.928) [-769.300] (-768.962) (-772.418) -- 0:00:51
Average standard deviation of split frequencies: 0.014367
260500 -- (-768.111) (-773.804) [-769.035] (-768.673) * (-769.920) (-770.720) (-767.794) [-768.108] -- 0:00:51
261000 -- (-772.064) (-770.234) [-767.219] (-769.337) * [-769.770] (-769.346) (-771.416) (-766.920) -- 0:00:50
261500 -- (-769.443) (-768.507) (-767.658) [-770.407] * (-768.180) (-768.233) [-769.441] (-768.119) -- 0:00:50
262000 -- (-772.091) (-770.549) [-770.734] (-771.018) * (-770.306) (-767.518) [-769.148] (-768.740) -- 0:00:50
262500 -- (-770.310) (-773.879) (-769.581) [-769.638] * (-771.799) [-767.090] (-772.291) (-767.234) -- 0:00:50
263000 -- [-770.952] (-774.514) (-768.564) (-771.873) * [-771.342] (-769.058) (-772.308) (-768.620) -- 0:00:50
263500 -- (-769.623) (-769.425) [-768.024] (-770.143) * (-770.414) [-769.724] (-771.293) (-769.314) -- 0:00:50
264000 -- (-768.136) [-770.892] (-770.605) (-768.684) * (-767.821) [-767.372] (-771.496) (-769.847) -- 0:00:50
264500 -- (-767.678) (-767.972) (-776.424) [-768.920] * (-767.906) [-767.477] (-770.896) (-769.265) -- 0:00:50
265000 -- (-770.823) (-768.355) (-773.146) [-776.680] * (-769.099) (-769.464) (-775.158) [-772.099] -- 0:00:49
Average standard deviation of split frequencies: 0.014276
265500 -- [-769.844] (-768.771) (-768.545) (-767.649) * (-768.157) (-771.937) (-773.276) [-768.848] -- 0:00:49
266000 -- (-770.535) (-770.073) [-768.335] (-769.001) * [-768.381] (-771.456) (-770.904) (-769.194) -- 0:00:49
266500 -- (-767.784) (-768.718) (-768.230) [-769.622] * (-768.336) [-770.633] (-768.106) (-767.735) -- 0:00:49
267000 -- (-769.000) (-770.633) [-770.700] (-770.835) * (-769.860) [-768.810] (-769.155) (-770.637) -- 0:00:49
267500 -- [-768.066] (-768.111) (-768.973) (-770.794) * [-767.971] (-767.810) (-768.854) (-771.502) -- 0:00:49
268000 -- (-769.046) (-767.258) [-768.039] (-768.928) * (-767.956) (-769.177) (-767.685) [-767.737] -- 0:00:49
268500 -- (-769.051) (-767.102) [-770.216] (-768.139) * (-769.451) [-769.123] (-767.569) (-773.016) -- 0:00:49
269000 -- (-772.260) (-768.775) [-767.982] (-767.756) * (-771.419) [-768.487] (-767.850) (-769.455) -- 0:00:48
269500 -- (-770.997) [-769.924] (-770.807) (-767.225) * (-771.750) (-770.900) [-768.305] (-769.543) -- 0:00:48
270000 -- (-770.293) (-767.078) [-774.624] (-769.860) * (-772.731) (-771.995) [-767.188] (-768.264) -- 0:00:48
Average standard deviation of split frequencies: 0.015675
270500 -- (-770.809) [-768.244] (-771.582) (-768.055) * [-771.227] (-774.099) (-767.835) (-768.602) -- 0:00:48
271000 -- [-767.774] (-768.114) (-769.244) (-770.472) * (-771.290) (-768.447) [-768.337] (-767.094) -- 0:00:48
271500 -- (-767.533) [-769.453] (-767.821) (-769.806) * (-769.761) (-770.115) (-768.885) [-767.372] -- 0:00:48
272000 -- (-770.422) (-769.990) [-768.515] (-771.123) * (-769.497) (-771.210) (-768.433) [-768.719] -- 0:00:48
272500 -- [-768.081] (-767.769) (-774.761) (-771.158) * (-768.480) [-771.814] (-771.196) (-770.122) -- 0:00:48
273000 -- [-770.039] (-768.672) (-769.954) (-775.974) * (-767.817) [-772.705] (-771.306) (-768.702) -- 0:00:47
273500 -- [-771.256] (-768.073) (-767.965) (-771.592) * [-769.193] (-772.044) (-770.089) (-769.896) -- 0:00:47
274000 -- (-770.157) [-768.234] (-767.383) (-774.201) * (-770.156) (-771.379) (-768.861) [-770.626] -- 0:00:50
274500 -- (-767.739) (-769.009) (-767.996) [-771.559] * (-772.103) (-767.558) [-768.470] (-771.227) -- 0:00:50
275000 -- (-768.235) [-767.960] (-768.123) (-770.526) * (-778.516) [-769.289] (-767.383) (-769.793) -- 0:00:50
Average standard deviation of split frequencies: 0.015573
275500 -- [-768.663] (-767.378) (-769.121) (-769.906) * (-770.366) [-768.958] (-771.506) (-770.662) -- 0:00:49
276000 -- (-768.364) (-769.526) (-769.138) [-771.620] * [-769.811] (-775.244) (-769.040) (-770.748) -- 0:00:49
276500 -- (-769.359) [-769.048] (-767.546) (-771.830) * (-770.830) [-770.426] (-766.902) (-768.698) -- 0:00:49
277000 -- (-769.205) (-771.640) (-767.553) [-769.251] * [-768.936] (-770.438) (-767.751) (-769.889) -- 0:00:49
277500 -- (-769.009) [-768.467] (-767.327) (-771.989) * (-770.200) [-771.757] (-768.099) (-768.419) -- 0:00:49
278000 -- (-767.793) (-768.541) [-768.010] (-769.695) * (-770.335) (-773.391) (-767.299) [-773.425] -- 0:00:49
278500 -- (-771.647) (-770.885) (-768.433) [-768.422] * (-769.406) [-768.915] (-769.368) (-773.579) -- 0:00:49
279000 -- (-770.550) (-767.581) (-768.929) [-768.421] * (-770.877) [-767.287] (-769.455) (-768.191) -- 0:00:49
279500 -- (-768.080) [-769.972] (-768.979) (-768.878) * (-768.618) (-772.288) (-769.998) [-768.942] -- 0:00:48
280000 -- (-770.877) (-768.748) (-769.081) [-769.542] * (-768.947) [-770.058] (-769.852) (-769.198) -- 0:00:48
Average standard deviation of split frequencies: 0.014721
280500 -- [-768.646] (-768.443) (-768.561) (-767.612) * (-769.539) [-768.989] (-766.974) (-775.637) -- 0:00:48
281000 -- (-768.990) (-768.214) [-769.633] (-767.612) * (-772.653) [-768.145] (-767.673) (-770.710) -- 0:00:48
281500 -- (-772.358) (-771.544) [-769.075] (-769.319) * [-769.150] (-770.089) (-768.235) (-768.911) -- 0:00:48
282000 -- [-771.880] (-767.222) (-769.945) (-768.688) * (-768.433) [-768.219] (-767.489) (-772.806) -- 0:00:48
282500 -- [-768.760] (-767.325) (-769.630) (-769.312) * [-770.367] (-769.315) (-768.648) (-774.838) -- 0:00:48
283000 -- (-774.089) [-767.476] (-768.071) (-774.041) * [-771.030] (-768.310) (-767.433) (-767.997) -- 0:00:48
283500 -- (-767.797) [-767.971] (-768.641) (-770.767) * [-770.953] (-767.569) (-767.790) (-767.309) -- 0:00:48
284000 -- (-771.824) (-769.141) [-769.416] (-768.477) * (-771.575) (-771.297) (-768.638) [-767.425] -- 0:00:47
284500 -- (-770.569) (-768.245) (-770.201) [-771.413] * (-771.931) [-768.696] (-767.775) (-768.392) -- 0:00:47
285000 -- [-770.020] (-769.090) (-770.639) (-769.851) * (-768.908) (-768.029) [-767.558] (-771.404) -- 0:00:47
Average standard deviation of split frequencies: 0.014731
285500 -- (-771.321) (-771.301) (-771.808) [-769.572] * (-775.679) [-767.651] (-769.198) (-768.606) -- 0:00:47
286000 -- (-768.706) (-767.774) [-771.606] (-768.826) * (-768.664) (-767.823) [-767.499] (-770.563) -- 0:00:47
286500 -- (-767.682) (-768.101) [-768.472] (-769.974) * (-769.929) (-771.154) [-767.422] (-768.851) -- 0:00:47
287000 -- (-771.539) [-768.302] (-770.393) (-768.379) * (-771.460) (-770.462) (-768.382) [-767.280] -- 0:00:47
287500 -- [-769.728] (-767.287) (-771.215) (-768.549) * (-769.680) (-771.016) [-771.976] (-767.371) -- 0:00:47
288000 -- (-768.809) [-766.846] (-769.675) (-770.985) * [-767.000] (-769.292) (-769.651) (-769.246) -- 0:00:46
288500 -- (-771.233) [-767.466] (-769.799) (-769.712) * (-766.981) [-767.925] (-768.111) (-770.823) -- 0:00:46
289000 -- (-770.493) [-768.153] (-772.514) (-768.413) * [-768.935] (-770.717) (-767.269) (-769.442) -- 0:00:46
289500 -- [-768.154] (-768.851) (-773.032) (-770.161) * [-772.260] (-769.165) (-767.457) (-768.497) -- 0:00:49
290000 -- (-776.387) (-772.096) (-778.021) [-774.241] * (-770.230) (-768.139) (-770.481) [-768.453] -- 0:00:48
Average standard deviation of split frequencies: 0.015359
290500 -- [-771.161] (-773.468) (-771.616) (-769.830) * [-770.092] (-769.855) (-770.027) (-769.741) -- 0:00:48
291000 -- (-769.453) (-771.357) (-770.189) [-770.379] * (-770.358) (-771.418) (-769.462) [-767.212] -- 0:00:48
291500 -- (-771.751) (-770.767) [-768.895] (-770.279) * (-767.886) (-772.388) [-769.405] (-768.287) -- 0:00:48
292000 -- (-773.268) [-768.986] (-769.892) (-770.019) * (-768.615) (-770.699) (-769.882) [-769.494] -- 0:00:48
292500 -- (-768.991) (-769.784) (-768.005) [-769.466] * (-769.203) (-770.750) [-771.158] (-768.521) -- 0:00:48
293000 -- (-771.517) [-769.728] (-767.654) (-770.085) * (-769.862) (-769.352) [-770.149] (-768.658) -- 0:00:48
293500 -- (-769.235) (-767.507) [-769.014] (-767.602) * [-768.413] (-772.385) (-773.646) (-767.883) -- 0:00:48
294000 -- [-770.061] (-768.862) (-770.152) (-767.924) * (-773.962) (-776.595) (-770.133) [-771.150] -- 0:00:48
294500 -- (-768.381) (-768.679) (-768.895) [-769.600] * (-769.302) (-770.343) [-769.135] (-770.943) -- 0:00:47
295000 -- (-768.513) (-770.822) [-770.305] (-769.051) * [-768.066] (-768.072) (-770.101) (-770.973) -- 0:00:47
Average standard deviation of split frequencies: 0.014776
295500 -- [-767.150] (-767.849) (-768.861) (-769.179) * [-770.766] (-770.338) (-768.918) (-769.395) -- 0:00:47
296000 -- (-768.463) (-767.026) [-769.554] (-769.706) * (-770.379) (-774.841) [-769.750] (-773.094) -- 0:00:47
296500 -- (-768.944) [-770.195] (-771.370) (-768.895) * [-768.739] (-770.759) (-768.313) (-772.564) -- 0:00:47
297000 -- [-769.332] (-767.771) (-770.848) (-767.965) * (-767.655) (-769.439) [-767.419] (-770.019) -- 0:00:47
297500 -- (-768.627) (-771.011) [-770.216] (-769.900) * [-768.260] (-767.833) (-768.141) (-767.831) -- 0:00:47
298000 -- (-768.175) (-768.006) [-768.652] (-767.940) * (-769.681) [-767.305] (-769.785) (-770.035) -- 0:00:47
298500 -- (-767.782) [-768.630] (-772.519) (-770.012) * [-768.893] (-774.660) (-771.830) (-770.027) -- 0:00:47
299000 -- [-767.858] (-767.721) (-770.778) (-767.854) * (-768.580) (-769.218) (-769.742) [-773.261] -- 0:00:46
299500 -- (-768.267) [-770.766] (-770.269) (-768.581) * [-770.749] (-768.628) (-767.800) (-771.099) -- 0:00:46
300000 -- [-769.357] (-767.695) (-768.282) (-771.236) * (-768.593) [-767.631] (-767.548) (-770.419) -- 0:00:46
Average standard deviation of split frequencies: 0.014664
300500 -- (-768.242) (-770.083) [-769.944] (-767.674) * [-768.260] (-770.418) (-768.766) (-768.810) -- 0:00:46
301000 -- (-767.487) (-769.023) [-768.773] (-767.702) * (-771.638) (-769.806) [-768.838] (-768.012) -- 0:00:46
301500 -- (-768.446) (-770.573) (-769.201) [-767.773] * (-768.660) [-768.772] (-767.421) (-770.529) -- 0:00:46
302000 -- [-769.117] (-769.332) (-768.623) (-767.835) * (-768.962) (-771.315) [-769.373] (-772.459) -- 0:00:46
302500 -- (-769.038) [-769.006] (-769.010) (-768.324) * (-768.249) (-770.552) [-769.567] (-768.668) -- 0:00:46
303000 -- [-770.540] (-769.026) (-770.006) (-768.211) * (-768.520) (-770.990) (-767.683) [-770.867] -- 0:00:46
303500 -- (-769.741) [-767.830] (-768.266) (-767.642) * (-772.961) [-770.335] (-768.011) (-768.696) -- 0:00:45
304000 -- (-772.396) (-768.778) [-767.812] (-772.332) * (-767.691) (-768.927) (-769.719) [-770.602] -- 0:00:45
304500 -- (-769.940) [-767.556] (-768.652) (-768.937) * (-770.146) (-768.101) (-771.064) [-768.075] -- 0:00:47
305000 -- (-774.135) (-768.361) (-768.521) [-767.661] * (-770.208) [-767.995] (-768.098) (-770.393) -- 0:00:47
Average standard deviation of split frequencies: 0.016135
305500 -- (-769.097) [-769.020] (-767.566) (-769.744) * (-768.328) [-768.879] (-768.644) (-768.136) -- 0:00:47
306000 -- [-769.318] (-769.386) (-769.922) (-772.902) * (-767.987) [-769.886] (-768.195) (-770.960) -- 0:00:47
306500 -- (-770.648) (-767.638) [-770.884] (-770.904) * (-770.609) [-767.471] (-776.113) (-769.288) -- 0:00:47
307000 -- (-767.575) [-768.080] (-771.900) (-768.445) * (-767.820) (-767.495) [-768.344] (-769.770) -- 0:00:47
307500 -- [-768.991] (-773.430) (-774.587) (-768.537) * [-769.470] (-768.246) (-769.164) (-768.050) -- 0:00:47
308000 -- (-767.848) (-772.220) (-769.390) [-768.885] * (-770.633) [-767.778] (-768.796) (-775.606) -- 0:00:47
308500 -- [-768.011] (-769.502) (-767.527) (-768.388) * (-769.224) (-768.423) [-767.221] (-770.883) -- 0:00:47
309000 -- (-768.590) [-769.326] (-768.130) (-768.337) * [-767.409] (-768.209) (-767.666) (-768.285) -- 0:00:46
309500 -- [-767.999] (-773.679) (-768.280) (-768.130) * (-767.110) (-769.667) [-767.192] (-769.571) -- 0:00:46
310000 -- [-768.947] (-768.397) (-770.089) (-770.797) * (-767.115) (-771.022) (-769.321) [-769.464] -- 0:00:46
Average standard deviation of split frequencies: 0.016532
310500 -- (-768.354) (-768.888) [-769.403] (-769.242) * (-771.020) (-771.227) (-770.062) [-769.392] -- 0:00:46
311000 -- [-768.426] (-769.049) (-769.174) (-771.441) * (-768.049) [-769.574] (-772.058) (-768.860) -- 0:00:46
311500 -- [-768.748] (-771.929) (-767.974) (-768.224) * (-768.055) (-769.667) (-768.047) [-769.682] -- 0:00:46
312000 -- (-768.743) [-769.121] (-767.899) (-768.564) * [-768.410] (-769.250) (-768.189) (-769.492) -- 0:00:46
312500 -- [-769.938] (-772.844) (-767.905) (-768.864) * (-771.249) (-767.720) (-768.063) [-768.343] -- 0:00:46
313000 -- [-770.020] (-768.889) (-769.053) (-769.324) * (-769.489) (-767.615) (-767.943) [-769.567] -- 0:00:46
313500 -- (-770.000) [-773.046] (-769.963) (-768.470) * (-769.377) (-768.887) [-770.419] (-768.685) -- 0:00:45
314000 -- (-768.986) (-768.715) (-773.520) [-767.290] * (-770.422) (-773.247) (-768.630) [-767.626] -- 0:00:45
314500 -- [-768.932] (-768.580) (-770.314) (-767.512) * [-768.115] (-772.280) (-768.700) (-768.430) -- 0:00:45
315000 -- [-767.158] (-768.993) (-767.896) (-770.064) * [-768.320] (-776.404) (-769.512) (-768.437) -- 0:00:45
Average standard deviation of split frequencies: 0.017587
315500 -- (-769.938) (-771.329) [-769.196] (-769.116) * (-768.595) (-771.298) [-768.986] (-769.912) -- 0:00:45
316000 -- (-768.948) (-772.509) [-773.554] (-768.558) * (-767.942) (-772.867) [-769.864] (-769.402) -- 0:00:45
316500 -- [-768.894] (-767.892) (-771.799) (-770.192) * (-767.246) (-770.312) [-769.249] (-768.465) -- 0:00:45
317000 -- (-767.988) [-768.846] (-769.335) (-769.146) * (-768.069) [-769.302] (-769.623) (-770.819) -- 0:00:45
317500 -- (-769.735) (-775.762) (-767.861) [-769.972] * (-767.836) (-767.727) (-768.908) [-770.938] -- 0:00:45
318000 -- [-767.544] (-768.036) (-767.627) (-767.590) * [-768.796] (-768.755) (-770.195) (-783.643) -- 0:00:45
318500 -- [-768.009] (-770.734) (-767.627) (-768.821) * (-770.860) [-770.339] (-768.774) (-776.554) -- 0:00:44
319000 -- [-772.047] (-769.251) (-772.242) (-772.251) * (-768.864) (-770.450) [-769.013] (-770.920) -- 0:00:46
319500 -- [-770.332] (-769.873) (-772.718) (-771.521) * (-768.478) [-767.927] (-769.275) (-769.267) -- 0:00:46
320000 -- [-772.058] (-769.276) (-769.143) (-768.663) * (-768.039) (-768.232) (-768.653) [-768.964] -- 0:00:46
Average standard deviation of split frequencies: 0.018784
320500 -- (-771.356) (-768.993) [-769.526] (-767.945) * (-768.038) (-769.786) [-770.334] (-768.983) -- 0:00:46
321000 -- (-768.731) (-768.622) (-767.146) [-768.934] * (-768.489) [-769.161] (-773.114) (-769.471) -- 0:00:46
321500 -- (-767.957) (-767.835) [-767.002] (-770.739) * (-768.113) (-768.409) [-767.880] (-769.619) -- 0:00:46
322000 -- (-768.186) [-768.202] (-767.388) (-768.317) * (-769.677) (-772.404) (-767.781) [-767.361] -- 0:00:46
322500 -- (-767.548) [-769.024] (-769.770) (-769.174) * (-770.171) (-770.403) [-769.496] (-767.361) -- 0:00:46
323000 -- (-768.104) [-768.020] (-767.388) (-770.339) * (-772.463) [-770.099] (-772.075) (-772.076) -- 0:00:46
323500 -- (-768.243) [-768.477] (-768.107) (-769.781) * [-768.807] (-771.265) (-772.125) (-769.358) -- 0:00:46
324000 -- (-771.239) (-768.871) (-769.108) [-770.432] * (-769.567) (-767.364) [-770.410] (-769.864) -- 0:00:45
324500 -- [-767.544] (-769.793) (-768.064) (-769.828) * (-769.792) (-769.348) [-767.263] (-770.900) -- 0:00:45
325000 -- (-769.024) [-770.473] (-774.689) (-769.400) * (-773.405) [-767.378] (-767.214) (-769.947) -- 0:00:45
Average standard deviation of split frequencies: 0.018113
325500 -- (-768.633) (-769.670) [-773.386] (-768.296) * (-770.405) [-768.124] (-768.686) (-768.214) -- 0:00:45
326000 -- (-769.195) [-769.002] (-767.395) (-769.792) * (-768.813) (-768.663) [-767.829] (-769.978) -- 0:00:45
326500 -- (-772.630) (-773.234) (-767.408) [-768.408] * (-768.309) (-767.553) (-771.081) [-768.612] -- 0:00:45
327000 -- (-768.610) (-771.724) [-774.941] (-767.438) * [-767.657] (-771.967) (-769.521) (-767.995) -- 0:00:45
327500 -- [-767.263] (-770.339) (-767.644) (-770.896) * (-769.110) (-767.978) (-767.598) [-767.479] -- 0:00:45
328000 -- (-768.813) (-771.131) [-767.342] (-770.911) * [-770.188] (-768.137) (-767.109) (-768.338) -- 0:00:45
328500 -- (-768.068) (-770.674) [-769.856] (-773.294) * [-769.905] (-769.309) (-769.103) (-768.543) -- 0:00:44
329000 -- (-770.476) (-768.526) (-770.789) [-770.305] * (-769.574) (-767.757) [-767.377] (-768.706) -- 0:00:44
329500 -- (-773.532) (-768.777) [-770.278] (-771.731) * (-770.480) (-770.881) [-769.163] (-767.556) -- 0:00:44
330000 -- (-770.552) [-774.588] (-773.254) (-767.822) * (-771.455) (-769.079) [-771.380] (-769.740) -- 0:00:44
Average standard deviation of split frequencies: 0.017708
330500 -- (-775.362) (-768.553) (-770.716) [-767.502] * (-767.960) (-770.228) [-770.624] (-768.673) -- 0:00:44
331000 -- (-771.379) (-768.096) [-769.615] (-770.479) * [-768.766] (-771.562) (-768.300) (-769.994) -- 0:00:44
331500 -- (-772.950) (-768.514) [-769.247] (-770.726) * (-771.156) (-769.323) [-770.389] (-768.286) -- 0:00:44
332000 -- (-768.509) (-768.582) (-768.742) [-771.237] * (-772.650) [-769.800] (-768.473) (-772.489) -- 0:00:44
332500 -- (-769.093) (-769.298) (-769.101) [-770.188] * (-769.018) (-772.153) (-769.056) [-770.397] -- 0:00:44
333000 -- [-769.443] (-772.001) (-769.159) (-772.808) * (-767.253) (-770.033) (-769.240) [-769.023] -- 0:00:44
333500 -- (-770.454) (-769.835) [-769.350] (-771.106) * (-768.419) (-768.869) (-768.107) [-767.314] -- 0:00:43
334000 -- (-770.760) [-771.700] (-768.910) (-770.346) * (-768.851) [-770.855] (-770.272) (-771.285) -- 0:00:43
334500 -- [-768.949] (-771.758) (-770.211) (-769.507) * [-772.245] (-767.947) (-772.456) (-770.367) -- 0:00:45
335000 -- (-773.830) (-771.160) (-771.074) [-767.909] * [-769.848] (-767.892) (-768.187) (-769.204) -- 0:00:45
Average standard deviation of split frequencies: 0.017796
335500 -- (-769.525) [-769.953] (-771.136) (-775.182) * (-770.954) (-768.140) [-771.968] (-773.922) -- 0:00:45
336000 -- (-770.216) (-769.875) (-769.411) [-772.810] * (-769.820) (-771.975) (-768.943) [-767.825] -- 0:00:45
336500 -- (-770.109) (-769.974) [-768.933] (-767.454) * (-768.263) (-768.954) (-770.343) [-767.825] -- 0:00:45
337000 -- (-769.569) (-768.715) (-772.063) [-769.542] * (-768.316) (-770.359) [-769.606] (-767.872) -- 0:00:45
337500 -- (-767.616) (-769.694) [-769.608] (-769.751) * [-769.848] (-769.923) (-769.230) (-768.961) -- 0:00:45
338000 -- (-770.919) (-771.899) (-769.739) [-769.323] * (-769.435) [-771.551] (-767.658) (-768.035) -- 0:00:45
338500 -- (-776.083) [-768.467] (-771.951) (-772.621) * (-768.591) (-770.603) (-768.000) [-769.641] -- 0:00:44
339000 -- (-771.270) [-768.538] (-769.530) (-770.541) * (-772.082) [-768.869] (-767.615) (-768.608) -- 0:00:44
339500 -- (-768.378) (-767.766) [-768.776] (-768.583) * (-768.987) [-768.755] (-768.627) (-769.717) -- 0:00:44
340000 -- (-770.275) (-768.282) [-768.954] (-768.897) * (-766.934) (-768.847) (-769.100) [-772.153] -- 0:00:44
Average standard deviation of split frequencies: 0.016759
340500 -- (-771.579) (-766.953) [-769.238] (-767.731) * [-769.158] (-771.740) (-768.276) (-770.245) -- 0:00:44
341000 -- (-769.221) (-769.794) [-769.357] (-768.778) * (-770.483) [-768.797] (-770.022) (-768.247) -- 0:00:44
341500 -- (-769.089) [-769.180] (-770.732) (-768.289) * (-768.126) [-770.687] (-769.942) (-769.404) -- 0:00:44
342000 -- (-767.254) (-769.536) (-769.605) [-769.281] * (-771.248) (-771.174) (-769.990) [-769.558] -- 0:00:44
342500 -- (-769.342) (-768.322) [-768.807] (-768.258) * [-768.684] (-767.787) (-770.411) (-767.509) -- 0:00:44
343000 -- (-770.995) (-768.725) (-769.217) [-767.572] * (-768.179) (-770.054) [-771.779] (-770.971) -- 0:00:44
343500 -- [-768.480] (-771.237) (-768.243) (-768.475) * [-771.215] (-768.141) (-772.080) (-775.194) -- 0:00:43
344000 -- [-768.670] (-767.545) (-768.192) (-768.898) * [-768.736] (-768.135) (-770.481) (-774.790) -- 0:00:43
344500 -- (-767.258) (-767.290) (-769.661) [-767.344] * (-767.418) (-768.217) [-772.020] (-771.397) -- 0:00:43
345000 -- (-767.671) (-768.228) [-768.151] (-767.392) * [-767.860] (-769.789) (-770.378) (-770.792) -- 0:00:43
Average standard deviation of split frequencies: 0.017409
345500 -- (-769.195) (-769.619) (-769.198) [-768.590] * [-768.152] (-770.073) (-771.112) (-768.419) -- 0:00:43
346000 -- [-771.353] (-769.918) (-771.439) (-767.652) * [-768.715] (-769.755) (-768.623) (-770.406) -- 0:00:43
346500 -- (-770.299) [-770.048] (-767.551) (-768.482) * (-767.668) (-769.407) (-768.708) [-772.267] -- 0:00:43
347000 -- [-769.096] (-767.459) (-772.016) (-767.817) * (-767.090) (-772.706) [-768.586] (-769.368) -- 0:00:43
347500 -- (-767.292) (-768.510) (-772.067) [-770.684] * (-767.889) (-771.063) (-769.792) [-767.926] -- 0:00:43
348000 -- [-769.238] (-769.577) (-775.167) (-769.619) * (-767.304) [-768.703] (-770.123) (-771.662) -- 0:00:43
348500 -- [-773.021] (-769.654) (-767.754) (-768.305) * (-769.568) [-768.293] (-772.972) (-768.519) -- 0:00:42
349000 -- (-769.436) (-769.481) [-767.314] (-768.361) * (-770.700) (-768.635) (-769.554) [-769.350] -- 0:00:42
349500 -- [-771.192] (-770.003) (-767.507) (-770.160) * (-772.839) [-770.686] (-770.924) (-772.630) -- 0:00:42
350000 -- (-769.001) [-768.479] (-767.193) (-769.940) * (-769.975) [-769.156] (-772.251) (-774.790) -- 0:00:44
Average standard deviation of split frequencies: 0.017901
350500 -- (-773.272) (-769.270) [-767.685] (-771.075) * [-768.473] (-772.481) (-770.605) (-768.935) -- 0:00:44
351000 -- [-770.773] (-770.617) (-770.123) (-771.409) * (-769.983) (-774.671) [-770.363] (-767.219) -- 0:00:44
351500 -- [-769.236] (-769.214) (-768.544) (-771.273) * (-767.589) (-770.459) (-768.768) [-769.202] -- 0:00:44
352000 -- (-770.058) (-766.960) [-768.501] (-768.732) * (-769.411) [-767.719] (-767.087) (-767.905) -- 0:00:44
352500 -- (-770.465) (-769.613) [-769.525] (-768.467) * (-769.421) (-768.375) (-768.389) [-768.882] -- 0:00:44
353000 -- (-768.179) [-769.126] (-768.989) (-769.871) * (-769.171) (-769.963) (-771.278) [-769.083] -- 0:00:43
353500 -- (-770.326) (-768.946) [-770.094] (-770.511) * (-768.479) (-770.140) [-768.361] (-767.894) -- 0:00:43
354000 -- (-770.387) (-767.675) [-772.453] (-767.976) * (-773.055) [-769.671] (-769.125) (-768.133) -- 0:00:43
354500 -- (-770.389) [-768.258] (-771.336) (-769.972) * (-769.045) (-770.332) [-768.426] (-769.001) -- 0:00:43
355000 -- (-767.421) (-769.000) [-770.438] (-769.505) * (-767.601) (-771.368) [-769.609] (-770.259) -- 0:00:43
Average standard deviation of split frequencies: 0.017656
355500 -- [-768.535] (-770.759) (-771.148) (-770.414) * (-767.409) [-769.956] (-769.575) (-768.095) -- 0:00:43
356000 -- (-767.964) (-770.329) (-770.526) [-768.453] * (-772.160) [-771.082] (-773.119) (-768.947) -- 0:00:43
356500 -- (-769.778) [-772.203] (-769.429) (-773.728) * (-768.919) (-767.546) [-768.983] (-767.977) -- 0:00:43
357000 -- [-772.087] (-769.391) (-771.791) (-769.986) * (-768.961) (-768.322) [-768.376] (-770.984) -- 0:00:43
357500 -- (-772.420) (-768.990) [-770.194] (-767.926) * [-768.215] (-769.815) (-767.532) (-768.977) -- 0:00:43
358000 -- (-772.539) [-769.516] (-770.416) (-769.320) * [-769.146] (-769.013) (-767.732) (-771.580) -- 0:00:43
358500 -- [-770.659] (-767.901) (-770.003) (-768.548) * (-770.771) (-768.453) (-769.593) [-769.052] -- 0:00:42
359000 -- (-770.191) (-768.657) (-772.356) [-768.542] * (-772.134) [-768.250] (-773.502) (-779.975) -- 0:00:42
359500 -- (-769.908) [-769.324] (-769.564) (-769.485) * (-772.844) [-768.793] (-773.045) (-773.225) -- 0:00:42
360000 -- [-767.339] (-770.403) (-767.342) (-769.109) * (-778.291) (-767.049) [-766.930] (-770.158) -- 0:00:42
Average standard deviation of split frequencies: 0.017718
360500 -- (-770.952) (-775.070) [-769.265] (-769.026) * (-772.344) [-767.291] (-770.189) (-769.197) -- 0:00:42
361000 -- (-770.549) (-767.656) (-769.925) [-769.893] * (-770.433) [-769.002] (-768.634) (-771.137) -- 0:00:42
361500 -- (-768.986) [-768.717] (-772.453) (-770.061) * (-768.541) (-767.277) (-768.490) [-768.637] -- 0:00:42
362000 -- (-769.101) (-767.377) (-771.454) [-769.014] * (-770.174) [-768.262] (-769.303) (-768.696) -- 0:00:42
362500 -- (-769.020) (-776.045) (-768.883) [-769.121] * (-770.777) (-768.657) (-773.039) [-771.351] -- 0:00:42
363000 -- [-772.453] (-774.852) (-771.947) (-770.670) * [-769.472] (-778.107) (-770.715) (-768.574) -- 0:00:42
363500 -- [-770.157] (-769.242) (-767.182) (-769.500) * (-769.601) (-769.780) (-769.120) [-768.324] -- 0:00:42
364000 -- (-768.429) (-768.162) (-768.310) [-769.088] * (-770.174) [-770.267] (-769.345) (-767.686) -- 0:00:41
364500 -- (-768.272) (-769.230) (-770.203) [-767.979] * [-769.559] (-769.296) (-767.729) (-768.372) -- 0:00:43
365000 -- [-772.036] (-770.200) (-768.117) (-769.159) * (-769.553) [-773.392] (-768.281) (-771.947) -- 0:00:43
Average standard deviation of split frequencies: 0.018303
365500 -- (-768.456) (-769.655) [-767.595] (-772.576) * (-768.885) [-772.226] (-767.429) (-769.191) -- 0:00:43
366000 -- (-768.420) (-768.854) (-767.474) [-774.651] * [-769.127] (-771.344) (-768.502) (-769.073) -- 0:00:43
366500 -- (-769.031) (-769.811) (-770.175) [-768.900] * (-770.045) [-770.922] (-773.082) (-768.883) -- 0:00:43
367000 -- (-769.009) [-771.725] (-769.949) (-769.231) * [-769.230] (-771.897) (-767.675) (-768.892) -- 0:00:43
367500 -- (-770.152) [-768.911] (-767.230) (-770.940) * (-767.589) [-770.242] (-769.768) (-770.538) -- 0:00:43
368000 -- (-769.786) [-769.694] (-768.753) (-768.704) * [-768.678] (-769.770) (-769.069) (-771.542) -- 0:00:42
368500 -- (-767.945) (-771.924) (-770.163) [-770.652] * (-771.203) [-767.508] (-773.189) (-771.175) -- 0:00:42
369000 -- (-767.908) [-769.545] (-768.635) (-769.672) * (-769.009) [-768.001] (-769.345) (-772.590) -- 0:00:42
369500 -- (-767.341) (-769.222) [-768.547] (-769.964) * (-768.708) [-767.029] (-768.925) (-767.130) -- 0:00:42
370000 -- [-769.251] (-768.679) (-768.135) (-768.240) * (-768.910) [-769.943] (-769.799) (-767.923) -- 0:00:42
Average standard deviation of split frequencies: 0.018541
370500 -- (-770.017) (-769.963) [-767.919] (-768.754) * (-769.301) (-769.437) [-769.188] (-770.083) -- 0:00:42
371000 -- (-769.387) (-774.991) (-769.272) [-768.314] * (-768.783) [-772.667] (-769.179) (-767.092) -- 0:00:42
371500 -- [-770.387] (-769.587) (-767.715) (-769.792) * (-768.196) [-768.178] (-769.123) (-769.481) -- 0:00:42
372000 -- [-769.212] (-771.558) (-768.060) (-769.529) * (-772.553) (-769.098) (-768.003) [-768.737] -- 0:00:42
372500 -- (-767.305) [-770.291] (-767.963) (-773.645) * (-769.496) [-771.824] (-767.344) (-770.511) -- 0:00:42
373000 -- (-767.312) [-767.990] (-767.375) (-775.786) * [-773.121] (-769.437) (-767.330) (-770.654) -- 0:00:42
373500 -- (-771.719) (-770.069) (-770.911) [-767.852] * (-769.944) (-775.105) [-767.824] (-770.303) -- 0:00:41
374000 -- (-768.743) [-769.933] (-777.656) (-769.556) * [-771.626] (-772.119) (-767.244) (-767.705) -- 0:00:41
374500 -- (-769.759) (-769.556) (-775.493) [-770.392] * (-769.013) (-768.902) [-768.846] (-767.136) -- 0:00:41
375000 -- (-768.094) (-769.478) (-768.991) [-770.775] * (-770.874) (-769.127) (-768.221) [-767.937] -- 0:00:41
Average standard deviation of split frequencies: 0.017761
375500 -- [-770.158] (-769.264) (-768.083) (-768.320) * (-769.097) (-768.995) [-770.673] (-772.360) -- 0:00:41
376000 -- (-769.953) [-771.361] (-770.279) (-767.730) * (-771.901) (-769.890) [-769.204] (-771.798) -- 0:00:41
376500 -- (-768.686) (-769.825) (-768.555) [-768.980] * (-767.673) [-769.588] (-767.918) (-771.796) -- 0:00:41
377000 -- (-767.932) [-770.901] (-771.267) (-771.460) * (-767.531) (-769.350) (-768.885) [-769.192] -- 0:00:41
377500 -- (-770.458) (-768.563) [-769.117] (-771.141) * (-770.583) [-769.663] (-770.082) (-770.603) -- 0:00:41
378000 -- (-768.579) (-770.665) [-767.460] (-769.545) * (-768.725) (-768.147) [-772.162] (-770.289) -- 0:00:41
378500 -- [-767.848] (-769.718) (-769.654) (-768.681) * (-769.685) (-768.143) (-770.678) [-769.793] -- 0:00:41
379000 -- (-768.710) (-768.968) (-769.312) [-767.731] * (-769.446) [-767.594] (-769.963) (-768.142) -- 0:00:40
379500 -- (-768.113) [-767.675] (-769.398) (-768.530) * (-769.287) (-768.035) [-769.398] (-769.048) -- 0:00:40
380000 -- [-768.524] (-768.969) (-771.726) (-768.151) * (-770.200) (-767.432) (-770.348) [-771.024] -- 0:00:42
Average standard deviation of split frequencies: 0.017483
380500 -- (-771.701) (-768.745) (-768.579) [-769.531] * [-768.684] (-770.440) (-768.878) (-770.459) -- 0:00:42
381000 -- (-770.213) (-768.700) (-770.768) [-769.335] * (-768.703) [-771.037] (-770.013) (-770.258) -- 0:00:42
381500 -- (-769.359) [-770.810] (-772.682) (-770.737) * (-771.930) (-769.544) (-769.296) [-767.914] -- 0:00:42
382000 -- (-769.117) (-768.563) [-768.734] (-772.417) * (-767.223) (-767.457) [-770.723] (-768.406) -- 0:00:42
382500 -- (-771.997) [-768.770] (-768.595) (-771.723) * [-768.677] (-767.958) (-769.483) (-767.802) -- 0:00:41
383000 -- [-775.166] (-768.262) (-769.292) (-773.172) * (-770.603) (-768.362) (-773.003) [-767.722] -- 0:00:41
383500 -- [-767.672] (-771.357) (-771.609) (-770.174) * [-769.631] (-769.958) (-769.307) (-767.423) -- 0:00:41
384000 -- (-768.734) (-771.243) (-770.557) [-768.945] * (-768.584) [-769.088] (-770.159) (-769.838) -- 0:00:41
384500 -- (-773.597) (-770.522) [-768.272] (-767.863) * (-771.262) (-768.365) [-769.103] (-767.806) -- 0:00:41
385000 -- [-770.836] (-771.131) (-771.117) (-769.380) * (-768.193) (-770.391) (-772.162) [-767.652] -- 0:00:41
Average standard deviation of split frequencies: 0.017776
385500 -- (-772.904) (-768.336) (-771.325) [-768.728] * [-768.910] (-770.106) (-768.448) (-767.641) -- 0:00:41
386000 -- [-770.489] (-772.958) (-768.691) (-773.546) * (-770.878) (-770.540) (-768.436) [-768.231] -- 0:00:41
386500 -- (-770.114) (-767.523) (-769.564) [-769.105] * (-769.751) (-769.014) [-767.941] (-769.441) -- 0:00:41
387000 -- [-767.302] (-771.193) (-767.896) (-770.215) * (-768.984) [-773.316] (-768.906) (-770.321) -- 0:00:41
387500 -- [-767.301] (-769.452) (-767.607) (-769.394) * (-771.280) (-772.987) [-768.561] (-767.666) -- 0:00:41
388000 -- (-767.801) (-768.588) (-767.157) [-767.707] * (-768.246) (-769.653) [-769.256] (-770.189) -- 0:00:41
388500 -- (-769.313) (-776.717) (-767.310) [-768.349] * [-768.345] (-767.274) (-771.145) (-774.207) -- 0:00:40
389000 -- (-771.662) [-773.058] (-767.258) (-768.141) * (-768.229) (-770.215) [-768.873] (-776.478) -- 0:00:40
389500 -- (-773.059) (-769.970) (-767.695) [-770.811] * [-767.916] (-767.544) (-768.916) (-768.612) -- 0:00:40
390000 -- (-768.143) [-767.348] (-767.591) (-772.178) * (-768.732) [-768.050] (-769.453) (-769.487) -- 0:00:40
Average standard deviation of split frequencies: 0.017592
390500 -- (-770.415) [-767.939] (-768.253) (-769.561) * (-770.497) (-768.537) (-769.026) [-767.515] -- 0:00:40
391000 -- [-768.646] (-770.550) (-771.057) (-770.633) * (-768.926) (-769.134) (-768.693) [-767.435] -- 0:00:40
391500 -- [-769.456] (-768.990) (-768.003) (-768.615) * (-769.624) (-767.365) [-771.472] (-767.168) -- 0:00:40
392000 -- (-768.045) (-768.254) [-771.947] (-770.253) * [-772.162] (-769.976) (-767.666) (-768.736) -- 0:00:40
392500 -- (-768.040) [-772.656] (-769.855) (-768.338) * (-769.755) [-771.368] (-771.645) (-771.385) -- 0:00:40
393000 -- (-769.361) (-774.587) [-769.084] (-768.226) * (-768.521) (-772.960) (-769.231) [-772.731] -- 0:00:40
393500 -- (-768.594) (-775.168) (-770.198) [-767.783] * (-769.451) [-772.165] (-768.950) (-770.712) -- 0:00:40
394000 -- [-769.262] (-768.396) (-769.747) (-767.628) * [-767.556] (-774.980) (-772.210) (-774.237) -- 0:00:41
394500 -- [-768.134] (-768.931) (-768.596) (-768.011) * (-767.522) (-768.801) [-768.508] (-772.157) -- 0:00:41
395000 -- (-767.759) (-769.491) [-768.689] (-770.404) * [-767.617] (-768.098) (-768.506) (-768.700) -- 0:00:41
Average standard deviation of split frequencies: 0.016666
395500 -- (-767.685) (-770.082) (-767.375) [-769.851] * (-767.540) (-768.322) (-771.182) [-769.914] -- 0:00:41
396000 -- [-769.705] (-767.648) (-771.122) (-769.622) * [-767.540] (-771.313) (-772.773) (-769.886) -- 0:00:41
396500 -- (-769.135) [-768.750] (-772.665) (-773.396) * (-767.823) (-770.455) [-770.325] (-773.445) -- 0:00:41
397000 -- (-772.533) (-770.530) [-769.005] (-769.393) * (-768.195) (-768.292) (-773.648) [-770.096] -- 0:00:41
397500 -- [-769.605] (-769.622) (-769.864) (-771.204) * [-769.010] (-769.554) (-770.392) (-768.018) -- 0:00:40
398000 -- [-768.790] (-771.619) (-769.253) (-769.044) * (-769.611) (-768.888) [-769.691] (-770.253) -- 0:00:40
398500 -- [-768.260] (-769.158) (-769.421) (-772.088) * (-770.219) [-769.728] (-768.081) (-770.175) -- 0:00:40
399000 -- (-772.443) (-769.203) [-769.260] (-767.925) * (-768.358) (-771.095) (-768.804) [-771.916] -- 0:00:40
399500 -- (-770.909) (-769.073) [-768.230] (-767.938) * [-768.302] (-771.262) (-770.272) (-772.135) -- 0:00:40
400000 -- (-768.530) (-771.436) (-771.179) [-769.507] * (-767.502) (-769.898) (-771.976) [-773.634] -- 0:00:40
Average standard deviation of split frequencies: 0.015918
400500 -- (-769.600) (-767.421) (-767.874) [-770.007] * (-770.582) (-770.490) [-767.608] (-769.205) -- 0:00:40
401000 -- (-768.970) (-768.662) [-770.251] (-769.118) * (-770.213) (-769.376) (-768.160) [-769.861] -- 0:00:40
401500 -- [-768.677] (-769.368) (-767.908) (-773.799) * (-771.611) (-768.654) [-768.486] (-767.778) -- 0:00:40
402000 -- (-768.914) [-768.524] (-769.383) (-768.962) * (-768.622) (-775.263) (-771.877) [-768.497] -- 0:00:40
402500 -- (-767.821) [-767.474] (-771.361) (-768.136) * [-768.625] (-773.502) (-772.307) (-767.233) -- 0:00:40
403000 -- (-768.171) [-769.996] (-770.575) (-768.200) * (-767.843) (-767.915) (-770.453) [-767.562] -- 0:00:39
403500 -- (-769.063) (-767.986) [-767.720] (-768.879) * (-769.821) (-770.705) (-774.583) [-769.708] -- 0:00:39
404000 -- [-771.164] (-769.315) (-767.347) (-771.110) * (-768.170) (-769.275) [-771.490] (-769.390) -- 0:00:39
404500 -- (-768.182) (-771.081) [-768.085] (-769.676) * [-767.484] (-769.435) (-770.448) (-768.656) -- 0:00:39
405000 -- [-769.590] (-773.859) (-768.038) (-769.134) * (-768.760) (-769.442) (-769.593) [-772.783] -- 0:00:39
Average standard deviation of split frequencies: 0.016707
405500 -- [-768.207] (-768.118) (-770.421) (-769.984) * [-767.952] (-769.513) (-771.636) (-767.987) -- 0:00:39
406000 -- [-767.867] (-771.528) (-773.865) (-770.092) * (-768.178) [-767.365] (-769.204) (-766.976) -- 0:00:39
406500 -- (-768.870) (-770.916) (-771.205) [-769.714] * (-767.539) (-769.513) [-768.696] (-768.203) -- 0:00:39
407000 -- (-770.644) (-770.836) (-774.106) [-767.068] * (-769.035) (-771.821) [-770.506] (-768.311) -- 0:00:39
407500 -- (-770.707) (-767.757) (-770.306) [-767.659] * [-768.281] (-773.113) (-771.058) (-768.386) -- 0:00:39
408000 -- (-769.066) (-769.648) (-773.310) [-767.499] * (-770.770) (-768.848) [-771.267] (-768.146) -- 0:00:39
408500 -- (-768.543) (-769.086) (-768.423) [-769.884] * (-769.992) [-768.140] (-771.391) (-768.634) -- 0:00:39
409000 -- [-768.675] (-769.552) (-770.371) (-768.755) * [-767.951] (-768.041) (-769.708) (-772.765) -- 0:00:40
409500 -- (-767.523) [-768.620] (-767.539) (-771.937) * (-767.124) [-770.851] (-771.591) (-767.893) -- 0:00:40
410000 -- [-769.326] (-769.298) (-771.484) (-773.643) * [-767.507] (-771.367) (-769.541) (-771.599) -- 0:00:40
Average standard deviation of split frequencies: 0.016675
410500 -- [-772.437] (-771.035) (-768.033) (-769.007) * [-767.849] (-768.549) (-767.160) (-767.459) -- 0:00:40
411000 -- (-770.519) (-775.965) [-769.415] (-770.003) * [-767.719] (-770.601) (-772.853) (-768.465) -- 0:00:40
411500 -- (-773.615) [-769.525] (-772.441) (-770.174) * (-770.929) (-769.214) (-768.519) [-767.227] -- 0:00:40
412000 -- (-771.895) (-768.229) (-773.782) [-768.110] * (-769.531) (-768.117) [-768.701] (-768.250) -- 0:00:39
412500 -- (-770.085) [-768.139] (-770.748) (-768.203) * (-769.668) [-770.889] (-770.520) (-768.295) -- 0:00:39
413000 -- (-768.096) (-768.856) (-767.331) [-767.290] * [-768.686] (-769.870) (-769.779) (-771.393) -- 0:00:39
413500 -- [-768.549] (-771.377) (-767.901) (-768.866) * (-770.742) (-770.511) (-768.185) [-767.338] -- 0:00:39
414000 -- (-774.986) (-773.441) [-769.410] (-768.576) * (-768.570) (-770.070) (-768.067) [-770.676] -- 0:00:39
414500 -- (-776.325) (-770.768) [-767.375] (-770.259) * [-770.224] (-768.942) (-769.110) (-770.452) -- 0:00:39
415000 -- [-768.469] (-770.961) (-769.311) (-772.334) * [-770.451] (-769.672) (-768.493) (-767.494) -- 0:00:39
Average standard deviation of split frequencies: 0.016198
415500 -- (-768.500) [-768.341] (-769.504) (-769.301) * [-768.673] (-767.811) (-767.761) (-773.903) -- 0:00:39
416000 -- (-769.238) (-769.382) [-769.443] (-767.923) * [-768.501] (-767.886) (-768.505) (-768.791) -- 0:00:39
416500 -- (-773.873) (-772.652) (-769.557) [-772.715] * (-771.248) (-768.575) (-767.840) [-768.395] -- 0:00:39
417000 -- (-768.788) (-771.538) [-770.163] (-772.949) * (-768.596) (-774.506) [-768.632] (-771.061) -- 0:00:39
417500 -- (-770.657) (-768.701) [-768.852] (-772.419) * (-768.205) [-768.524] (-769.739) (-772.120) -- 0:00:39
418000 -- (-768.678) (-769.010) [-768.735] (-771.048) * [-769.189] (-769.762) (-769.059) (-770.337) -- 0:00:38
418500 -- [-767.752] (-769.517) (-767.549) (-771.880) * (-769.219) (-770.008) (-772.040) [-768.755] -- 0:00:38
419000 -- (-769.143) [-769.460] (-768.397) (-768.956) * (-769.692) [-767.645] (-770.413) (-769.787) -- 0:00:38
419500 -- (-767.692) (-771.300) (-770.446) [-771.322] * (-767.720) [-767.605] (-772.809) (-767.956) -- 0:00:38
420000 -- (-768.644) (-768.503) (-767.982) [-770.683] * (-771.658) (-767.961) [-769.648] (-769.707) -- 0:00:38
Average standard deviation of split frequencies: 0.015689
420500 -- [-768.226] (-769.379) (-770.028) (-771.211) * (-770.031) (-769.007) [-769.480] (-771.855) -- 0:00:38
421000 -- (-768.187) [-769.039] (-774.572) (-767.382) * [-769.437] (-773.673) (-771.912) (-771.043) -- 0:00:38
421500 -- (-769.323) [-767.509] (-772.749) (-767.631) * [-768.695] (-769.616) (-773.773) (-769.070) -- 0:00:38
422000 -- (-770.527) [-767.593] (-767.960) (-769.223) * (-770.103) (-768.953) [-771.749] (-769.999) -- 0:00:38
422500 -- [-767.783] (-767.817) (-768.600) (-772.289) * [-769.728] (-768.995) (-774.857) (-772.009) -- 0:00:38
423000 -- (-767.787) (-768.427) (-769.972) [-769.685] * (-769.314) [-767.912] (-769.591) (-770.132) -- 0:00:38
423500 -- (-772.946) (-769.005) (-768.665) [-768.279] * (-767.560) [-769.930] (-768.584) (-769.559) -- 0:00:38
424000 -- [-772.829] (-768.138) (-769.196) (-770.055) * (-767.613) (-769.605) (-769.572) [-769.640] -- 0:00:39
424500 -- (-771.545) (-770.350) (-769.068) [-773.077] * (-767.415) (-767.850) (-772.721) [-769.045] -- 0:00:39
425000 -- (-769.308) [-768.822] (-768.196) (-769.121) * (-767.278) (-768.398) (-772.231) [-774.382] -- 0:00:39
Average standard deviation of split frequencies: 0.015725
425500 -- (-768.819) (-769.092) (-768.489) [-769.095] * (-767.785) [-767.659] (-771.510) (-771.575) -- 0:00:39
426000 -- (-769.131) [-767.385] (-769.557) (-768.746) * [-768.927] (-768.074) (-771.532) (-772.432) -- 0:00:39
426500 -- (-773.700) [-768.891] (-768.896) (-768.623) * (-774.394) (-773.584) [-768.328] (-769.550) -- 0:00:38
427000 -- (-768.583) (-770.539) (-770.508) [-767.823] * (-770.294) [-768.042] (-767.206) (-769.351) -- 0:00:38
427500 -- [-768.958] (-771.066) (-769.958) (-771.764) * (-768.673) (-767.528) [-771.654] (-769.709) -- 0:00:38
428000 -- (-767.546) (-772.186) [-768.280] (-772.720) * (-769.936) (-772.462) (-767.126) [-768.739] -- 0:00:38
428500 -- [-775.169] (-769.745) (-768.265) (-772.413) * (-770.626) [-769.111] (-768.376) (-768.339) -- 0:00:38
429000 -- (-771.905) (-769.337) [-769.215] (-769.534) * (-769.491) (-769.774) (-770.089) [-768.441] -- 0:00:38
429500 -- [-770.218] (-773.885) (-770.307) (-767.779) * [-767.619] (-770.101) (-768.606) (-769.839) -- 0:00:38
430000 -- (-770.367) (-769.924) (-767.138) [-769.977] * (-768.171) (-767.536) (-769.099) [-767.748] -- 0:00:38
Average standard deviation of split frequencies: 0.015151
430500 -- (-769.995) (-769.742) (-767.265) [-775.081] * (-769.092) (-768.299) [-774.573] (-769.855) -- 0:00:38
431000 -- [-771.563] (-771.037) (-772.824) (-772.924) * (-768.730) [-769.301] (-768.107) (-771.612) -- 0:00:38
431500 -- (-769.216) (-770.879) [-769.305] (-774.185) * (-767.802) (-768.566) [-767.576] (-771.279) -- 0:00:38
432000 -- [-769.391] (-771.696) (-771.289) (-773.154) * [-768.359] (-768.323) (-768.710) (-771.328) -- 0:00:38
432500 -- (-768.405) (-771.457) (-768.679) [-770.000] * [-770.479] (-767.730) (-769.251) (-770.787) -- 0:00:38
433000 -- (-771.342) (-775.154) [-768.714] (-773.693) * [-769.445] (-767.939) (-769.696) (-767.819) -- 0:00:37
433500 -- (-767.860) (-770.087) (-768.306) [-770.783] * (-769.423) (-768.459) (-769.503) [-767.662] -- 0:00:37
434000 -- (-768.665) [-772.161] (-767.574) (-768.949) * (-768.672) [-767.657] (-768.512) (-769.916) -- 0:00:37
434500 -- [-769.968] (-767.863) (-769.839) (-769.365) * (-771.123) (-768.351) (-773.008) [-768.716] -- 0:00:37
435000 -- (-769.010) (-772.163) (-771.960) [-768.033] * (-772.129) (-767.876) (-770.133) [-768.546] -- 0:00:37
Average standard deviation of split frequencies: 0.016278
435500 -- (-771.433) (-770.531) [-769.581] (-769.858) * [-770.701] (-769.656) (-769.102) (-769.197) -- 0:00:37
436000 -- (-771.477) (-772.533) [-769.687] (-771.930) * (-773.964) (-773.310) (-768.359) [-768.232] -- 0:00:37
436500 -- (-770.017) (-767.908) [-769.025] (-768.880) * [-770.903] (-767.762) (-768.388) (-768.478) -- 0:00:37
437000 -- [-770.806] (-770.779) (-770.806) (-767.715) * [-771.809] (-767.889) (-767.554) (-773.325) -- 0:00:37
437500 -- (-768.938) (-775.121) (-770.799) [-767.073] * (-773.619) [-768.083] (-767.554) (-769.732) -- 0:00:37
438000 -- (-769.048) [-769.793] (-769.433) (-769.900) * (-773.817) [-767.586] (-772.020) (-770.784) -- 0:00:37
438500 -- (-770.063) (-768.403) [-767.930] (-769.197) * (-770.072) (-769.581) [-769.402] (-768.048) -- 0:00:37
439000 -- (-768.489) (-772.530) [-767.613] (-772.203) * [-767.384] (-768.822) (-772.639) (-768.281) -- 0:00:38
439500 -- (-771.507) (-769.739) [-768.515] (-768.845) * [-767.090] (-768.526) (-767.920) (-768.034) -- 0:00:38
440000 -- (-769.445) (-769.583) (-769.116) [-770.615] * (-769.598) [-768.450] (-768.653) (-773.400) -- 0:00:38
Average standard deviation of split frequencies: 0.016864
440500 -- (-767.379) (-772.197) (-769.349) [-767.764] * (-768.480) (-769.081) [-767.438] (-772.546) -- 0:00:38
441000 -- (-770.365) (-768.483) [-771.799] (-769.889) * (-772.079) [-768.089] (-770.652) (-768.651) -- 0:00:38
441500 -- [-770.456] (-770.630) (-768.868) (-770.340) * (-768.214) (-768.268) (-769.016) [-772.904] -- 0:00:37
442000 -- (-769.073) [-769.931] (-767.634) (-768.672) * [-768.157] (-770.068) (-771.992) (-771.353) -- 0:00:37
442500 -- (-769.534) (-768.236) [-769.266] (-768.260) * (-769.021) (-769.174) [-767.703] (-774.392) -- 0:00:37
443000 -- (-767.749) (-768.471) [-768.712] (-767.722) * (-768.177) [-768.645] (-771.939) (-769.142) -- 0:00:37
443500 -- (-771.464) (-771.694) [-768.697] (-768.913) * (-768.017) (-768.246) [-769.850] (-773.918) -- 0:00:37
444000 -- (-771.328) (-771.213) (-767.902) [-773.184] * (-774.489) [-769.076] (-770.193) (-771.293) -- 0:00:37
444500 -- (-769.023) (-775.535) [-768.176] (-769.084) * (-769.147) [-767.811] (-768.157) (-771.538) -- 0:00:37
445000 -- (-768.944) [-769.375] (-768.269) (-769.462) * (-768.480) [-771.205] (-770.444) (-772.006) -- 0:00:37
Average standard deviation of split frequencies: 0.016031
445500 -- (-770.243) (-769.922) [-770.954] (-771.055) * (-771.440) [-773.793] (-767.901) (-770.326) -- 0:00:37
446000 -- (-767.767) (-770.189) (-769.234) [-770.792] * (-769.028) (-769.519) [-770.029] (-768.921) -- 0:00:37
446500 -- (-768.825) (-768.901) (-768.027) [-770.990] * (-770.065) [-769.008] (-767.851) (-772.729) -- 0:00:37
447000 -- (-767.980) (-771.222) (-767.663) [-768.463] * [-771.521] (-768.674) (-770.894) (-770.425) -- 0:00:37
447500 -- (-770.505) [-768.868] (-768.384) (-768.455) * (-771.112) [-773.850] (-768.971) (-769.841) -- 0:00:37
448000 -- (-767.721) (-770.992) [-769.917] (-769.346) * (-770.021) (-769.659) (-767.241) [-767.783] -- 0:00:36
448500 -- (-768.480) (-777.093) (-767.671) [-771.305] * (-769.659) [-767.860] (-767.346) (-771.306) -- 0:00:36
449000 -- (-768.679) (-769.237) (-767.786) [-770.627] * (-769.088) (-769.045) [-767.313] (-773.478) -- 0:00:36
449500 -- (-768.421) [-767.427] (-771.452) (-772.226) * (-768.721) (-768.323) [-771.542] (-769.408) -- 0:00:36
450000 -- (-769.838) (-768.276) (-774.957) [-775.350] * (-771.953) (-770.488) [-767.367] (-771.754) -- 0:00:36
Average standard deviation of split frequencies: 0.015865
450500 -- (-769.939) (-768.233) (-769.244) [-776.577] * [-770.162] (-770.110) (-768.805) (-768.082) -- 0:00:36
451000 -- (-769.267) (-770.987) [-769.119] (-772.137) * [-769.765] (-770.847) (-768.118) (-768.949) -- 0:00:36
451500 -- [-769.048] (-768.733) (-770.379) (-770.901) * (-775.072) [-768.821] (-767.902) (-771.005) -- 0:00:36
452000 -- (-768.683) (-770.500) (-768.736) [-769.207] * [-771.185] (-769.162) (-769.741) (-767.930) -- 0:00:36
452500 -- [-768.458] (-770.222) (-770.010) (-772.231) * (-771.565) [-770.342] (-771.433) (-768.532) -- 0:00:36
453000 -- (-769.019) [-770.441] (-777.724) (-770.575) * [-770.303] (-768.049) (-770.306) (-768.759) -- 0:00:36
453500 -- [-767.304] (-774.943) (-770.196) (-768.712) * [-769.779] (-768.935) (-768.842) (-769.427) -- 0:00:36
454000 -- (-769.297) (-770.297) [-771.995] (-767.762) * (-772.073) [-769.869] (-767.558) (-775.841) -- 0:00:36
454500 -- (-768.825) [-773.142] (-769.201) (-776.179) * (-767.867) (-769.603) [-771.637] (-775.634) -- 0:00:37
455000 -- (-771.014) (-768.489) [-768.570] (-769.523) * (-767.115) [-768.540] (-768.728) (-770.477) -- 0:00:37
Average standard deviation of split frequencies: 0.015993
455500 -- [-769.307] (-770.039) (-769.791) (-768.506) * (-774.074) (-768.170) (-771.343) [-769.237] -- 0:00:37
456000 -- (-769.512) [-768.270] (-771.610) (-767.586) * (-767.640) (-769.487) [-770.663] (-768.711) -- 0:00:36
456500 -- (-767.946) (-767.103) (-771.820) [-769.749] * [-768.360] (-769.762) (-771.934) (-769.716) -- 0:00:36
457000 -- [-768.060] (-767.149) (-770.858) (-769.016) * (-770.625) [-771.364] (-776.235) (-770.517) -- 0:00:36
457500 -- (-769.136) (-773.153) [-767.700] (-769.279) * [-771.154] (-769.447) (-777.204) (-769.513) -- 0:00:36
458000 -- (-769.666) [-767.106] (-767.834) (-770.947) * (-769.515) [-773.957] (-769.192) (-770.968) -- 0:00:36
458500 -- (-771.532) (-770.381) (-769.486) [-768.707] * (-769.013) [-773.716] (-772.561) (-767.261) -- 0:00:36
459000 -- (-770.073) [-767.767] (-770.802) (-770.101) * (-770.568) (-767.485) (-769.714) [-773.482] -- 0:00:36
459500 -- [-768.738] (-767.779) (-767.913) (-770.995) * [-772.042] (-767.714) (-768.450) (-772.065) -- 0:00:36
460000 -- (-770.042) (-768.324) (-768.885) [-771.499] * (-768.170) (-768.032) [-769.211] (-768.779) -- 0:00:36
Average standard deviation of split frequencies: 0.016373
460500 -- [-767.650] (-769.001) (-770.826) (-769.862) * (-768.445) (-767.948) (-768.491) [-769.982] -- 0:00:36
461000 -- (-771.677) (-769.117) (-768.988) [-768.345] * [-768.864] (-767.586) (-769.724) (-772.736) -- 0:00:36
461500 -- [-770.427] (-768.388) (-769.420) (-768.305) * (-768.770) [-768.211] (-770.213) (-770.776) -- 0:00:36
462000 -- (-768.651) [-770.338] (-767.123) (-770.796) * (-770.451) (-769.752) (-769.961) [-770.878] -- 0:00:36
462500 -- (-770.541) (-768.352) (-770.086) [-769.354] * (-771.536) [-769.283] (-768.802) (-771.551) -- 0:00:36
463000 -- (-770.724) (-769.803) (-770.101) [-770.736] * (-772.055) [-768.166] (-769.209) (-769.667) -- 0:00:35
463500 -- (-769.747) (-768.713) (-769.165) [-768.775] * (-768.185) [-767.612] (-775.823) (-769.415) -- 0:00:35
464000 -- [-770.536] (-768.588) (-768.843) (-769.225) * (-769.404) (-767.377) [-772.084] (-767.595) -- 0:00:35
464500 -- (-768.459) [-768.407] (-768.213) (-767.772) * [-769.306] (-768.458) (-768.586) (-768.679) -- 0:00:35
465000 -- [-767.970] (-768.498) (-768.891) (-769.905) * (-769.244) (-768.821) [-769.571] (-774.756) -- 0:00:35
Average standard deviation of split frequencies: 0.016245
465500 -- (-767.929) (-769.117) [-768.002] (-768.722) * (-768.424) (-768.630) (-767.545) [-774.511] -- 0:00:35
466000 -- (-768.535) [-769.471] (-768.309) (-771.352) * (-769.640) (-770.670) (-768.878) [-776.842] -- 0:00:35
466500 -- (-769.528) (-770.381) (-774.017) [-770.702] * [-768.026] (-767.410) (-773.467) (-772.382) -- 0:00:35
467000 -- (-771.225) [-772.242] (-768.973) (-770.245) * [-768.184] (-769.688) (-770.680) (-768.646) -- 0:00:35
467500 -- (-768.322) (-768.901) (-770.495) [-769.094] * (-767.773) (-771.812) [-769.091] (-768.492) -- 0:00:35
468000 -- (-770.463) (-769.753) (-771.986) [-771.470] * (-768.437) (-770.399) (-768.898) [-767.913] -- 0:00:35
468500 -- (-770.362) (-771.599) (-767.818) [-769.845] * (-768.576) [-768.118] (-767.215) (-768.265) -- 0:00:35
469000 -- (-770.627) [-768.868] (-768.844) (-770.498) * (-771.510) [-768.307] (-768.464) (-768.120) -- 0:00:36
469500 -- (-769.972) (-769.037) (-775.206) [-774.479] * [-772.270] (-768.315) (-767.898) (-769.344) -- 0:00:36
470000 -- (-769.974) (-770.471) (-769.942) [-769.243] * (-770.785) (-767.384) [-768.974] (-770.358) -- 0:00:36
Average standard deviation of split frequencies: 0.015789
470500 -- (-767.406) (-771.690) (-769.676) [-770.362] * (-767.036) [-770.156] (-768.622) (-770.792) -- 0:00:36
471000 -- (-769.622) (-771.487) [-769.021] (-773.538) * (-770.191) (-773.425) (-770.540) [-769.452] -- 0:00:35
471500 -- (-767.968) [-767.531] (-771.104) (-771.515) * (-776.095) (-769.217) (-768.024) [-767.576] -- 0:00:35
472000 -- (-767.438) [-770.613] (-774.554) (-769.238) * (-782.408) [-770.059] (-770.595) (-767.921) -- 0:00:35
472500 -- (-770.009) (-767.894) (-772.661) [-769.328] * (-771.672) (-768.769) [-770.816] (-771.548) -- 0:00:35
473000 -- [-770.556] (-767.295) (-781.652) (-767.970) * (-768.197) [-769.024] (-769.299) (-769.338) -- 0:00:35
473500 -- (-770.679) (-770.898) (-769.041) [-767.182] * (-768.398) [-768.552] (-773.951) (-768.446) -- 0:00:35
474000 -- (-767.946) (-771.885) (-768.468) [-767.754] * (-768.811) [-768.330] (-774.961) (-770.076) -- 0:00:35
474500 -- (-769.746) (-770.218) [-771.174] (-767.965) * (-768.030) [-770.701] (-771.151) (-771.610) -- 0:00:35
475000 -- [-768.352] (-768.004) (-770.939) (-766.900) * (-767.710) (-776.391) [-770.796] (-772.353) -- 0:00:35
Average standard deviation of split frequencies: 0.016079
475500 -- (-768.029) (-768.709) [-768.577] (-770.233) * (-767.567) (-769.487) (-770.955) [-771.987] -- 0:00:35
476000 -- (-769.350) (-771.056) (-772.178) [-769.780] * (-768.460) (-768.409) [-770.465] (-771.765) -- 0:00:35
476500 -- [-771.624] (-772.706) (-768.580) (-770.861) * [-772.306] (-774.284) (-768.097) (-770.280) -- 0:00:35
477000 -- (-772.694) (-768.898) (-768.447) [-767.570] * (-773.075) [-769.925] (-774.569) (-768.781) -- 0:00:35
477500 -- (-768.980) (-769.510) (-770.737) [-767.266] * (-770.112) [-768.001] (-771.289) (-769.365) -- 0:00:35
478000 -- [-768.962] (-769.320) (-771.148) (-767.522) * (-770.614) (-767.615) (-771.663) [-770.381] -- 0:00:34
478500 -- (-770.625) [-767.229] (-776.206) (-769.145) * (-768.068) [-768.062] (-772.462) (-774.875) -- 0:00:34
479000 -- (-772.287) (-768.003) (-769.419) [-769.213] * (-768.396) (-767.980) (-769.363) [-767.817] -- 0:00:34
479500 -- (-771.477) (-767.891) (-770.330) [-769.824] * [-769.322] (-769.073) (-769.550) (-769.277) -- 0:00:34
480000 -- (-771.686) [-769.700] (-773.184) (-769.467) * [-769.015] (-769.692) (-770.860) (-768.680) -- 0:00:34
Average standard deviation of split frequencies: 0.015692
480500 -- (-767.860) (-768.301) (-768.865) [-769.079] * (-772.999) (-772.588) (-770.094) [-769.371] -- 0:00:34
481000 -- [-768.744] (-768.496) (-771.945) (-770.759) * (-768.344) (-772.880) [-768.299] (-770.188) -- 0:00:34
481500 -- [-768.258] (-767.958) (-768.731) (-770.178) * (-773.737) (-769.258) (-769.075) [-769.426] -- 0:00:34
482000 -- (-767.489) [-769.907] (-768.949) (-771.687) * [-770.842] (-767.476) (-768.392) (-771.268) -- 0:00:34
482500 -- (-768.506) [-768.232] (-769.252) (-769.862) * (-768.201) (-767.289) [-767.961] (-768.523) -- 0:00:34
483000 -- (-769.927) (-767.652) (-770.761) [-769.251] * (-770.972) (-768.829) (-770.487) [-768.602] -- 0:00:35
483500 -- (-772.250) (-767.797) (-769.834) [-770.139] * (-768.504) (-771.999) (-770.952) [-769.887] -- 0:00:35
484000 -- (-768.490) [-767.653] (-769.172) (-769.105) * (-768.017) (-768.864) (-770.096) [-768.505] -- 0:00:35
484500 -- [-769.655] (-769.930) (-767.648) (-767.721) * (-767.642) (-771.365) [-769.467] (-770.539) -- 0:00:35
485000 -- (-769.962) (-768.860) [-767.849] (-768.396) * (-767.780) (-769.285) (-769.153) [-769.289] -- 0:00:35
Average standard deviation of split frequencies: 0.015035
485500 -- (-771.527) (-768.013) (-770.256) [-772.557] * (-769.257) (-768.138) (-769.865) [-768.622] -- 0:00:34
486000 -- (-768.033) (-770.635) (-768.154) [-768.216] * (-770.295) [-769.393] (-769.006) (-769.670) -- 0:00:34
486500 -- (-773.404) [-768.273] (-770.724) (-768.752) * (-770.186) (-772.752) (-769.085) [-768.856] -- 0:00:34
487000 -- (-770.383) (-769.588) (-771.023) [-768.548] * (-769.304) (-768.468) [-768.535] (-767.509) -- 0:00:34
487500 -- (-773.289) (-769.834) (-769.637) [-770.662] * (-767.892) (-768.449) [-768.784] (-767.191) -- 0:00:34
488000 -- (-770.180) (-770.299) [-771.663] (-769.957) * (-769.015) (-771.286) [-769.618] (-769.787) -- 0:00:34
488500 -- (-771.306) (-769.721) [-770.047] (-771.180) * (-768.011) [-768.087] (-769.202) (-769.310) -- 0:00:34
489000 -- [-767.679] (-772.671) (-769.532) (-770.371) * (-772.701) (-769.396) (-770.828) [-768.492] -- 0:00:34
489500 -- (-772.486) (-769.743) (-768.617) [-769.033] * (-770.831) (-768.124) [-769.383] (-767.470) -- 0:00:34
490000 -- (-769.814) (-769.163) [-768.266] (-773.421) * (-770.229) [-767.404] (-768.943) (-768.682) -- 0:00:34
Average standard deviation of split frequencies: 0.015692
490500 -- (-769.176) [-773.393] (-767.447) (-772.903) * (-769.190) [-769.841] (-767.558) (-769.201) -- 0:00:34
491000 -- (-768.110) (-770.962) [-768.652] (-768.989) * [-771.219] (-769.355) (-768.791) (-768.756) -- 0:00:34
491500 -- (-768.036) (-767.489) (-768.030) [-768.008] * (-768.752) (-768.505) (-768.039) [-767.676] -- 0:00:34
492000 -- (-772.704) (-772.064) (-768.404) [-767.874] * (-771.320) [-768.290] (-769.016) (-767.648) -- 0:00:34
492500 -- (-768.247) (-769.602) [-768.120] (-767.759) * (-767.644) (-768.844) [-769.324] (-769.844) -- 0:00:34
493000 -- [-772.885] (-768.443) (-769.956) (-767.991) * [-772.036] (-769.595) (-767.701) (-774.479) -- 0:00:33
493500 -- (-773.659) [-768.066] (-770.374) (-768.571) * [-769.658] (-769.038) (-770.665) (-770.518) -- 0:00:33
494000 -- (-769.804) [-767.545] (-772.894) (-767.252) * [-768.100] (-773.353) (-771.032) (-768.194) -- 0:00:33
494500 -- (-770.420) (-768.706) (-772.192) [-767.390] * [-769.041] (-772.407) (-767.972) (-769.307) -- 0:00:33
495000 -- [-771.221] (-769.969) (-769.082) (-769.851) * (-768.042) (-768.435) [-770.108] (-768.493) -- 0:00:33
Average standard deviation of split frequencies: 0.015259
495500 -- [-770.721] (-767.409) (-770.309) (-769.222) * (-771.045) [-768.806] (-769.164) (-772.779) -- 0:00:33
496000 -- [-769.097] (-767.442) (-770.056) (-769.097) * (-769.957) (-768.194) (-768.115) [-767.690] -- 0:00:33
496500 -- (-770.122) [-768.226] (-774.578) (-771.045) * (-768.396) (-769.156) [-769.254] (-767.490) -- 0:00:33
497000 -- [-767.443] (-770.271) (-771.616) (-768.483) * (-767.968) [-768.963] (-770.680) (-767.312) -- 0:00:33
497500 -- (-768.379) [-769.510] (-770.580) (-771.517) * (-767.890) (-769.052) (-768.330) [-772.520] -- 0:00:33
498000 -- (-768.290) [-771.617] (-771.220) (-773.127) * [-769.461] (-769.721) (-773.134) (-770.743) -- 0:00:33
498500 -- (-769.340) (-774.162) (-771.645) [-769.763] * [-769.525] (-768.453) (-770.481) (-767.247) -- 0:00:34
499000 -- (-770.652) (-771.269) [-767.127] (-771.482) * [-767.761] (-773.433) (-768.736) (-767.112) -- 0:00:34
499500 -- (-772.024) (-768.892) [-768.145] (-770.769) * (-770.248) (-770.344) (-776.573) [-768.487] -- 0:00:34
500000 -- (-769.592) [-772.216] (-769.001) (-769.836) * (-771.875) (-767.496) (-771.283) [-770.163] -- 0:00:34
Average standard deviation of split frequencies: 0.015013
500500 -- [-768.176] (-774.628) (-774.301) (-771.308) * (-768.556) [-767.648] (-767.402) (-769.999) -- 0:00:33
501000 -- (-768.021) (-770.547) [-771.651] (-768.955) * [-768.184] (-770.715) (-766.885) (-769.618) -- 0:00:33
501500 -- (-771.196) (-769.494) [-771.591] (-767.520) * [-769.547] (-771.418) (-770.807) (-767.975) -- 0:00:33
502000 -- (-771.355) [-768.290] (-767.738) (-767.561) * [-772.021] (-768.543) (-772.871) (-769.220) -- 0:00:33
502500 -- (-772.491) [-768.172] (-773.724) (-768.048) * (-771.181) [-768.979] (-772.527) (-768.591) -- 0:00:33
503000 -- (-768.294) (-770.847) (-769.009) [-772.533] * [-767.266] (-773.501) (-768.052) (-768.341) -- 0:00:33
503500 -- (-768.764) (-768.161) (-768.512) [-769.630] * (-767.445) (-769.768) [-773.941] (-769.189) -- 0:00:33
504000 -- (-768.000) (-770.707) [-768.433] (-770.965) * (-774.384) (-768.097) [-768.895] (-768.806) -- 0:00:33
504500 -- [-767.615] (-768.627) (-769.441) (-768.890) * (-769.217) (-776.366) [-770.273] (-771.350) -- 0:00:33
505000 -- [-767.755] (-767.033) (-767.391) (-770.859) * [-768.082] (-771.694) (-771.227) (-771.756) -- 0:00:33
Average standard deviation of split frequencies: 0.014699
505500 -- (-770.949) (-767.069) [-770.186] (-768.111) * [-768.208] (-769.342) (-771.570) (-767.830) -- 0:00:33
506000 -- (-768.571) (-769.489) [-771.159] (-768.458) * (-768.374) (-767.381) (-768.326) [-767.614] -- 0:00:33
506500 -- (-769.940) (-767.504) (-769.940) [-768.951] * (-769.521) [-767.684] (-769.795) (-767.758) -- 0:00:33
507000 -- (-770.371) (-767.261) (-769.041) [-767.701] * [-772.888] (-769.866) (-772.119) (-768.644) -- 0:00:33
507500 -- (-769.194) [-770.201] (-769.516) (-770.214) * [-769.244] (-770.783) (-772.750) (-768.659) -- 0:00:32
508000 -- (-767.548) [-767.122] (-768.088) (-768.665) * (-770.909) (-770.139) [-772.233] (-768.474) -- 0:00:32
508500 -- (-769.833) (-773.455) [-767.822] (-767.112) * (-767.560) [-767.799] (-771.817) (-771.679) -- 0:00:32
509000 -- [-769.378] (-769.372) (-769.655) (-768.188) * (-770.030) (-770.020) [-771.244] (-769.781) -- 0:00:32
509500 -- (-771.130) (-770.361) (-768.944) [-769.857] * (-768.361) (-770.338) [-769.799] (-767.788) -- 0:00:32
510000 -- (-769.097) (-769.238) (-769.624) [-769.315] * (-770.585) (-768.934) [-770.265] (-768.438) -- 0:00:32
Average standard deviation of split frequencies: 0.014390
510500 -- [-767.911] (-771.213) (-769.826) (-767.827) * (-772.240) (-768.439) (-767.079) [-768.437] -- 0:00:32
511000 -- (-770.743) (-769.491) (-768.511) [-769.426] * (-772.304) (-770.217) [-769.172] (-769.785) -- 0:00:32
511500 -- (-772.009) [-769.009] (-772.506) (-770.140) * (-768.327) (-769.757) (-772.371) [-769.414] -- 0:00:32
512000 -- (-768.922) (-767.286) (-768.882) [-768.667] * (-771.002) [-770.444] (-768.390) (-772.185) -- 0:00:32
512500 -- (-767.640) (-767.211) (-768.264) [-771.611] * (-768.690) (-768.456) [-768.296] (-769.888) -- 0:00:32
513000 -- (-767.125) (-772.246) (-768.703) [-770.146] * (-771.317) (-773.902) [-771.451] (-768.847) -- 0:00:32
513500 -- (-767.020) (-771.501) [-768.555] (-769.176) * (-768.194) (-768.837) (-770.910) [-768.214] -- 0:00:32
514000 -- (-769.590) (-772.758) [-768.061] (-769.546) * (-767.553) (-767.276) [-771.319] (-769.295) -- 0:00:33
514500 -- [-767.847] (-770.314) (-770.664) (-771.368) * (-767.604) [-767.488] (-772.351) (-768.723) -- 0:00:33
515000 -- [-769.828] (-767.443) (-768.197) (-770.997) * (-772.517) [-768.586] (-768.407) (-767.343) -- 0:00:32
Average standard deviation of split frequencies: 0.014241
515500 -- (-768.838) (-767.262) (-770.078) [-769.092] * (-767.822) (-768.989) [-767.689] (-769.230) -- 0:00:32
516000 -- (-774.573) (-769.384) (-772.195) [-767.548] * (-767.819) (-768.069) (-767.444) [-768.266] -- 0:00:32
516500 -- (-768.447) (-770.931) [-768.110] (-768.847) * (-767.701) (-771.807) (-768.029) [-768.631] -- 0:00:32
517000 -- (-770.385) (-769.194) (-767.300) [-768.460] * (-767.701) (-768.288) [-768.708] (-769.065) -- 0:00:32
517500 -- (-774.153) (-771.876) (-768.806) [-768.922] * (-769.216) (-770.137) [-768.780] (-770.207) -- 0:00:32
518000 -- [-771.944] (-768.296) (-767.512) (-770.256) * (-769.195) (-770.427) [-768.226] (-768.475) -- 0:00:32
518500 -- [-769.913] (-768.962) (-768.355) (-772.364) * (-767.197) (-768.319) [-768.517] (-768.859) -- 0:00:32
519000 -- (-770.917) [-770.176] (-768.772) (-772.550) * (-769.065) [-769.748] (-771.566) (-768.218) -- 0:00:32
519500 -- [-770.528] (-769.107) (-771.597) (-772.966) * (-774.192) [-769.307] (-771.210) (-768.953) -- 0:00:32
520000 -- (-769.542) [-768.128] (-768.358) (-770.411) * [-767.801] (-768.292) (-768.403) (-767.852) -- 0:00:32
Average standard deviation of split frequencies: 0.014220
520500 -- [-767.671] (-774.169) (-770.992) (-769.591) * (-770.246) (-768.382) [-767.222] (-770.761) -- 0:00:32
521000 -- [-767.552] (-775.146) (-768.082) (-767.353) * (-767.386) (-769.665) [-769.720] (-768.278) -- 0:00:32
521500 -- [-768.604] (-769.518) (-771.862) (-770.295) * (-769.666) (-772.802) (-772.109) [-770.494] -- 0:00:32
522000 -- (-768.800) [-771.357] (-770.415) (-771.347) * (-770.304) [-767.740] (-770.251) (-771.109) -- 0:00:32
522500 -- (-775.057) (-775.524) [-770.406] (-768.210) * [-771.232] (-769.138) (-769.799) (-769.679) -- 0:00:31
523000 -- (-773.635) [-774.932] (-767.552) (-767.611) * (-771.166) [-770.456] (-768.847) (-767.661) -- 0:00:31
523500 -- (-769.031) (-773.171) [-769.970] (-767.753) * (-770.339) (-769.916) [-768.643] (-767.532) -- 0:00:31
524000 -- (-769.579) [-774.549] (-772.178) (-768.723) * (-768.214) (-772.523) (-768.181) [-770.621] -- 0:00:31
524500 -- (-767.417) (-769.891) (-768.061) [-768.822] * (-772.257) (-768.299) [-768.987] (-773.833) -- 0:00:31
525000 -- (-769.521) (-770.019) [-768.415] (-768.448) * (-769.399) [-767.651] (-770.738) (-768.263) -- 0:00:31
Average standard deviation of split frequencies: 0.013812
525500 -- (-772.196) [-767.445] (-768.592) (-768.137) * (-770.220) (-767.651) (-767.929) [-768.218] -- 0:00:31
526000 -- [-768.691] (-768.503) (-767.974) (-768.901) * [-774.752] (-770.049) (-769.172) (-767.706) -- 0:00:31
526500 -- [-768.163] (-770.508) (-768.959) (-768.713) * (-768.850) (-770.963) (-768.283) [-770.680] -- 0:00:31
527000 -- (-770.567) (-767.632) [-769.355] (-767.802) * (-772.228) [-769.387] (-767.493) (-774.389) -- 0:00:31
527500 -- (-767.791) (-769.760) [-768.237] (-770.901) * (-770.565) (-775.379) [-770.848] (-769.771) -- 0:00:31
528000 -- (-767.749) (-771.499) (-769.840) [-768.450] * [-768.836] (-769.086) (-768.565) (-771.302) -- 0:00:31
528500 -- [-768.422] (-769.300) (-770.445) (-770.964) * [-767.839] (-767.647) (-769.189) (-768.012) -- 0:00:31
529000 -- (-768.164) [-767.211] (-769.844) (-769.452) * (-768.117) (-770.521) [-769.152] (-773.063) -- 0:00:32
529500 -- [-767.935] (-768.983) (-768.751) (-772.049) * [-768.372] (-771.598) (-774.901) (-769.099) -- 0:00:31
530000 -- [-768.517] (-768.867) (-767.927) (-772.028) * [-769.509] (-769.886) (-771.196) (-769.567) -- 0:00:31
Average standard deviation of split frequencies: 0.013273
530500 -- (-770.371) (-769.735) [-767.636] (-768.895) * (-770.610) (-771.388) (-770.608) [-769.341] -- 0:00:31
531000 -- (-771.114) (-768.486) (-768.165) [-771.674] * (-768.153) [-769.670] (-771.043) (-768.760) -- 0:00:31
531500 -- (-769.407) [-768.435] (-769.322) (-773.267) * (-771.142) (-769.871) (-769.215) [-770.328] -- 0:00:31
532000 -- (-770.936) (-768.778) [-771.505] (-771.690) * (-768.342) [-774.379] (-770.011) (-770.072) -- 0:00:31
532500 -- (-768.308) (-769.381) [-772.107] (-772.348) * (-769.281) (-774.139) [-767.896] (-772.732) -- 0:00:31
533000 -- [-767.215] (-770.423) (-770.032) (-770.902) * (-768.008) (-772.908) (-768.750) [-771.242] -- 0:00:31
533500 -- (-767.357) (-769.701) [-767.909] (-768.791) * [-768.223] (-770.268) (-770.904) (-768.519) -- 0:00:31
534000 -- (-768.680) [-768.583] (-770.852) (-768.892) * (-770.486) (-772.741) (-769.961) [-768.290] -- 0:00:31
534500 -- (-770.072) (-769.720) (-767.082) [-768.361] * (-771.495) (-769.038) (-767.286) [-768.876] -- 0:00:31
535000 -- (-769.113) [-769.760] (-771.774) (-768.603) * (-769.466) [-768.988] (-768.517) (-769.383) -- 0:00:31
Average standard deviation of split frequencies: 0.013244
535500 -- (-768.039) [-769.176] (-769.536) (-767.910) * [-770.048] (-770.261) (-769.919) (-772.328) -- 0:00:31
536000 -- (-771.367) [-768.711] (-769.632) (-769.092) * (-772.095) (-769.469) [-773.935] (-771.330) -- 0:00:31
536500 -- (-771.673) (-768.736) [-768.114] (-772.106) * (-767.617) (-773.655) [-768.807] (-770.184) -- 0:00:31
537000 -- (-769.278) (-769.116) (-769.056) [-774.912] * [-768.910] (-770.943) (-769.792) (-767.487) -- 0:00:31
537500 -- (-769.416) (-770.858) [-768.676] (-774.701) * (-770.524) (-774.821) (-769.111) [-768.025] -- 0:00:30
538000 -- (-768.010) [-771.942] (-770.576) (-774.999) * (-773.690) [-769.024] (-768.271) (-770.426) -- 0:00:30
538500 -- (-772.181) (-768.509) (-768.191) [-769.734] * [-771.989] (-769.052) (-767.922) (-769.970) -- 0:00:30
539000 -- [-768.189] (-771.404) (-769.551) (-768.266) * (-771.164) [-767.626] (-771.063) (-769.731) -- 0:00:30
539500 -- (-768.850) (-771.984) [-768.699] (-768.682) * (-768.923) (-768.842) (-769.733) [-767.859] -- 0:00:30
540000 -- [-768.962] (-773.528) (-771.140) (-770.446) * (-768.057) (-774.211) (-771.330) [-767.683] -- 0:00:30
Average standard deviation of split frequencies: 0.013130
540500 -- (-769.920) (-771.879) (-770.252) [-768.561] * [-770.034] (-770.367) (-770.351) (-767.384) -- 0:00:30
541000 -- (-768.164) [-768.944] (-770.843) (-769.242) * (-773.709) [-771.497] (-768.865) (-770.275) -- 0:00:30
541500 -- (-767.093) (-774.309) (-768.336) [-767.923] * (-768.028) (-767.176) (-768.324) [-769.061] -- 0:00:30
542000 -- (-768.438) (-767.612) (-769.108) [-767.593] * (-771.904) [-768.557] (-769.941) (-768.462) -- 0:00:30
542500 -- (-768.528) [-767.581] (-768.351) (-768.202) * (-774.970) (-768.187) (-770.043) [-772.141] -- 0:00:30
543000 -- (-769.607) (-767.808) [-769.718] (-770.934) * (-770.178) (-768.355) [-770.847] (-774.673) -- 0:00:30
543500 -- (-768.847) (-769.096) (-767.695) [-768.428] * (-768.588) [-768.646] (-773.593) (-769.868) -- 0:00:30
544000 -- (-768.597) (-769.847) (-767.854) [-768.543] * (-771.290) (-768.837) [-774.555] (-768.776) -- 0:00:30
544500 -- (-768.822) (-768.758) [-767.996] (-768.691) * [-768.567] (-769.624) (-767.972) (-768.210) -- 0:00:30
545000 -- (-770.370) (-769.937) (-769.305) [-767.658] * (-767.955) (-771.370) [-769.166] (-769.411) -- 0:00:30
Average standard deviation of split frequencies: 0.013459
545500 -- (-771.121) [-768.592] (-769.275) (-770.928) * (-769.310) [-769.237] (-769.389) (-774.390) -- 0:00:30
546000 -- [-768.281] (-768.735) (-768.794) (-768.242) * (-767.536) (-767.997) (-770.877) [-768.387] -- 0:00:30
546500 -- [-768.281] (-768.101) (-768.129) (-768.353) * [-769.337] (-771.501) (-770.606) (-769.616) -- 0:00:30
547000 -- [-770.748] (-768.386) (-771.536) (-769.226) * (-769.281) [-768.944] (-771.402) (-771.200) -- 0:00:30
547500 -- [-767.429] (-768.315) (-770.367) (-769.417) * (-770.813) [-769.023] (-769.962) (-768.898) -- 0:00:30
548000 -- (-767.429) (-770.143) (-769.487) [-768.595] * (-767.238) (-774.148) [-767.542] (-776.225) -- 0:00:30
548500 -- (-774.476) [-768.616] (-771.014) (-768.093) * (-769.653) (-769.297) [-767.643] (-771.947) -- 0:00:30
549000 -- (-770.762) (-769.346) (-767.713) [-768.395] * [-769.094] (-771.150) (-772.534) (-769.351) -- 0:00:30
549500 -- (-770.129) (-768.853) [-768.947] (-768.491) * (-770.268) (-768.215) (-773.200) [-769.720] -- 0:00:30
550000 -- (-769.954) (-770.603) [-769.322] (-770.029) * (-770.375) [-770.098] (-768.103) (-770.004) -- 0:00:30
Average standard deviation of split frequencies: 0.012992
550500 -- (-769.580) [-771.150] (-770.511) (-769.037) * (-767.674) (-768.953) (-770.649) [-771.072] -- 0:00:30
551000 -- [-769.416] (-768.823) (-769.955) (-769.318) * [-768.155] (-772.194) (-773.053) (-768.660) -- 0:00:30
551500 -- (-769.601) (-768.654) [-769.533] (-767.475) * (-771.199) (-769.490) [-770.640] (-769.528) -- 0:00:30
552000 -- [-774.223] (-767.545) (-779.443) (-767.391) * (-770.199) (-769.099) (-769.829) [-768.089] -- 0:00:30
552500 -- (-774.945) [-768.268] (-771.066) (-767.744) * (-770.203) [-767.768] (-771.701) (-767.614) -- 0:00:29
553000 -- (-769.496) (-774.819) [-769.574] (-772.081) * (-770.661) [-768.853] (-769.130) (-772.008) -- 0:00:29
553500 -- (-768.276) (-769.475) [-767.735] (-771.908) * (-771.575) (-768.490) (-771.895) [-774.996] -- 0:00:29
554000 -- (-767.531) [-769.504] (-769.304) (-771.866) * (-771.171) (-767.051) [-768.989] (-769.954) -- 0:00:29
554500 -- (-768.062) (-769.291) (-769.475) [-770.236] * (-768.558) [-768.962] (-770.509) (-768.512) -- 0:00:29
555000 -- (-769.294) (-769.078) (-768.050) [-769.629] * (-771.691) (-773.732) (-769.949) [-768.779] -- 0:00:29
Average standard deviation of split frequencies: 0.013416
555500 -- (-771.040) [-768.288] (-768.216) (-772.265) * (-768.945) (-772.292) (-768.739) [-769.175] -- 0:00:29
556000 -- (-770.614) [-769.232] (-768.276) (-771.257) * (-769.280) (-770.720) [-769.466] (-770.697) -- 0:00:29
556500 -- (-769.479) (-768.213) [-768.844] (-770.119) * (-768.959) (-767.675) [-769.320] (-770.868) -- 0:00:29
557000 -- [-767.882] (-768.928) (-770.558) (-771.264) * (-769.257) (-768.120) (-771.922) [-771.661] -- 0:00:29
557500 -- [-769.788] (-770.262) (-767.910) (-769.273) * [-768.496] (-768.298) (-770.307) (-775.243) -- 0:00:29
558000 -- [-772.637] (-768.897) (-770.332) (-769.120) * (-771.616) [-768.576] (-772.413) (-772.512) -- 0:00:29
558500 -- (-769.803) [-770.235] (-767.679) (-769.906) * [-773.969] (-769.109) (-770.542) (-768.230) -- 0:00:29
559000 -- (-771.202) [-772.247] (-768.208) (-774.698) * (-768.275) (-767.621) (-768.166) [-767.235] -- 0:00:29
559500 -- [-769.271] (-768.368) (-767.295) (-772.215) * (-767.961) [-767.542] (-768.789) (-769.031) -- 0:00:29
560000 -- (-769.662) (-772.116) (-776.262) [-767.748] * [-767.648] (-770.424) (-769.262) (-769.873) -- 0:00:29
Average standard deviation of split frequencies: 0.013304
560500 -- (-768.310) [-769.302] (-768.939) (-769.435) * [-767.832] (-767.972) (-771.756) (-768.503) -- 0:00:29
561000 -- (-769.280) (-768.722) (-772.706) [-769.331] * (-767.508) (-768.028) [-768.155] (-769.041) -- 0:00:29
561500 -- (-767.745) (-767.403) (-767.536) [-767.491] * (-768.288) (-768.194) (-768.611) [-770.314] -- 0:00:29
562000 -- (-768.024) (-767.161) (-768.207) [-769.225] * (-768.509) [-767.821] (-767.462) (-769.914) -- 0:00:29
562500 -- (-771.836) (-767.529) (-768.897) [-767.491] * (-768.810) (-770.955) (-767.357) [-767.165] -- 0:00:29
563000 -- (-774.204) (-769.658) [-769.301] (-772.104) * (-768.515) [-770.887] (-768.249) (-774.496) -- 0:00:29
563500 -- (-775.689) [-769.090] (-768.547) (-773.508) * (-770.563) [-770.613] (-767.193) (-773.691) -- 0:00:29
564000 -- (-767.815) [-768.394] (-770.373) (-768.981) * (-770.117) [-767.548] (-768.353) (-770.137) -- 0:00:29
564500 -- (-767.797) (-768.889) [-768.079] (-771.919) * [-769.485] (-768.660) (-769.971) (-773.335) -- 0:00:29
565000 -- (-771.928) (-767.775) (-776.047) [-768.869] * (-767.523) (-767.161) [-767.143] (-769.393) -- 0:00:29
Average standard deviation of split frequencies: 0.013424
565500 -- [-767.132] (-767.713) (-774.747) (-769.989) * (-773.172) (-769.862) [-768.949] (-768.149) -- 0:00:29
566000 -- [-771.608] (-767.116) (-772.773) (-768.931) * [-767.880] (-767.214) (-770.165) (-769.802) -- 0:00:29
566500 -- [-768.175] (-770.504) (-774.482) (-771.089) * (-766.936) (-768.122) [-770.027] (-770.773) -- 0:00:29
567000 -- (-768.407) (-768.234) (-769.807) [-769.471] * (-767.890) (-769.212) [-768.837] (-773.876) -- 0:00:29
567500 -- [-769.255] (-768.234) (-768.427) (-768.322) * (-767.697) [-768.575] (-774.538) (-768.622) -- 0:00:28
568000 -- (-774.803) (-767.838) (-768.529) [-768.900] * (-770.891) (-773.769) [-767.543] (-767.818) -- 0:00:28
568500 -- (-768.400) (-769.273) (-769.413) [-768.688] * [-769.804] (-771.611) (-767.864) (-767.320) -- 0:00:28
569000 -- (-770.791) [-772.570] (-768.472) (-769.135) * (-770.811) [-767.359] (-767.988) (-773.631) -- 0:00:28
569500 -- (-768.671) (-770.320) (-769.226) [-769.184] * (-769.037) [-767.821] (-767.952) (-773.179) -- 0:00:28
570000 -- (-770.907) (-770.763) [-769.736] (-768.714) * [-768.898] (-771.565) (-770.294) (-769.855) -- 0:00:28
Average standard deviation of split frequencies: 0.012925
570500 -- [-769.117] (-769.961) (-768.873) (-769.036) * (-768.728) [-770.148] (-770.294) (-770.177) -- 0:00:28
571000 -- (-768.791) (-772.469) (-774.799) [-767.040] * (-768.137) (-767.990) (-774.187) [-769.055] -- 0:00:28
571500 -- (-775.708) [-768.273] (-769.255) (-770.345) * [-769.803] (-768.280) (-771.059) (-768.280) -- 0:00:28
572000 -- (-774.454) (-768.453) [-769.980] (-768.709) * (-767.294) (-768.091) [-768.277] (-773.858) -- 0:00:28
572500 -- (-774.419) (-769.222) [-768.628] (-768.628) * (-768.568) [-769.086] (-772.803) (-768.468) -- 0:00:28
573000 -- (-768.998) [-769.042] (-769.129) (-767.130) * (-770.453) (-768.698) (-770.913) [-771.340] -- 0:00:28
573500 -- (-769.517) (-771.895) [-769.154] (-771.695) * (-768.799) (-770.977) [-770.561] (-770.639) -- 0:00:28
574000 -- (-769.679) (-770.740) [-770.095] (-773.317) * [-768.220] (-774.902) (-768.816) (-771.734) -- 0:00:28
574500 -- [-770.090] (-774.058) (-769.950) (-779.237) * (-770.719) [-772.940] (-767.471) (-771.761) -- 0:00:28
575000 -- [-771.846] (-771.162) (-771.220) (-775.194) * [-770.185] (-769.809) (-772.533) (-770.693) -- 0:00:28
Average standard deviation of split frequencies: 0.012950
575500 -- [-768.514] (-767.929) (-769.214) (-770.808) * (-768.873) (-769.072) [-773.350] (-773.512) -- 0:00:28
576000 -- (-767.890) (-771.823) (-770.004) [-770.929] * (-768.591) (-770.115) (-771.968) [-768.825] -- 0:00:27
576500 -- [-769.410] (-771.559) (-768.384) (-773.127) * (-769.281) (-769.376) (-767.842) [-767.267] -- 0:00:28
577000 -- (-769.260) (-773.829) [-768.743] (-772.747) * (-768.666) (-769.451) (-768.111) [-767.498] -- 0:00:28
577500 -- (-770.813) (-776.379) [-770.890] (-769.854) * (-768.136) (-769.769) (-768.899) [-768.665] -- 0:00:28
578000 -- (-767.953) (-771.272) (-772.622) [-768.342] * [-769.454] (-772.053) (-769.349) (-767.053) -- 0:00:28
578500 -- (-768.488) (-768.088) [-772.242] (-767.561) * (-769.642) [-771.387] (-767.777) (-768.194) -- 0:00:28
579000 -- (-767.521) (-769.647) [-768.873] (-769.021) * [-772.674] (-768.830) (-767.932) (-769.083) -- 0:00:28
579500 -- (-767.306) (-770.133) (-772.833) [-767.835] * (-776.361) (-767.791) [-769.986] (-767.929) -- 0:00:28
580000 -- (-768.943) (-769.869) [-774.179] (-768.283) * [-771.912] (-769.542) (-769.457) (-768.317) -- 0:00:28
Average standard deviation of split frequencies: 0.013243
580500 -- [-768.118] (-775.576) (-777.604) (-770.653) * [-769.344] (-770.999) (-767.619) (-769.161) -- 0:00:28
581000 -- (-769.962) [-768.429] (-773.118) (-773.332) * (-778.943) (-772.480) (-769.150) [-768.789] -- 0:00:28
581500 -- (-770.862) (-769.072) (-770.627) [-767.682] * [-768.377] (-769.015) (-769.790) (-768.398) -- 0:00:28
582000 -- (-768.450) (-769.281) [-769.215] (-767.646) * (-767.608) (-767.566) (-769.654) [-767.742] -- 0:00:28
582500 -- (-767.242) (-768.301) [-768.796] (-767.628) * (-768.394) [-768.886] (-769.817) (-768.156) -- 0:00:27
583000 -- (-768.050) (-767.512) [-768.716] (-768.841) * (-768.136) (-769.260) [-769.209] (-776.048) -- 0:00:27
583500 -- (-769.325) (-772.781) (-769.098) [-767.514] * (-768.082) (-769.243) [-768.432] (-768.974) -- 0:00:27
584000 -- (-768.565) (-771.689) [-770.422] (-769.964) * (-767.855) [-769.638] (-767.580) (-770.111) -- 0:00:27
584500 -- (-770.409) [-768.213] (-769.217) (-769.340) * (-769.113) (-768.546) (-768.083) [-768.405] -- 0:00:27
585000 -- (-767.503) (-770.128) (-767.317) [-767.715] * [-769.781] (-770.081) (-768.397) (-769.162) -- 0:00:27
Average standard deviation of split frequencies: 0.013877
585500 -- (-767.532) (-769.814) [-770.717] (-767.195) * (-767.658) (-772.884) (-768.746) [-771.037] -- 0:00:27
586000 -- [-769.101] (-767.778) (-768.889) (-769.483) * (-768.440) (-769.500) [-769.288] (-769.883) -- 0:00:27
586500 -- (-773.112) (-768.781) (-767.532) [-771.755] * (-773.427) (-768.708) [-771.233] (-768.291) -- 0:00:27
587000 -- (-769.949) (-769.617) (-767.642) [-770.195] * (-771.569) (-767.934) [-769.208] (-768.660) -- 0:00:27
587500 -- (-769.327) (-769.732) [-768.723] (-768.403) * (-770.632) [-770.668] (-775.180) (-768.660) -- 0:00:27
588000 -- (-769.386) (-771.386) (-770.091) [-767.483] * (-769.316) [-768.067] (-772.037) (-767.445) -- 0:00:27
588500 -- (-769.227) (-772.562) (-770.441) [-768.916] * (-768.842) [-769.643] (-772.443) (-767.358) -- 0:00:27
589000 -- (-767.609) (-770.047) [-768.401] (-768.517) * (-772.122) (-771.954) [-769.561] (-768.575) -- 0:00:27
589500 -- [-768.870] (-770.239) (-773.285) (-768.567) * (-769.911) [-772.190] (-770.762) (-769.927) -- 0:00:27
590000 -- [-769.635] (-771.355) (-773.946) (-770.717) * (-774.079) (-769.157) [-773.802] (-769.916) -- 0:00:27
Average standard deviation of split frequencies: 0.014316
590500 -- (-769.042) [-769.932] (-768.656) (-769.611) * [-769.002] (-768.450) (-769.932) (-774.910) -- 0:00:27
591000 -- (-768.620) (-771.460) (-768.178) [-768.736] * (-769.806) (-771.502) (-769.673) [-769.553] -- 0:00:26
591500 -- [-768.316] (-772.790) (-770.261) (-773.999) * (-770.079) (-769.319) [-770.217] (-768.907) -- 0:00:26
592000 -- (-770.116) (-770.913) (-768.687) [-772.449] * (-769.373) (-772.554) (-768.758) [-767.490] -- 0:00:26
592500 -- [-770.828] (-770.346) (-769.547) (-770.523) * (-767.262) (-769.569) [-767.409] (-770.843) -- 0:00:26
593000 -- [-767.699] (-769.260) (-771.021) (-768.534) * (-768.818) [-769.170] (-768.453) (-770.794) -- 0:00:27
593500 -- (-771.378) [-770.164] (-770.130) (-771.246) * (-768.359) (-768.559) (-767.927) [-767.081] -- 0:00:27
594000 -- (-770.227) [-767.820] (-768.233) (-771.522) * [-769.596] (-769.494) (-767.449) (-767.345) -- 0:00:27
594500 -- (-770.392) [-767.375] (-770.169) (-771.975) * (-768.512) (-768.766) [-767.546] (-769.274) -- 0:00:27
595000 -- (-770.853) [-768.188] (-769.338) (-771.347) * (-767.825) (-769.963) [-769.263] (-773.503) -- 0:00:27
Average standard deviation of split frequencies: 0.014284
595500 -- (-772.451) (-768.341) (-771.459) [-769.778] * [-767.902] (-768.877) (-769.956) (-770.126) -- 0:00:27
596000 -- [-768.421] (-767.518) (-770.644) (-770.598) * (-769.578) (-768.252) (-769.096) [-768.530] -- 0:00:27
596500 -- (-767.428) (-770.726) (-768.954) [-770.552] * (-771.279) (-768.037) [-771.272] (-767.862) -- 0:00:27
597000 -- (-768.452) (-771.688) [-768.161] (-768.281) * (-770.380) [-768.465] (-771.545) (-767.642) -- 0:00:27
597500 -- [-767.369] (-772.947) (-768.691) (-770.971) * [-771.396] (-770.093) (-768.360) (-769.025) -- 0:00:26
598000 -- (-776.370) (-772.294) (-767.804) [-770.086] * (-767.411) (-768.391) [-767.417] (-767.957) -- 0:00:26
598500 -- (-770.773) [-771.748] (-768.069) (-769.909) * (-769.116) (-770.189) [-771.005] (-770.774) -- 0:00:26
599000 -- (-769.932) (-769.678) (-767.258) [-771.374] * (-767.375) (-769.040) (-769.421) [-771.555] -- 0:00:26
599500 -- (-768.161) [-770.376] (-770.456) (-772.405) * (-770.393) [-767.225] (-769.660) (-770.034) -- 0:00:26
600000 -- (-768.420) (-769.687) [-771.825] (-768.494) * (-769.861) (-768.587) [-769.121] (-774.539) -- 0:00:26
Average standard deviation of split frequencies: 0.013942
600500 -- (-768.161) [-769.237] (-772.481) (-769.277) * (-769.681) [-768.254] (-767.354) (-772.342) -- 0:00:26
601000 -- [-768.341] (-768.922) (-770.720) (-770.060) * (-768.678) (-771.313) [-767.430] (-768.282) -- 0:00:26
601500 -- (-770.064) (-768.520) [-770.314] (-770.231) * (-768.355) (-770.038) [-768.065] (-768.826) -- 0:00:26
602000 -- (-769.642) (-767.193) [-768.282] (-769.249) * [-768.386] (-768.905) (-767.797) (-768.787) -- 0:00:26
602500 -- (-767.418) (-769.220) (-768.372) [-769.491] * (-767.263) (-771.146) [-767.214] (-769.874) -- 0:00:26
603000 -- (-770.654) (-768.589) (-769.077) [-770.924] * [-768.337] (-771.402) (-768.776) (-771.508) -- 0:00:26
603500 -- [-769.490] (-768.995) (-770.117) (-769.648) * (-767.305) [-769.279] (-768.017) (-769.460) -- 0:00:26
604000 -- [-773.054] (-772.860) (-769.960) (-768.236) * (-769.369) (-769.895) [-768.087] (-769.241) -- 0:00:26
604500 -- [-772.545] (-771.187) (-768.914) (-767.388) * [-768.778] (-768.090) (-767.771) (-772.312) -- 0:00:26
605000 -- (-768.638) [-771.344] (-769.796) (-769.224) * (-769.424) [-767.214] (-769.246) (-770.486) -- 0:00:26
Average standard deviation of split frequencies: 0.014048
605500 -- (-767.594) [-768.300] (-771.841) (-773.146) * (-769.502) [-769.691] (-770.308) (-767.767) -- 0:00:26
606000 -- [-768.850] (-769.116) (-772.043) (-771.080) * (-772.717) (-768.766) [-771.151] (-768.015) -- 0:00:26
606500 -- (-770.141) (-769.563) (-772.255) [-767.958] * (-772.086) (-769.154) [-768.381] (-772.138) -- 0:00:25
607000 -- (-767.194) (-771.342) [-771.457] (-770.070) * (-771.105) (-769.470) [-766.990] (-768.117) -- 0:00:25
607500 -- (-769.556) (-770.413) (-770.129) [-769.992] * (-770.724) (-772.511) [-767.786] (-767.592) -- 0:00:25
608000 -- (-772.226) [-771.293] (-768.528) (-770.293) * (-769.857) (-767.718) (-767.373) [-767.921] -- 0:00:25
608500 -- (-769.505) (-766.992) (-770.532) [-767.566] * (-769.956) [-767.768] (-769.312) (-767.841) -- 0:00:25
609000 -- (-769.453) (-769.649) [-769.724] (-771.348) * [-769.713] (-768.350) (-769.095) (-770.414) -- 0:00:26
609500 -- (-769.289) (-773.137) [-768.038] (-773.279) * [-767.901] (-767.866) (-767.764) (-769.317) -- 0:00:26
610000 -- (-769.276) [-771.901] (-770.892) (-769.240) * (-769.357) (-773.191) (-769.368) [-771.697] -- 0:00:26
Average standard deviation of split frequencies: 0.014077
610500 -- (-768.783) (-772.052) (-771.225) [-769.339] * (-774.937) (-770.576) [-771.827] (-771.626) -- 0:00:26
611000 -- (-769.937) (-769.149) (-772.278) [-771.730] * (-770.213) (-771.315) [-770.333] (-769.338) -- 0:00:26
611500 -- [-767.519] (-767.164) (-770.981) (-768.335) * [-769.035] (-774.436) (-770.722) (-772.870) -- 0:00:26
612000 -- (-767.523) [-768.106] (-771.038) (-767.255) * (-768.889) [-771.853] (-774.448) (-770.867) -- 0:00:25
612500 -- [-770.726] (-768.868) (-769.186) (-768.341) * [-767.840] (-773.127) (-772.617) (-770.399) -- 0:00:25
613000 -- [-773.631] (-769.872) (-768.464) (-769.057) * [-769.476] (-769.502) (-773.291) (-767.879) -- 0:00:25
613500 -- (-779.774) (-771.124) (-771.103) [-768.222] * (-769.652) (-770.186) (-770.241) [-769.477] -- 0:00:25
614000 -- [-768.618] (-772.225) (-767.554) (-769.785) * (-771.680) (-772.513) (-767.531) [-769.235] -- 0:00:25
614500 -- (-767.037) (-770.846) [-768.914] (-770.634) * [-770.423] (-770.859) (-769.796) (-770.296) -- 0:00:25
615000 -- (-767.805) [-771.003] (-770.862) (-771.605) * [-775.715] (-771.215) (-768.219) (-767.253) -- 0:00:25
Average standard deviation of split frequencies: 0.013865
615500 -- (-769.935) [-771.984] (-770.091) (-769.815) * (-766.979) [-768.379] (-770.527) (-767.756) -- 0:00:25
616000 -- (-771.918) [-769.108] (-768.188) (-769.526) * (-768.889) (-769.278) [-769.932] (-768.489) -- 0:00:25
616500 -- [-771.765] (-770.876) (-769.643) (-773.347) * (-770.608) [-768.376] (-771.178) (-769.731) -- 0:00:25
617000 -- (-769.494) (-769.960) (-769.210) [-772.305] * (-768.755) (-770.475) (-772.684) [-769.619] -- 0:00:25
617500 -- (-773.792) [-767.526] (-771.414) (-769.656) * (-768.223) (-768.202) (-770.604) [-769.788] -- 0:00:25
618000 -- [-770.422] (-768.506) (-769.195) (-770.346) * (-768.162) [-770.621] (-768.480) (-769.609) -- 0:00:25
618500 -- (-767.923) (-770.562) [-767.789] (-768.337) * (-767.806) [-770.040] (-774.073) (-769.287) -- 0:00:25
619000 -- (-778.604) (-770.795) [-769.112] (-768.039) * (-771.152) (-770.508) (-771.415) [-773.117] -- 0:00:25
619500 -- (-770.525) [-769.125] (-769.562) (-767.063) * [-769.005] (-767.354) (-768.430) (-770.509) -- 0:00:25
620000 -- (-770.621) (-768.562) [-769.708] (-770.712) * (-770.186) [-767.803] (-777.846) (-771.544) -- 0:00:25
Average standard deviation of split frequencies: 0.012912
620500 -- (-769.270) (-776.582) (-771.723) [-767.442] * (-767.255) (-768.932) [-768.760] (-768.773) -- 0:00:25
621000 -- (-768.150) [-768.214] (-768.009) (-768.305) * [-770.037] (-771.539) (-768.823) (-767.654) -- 0:00:25
621500 -- (-770.389) [-768.232] (-767.680) (-770.347) * (-769.260) [-769.638] (-774.959) (-768.804) -- 0:00:24
622000 -- (-769.631) (-767.507) (-767.852) [-768.601] * (-770.278) (-769.785) (-768.762) [-769.637] -- 0:00:24
622500 -- [-770.731] (-768.364) (-768.427) (-768.619) * [-773.217] (-771.253) (-769.367) (-768.939) -- 0:00:24
623000 -- (-768.117) (-768.321) (-771.052) [-768.845] * [-768.204] (-769.145) (-771.049) (-772.771) -- 0:00:24
623500 -- [-769.687] (-768.075) (-770.702) (-770.166) * (-771.205) [-769.895] (-770.157) (-769.177) -- 0:00:24
624000 -- (-770.818) (-769.291) [-767.532] (-768.289) * (-767.580) (-768.388) [-773.061] (-769.727) -- 0:00:24
624500 -- [-768.880] (-768.622) (-772.659) (-769.286) * (-769.032) (-770.324) (-771.238) [-768.306] -- 0:00:24
625000 -- (-767.628) [-768.571] (-772.479) (-767.966) * [-770.124] (-769.000) (-768.579) (-769.463) -- 0:00:25
Average standard deviation of split frequencies: 0.013067
625500 -- [-769.289] (-769.192) (-770.916) (-768.319) * (-777.754) [-771.442] (-768.384) (-769.603) -- 0:00:25
626000 -- (-772.064) (-768.886) (-770.587) [-768.746] * (-769.197) (-770.562) (-770.639) [-768.520] -- 0:00:25
626500 -- [-772.766] (-770.012) (-767.838) (-774.119) * (-771.282) [-770.420] (-767.110) (-771.216) -- 0:00:25
627000 -- (-774.485) (-767.923) (-767.479) [-768.072] * (-769.894) (-771.871) (-768.436) [-768.554] -- 0:00:24
627500 -- (-768.825) (-768.237) [-768.395] (-768.463) * (-770.010) (-773.248) [-769.242] (-768.644) -- 0:00:24
628000 -- [-770.516] (-769.371) (-769.313) (-767.613) * (-770.772) (-774.697) [-768.014] (-768.603) -- 0:00:24
628500 -- [-770.290] (-771.818) (-768.177) (-770.341) * (-769.118) (-775.022) [-770.336] (-773.452) -- 0:00:24
629000 -- (-773.072) [-767.546] (-768.877) (-768.203) * (-768.925) [-775.019] (-767.901) (-771.688) -- 0:00:24
629500 -- (-766.923) (-767.609) [-768.378] (-768.208) * (-768.625) [-771.570] (-767.546) (-770.710) -- 0:00:24
630000 -- (-769.344) [-769.137] (-768.008) (-771.833) * (-768.014) (-770.513) [-769.443] (-768.325) -- 0:00:24
Average standard deviation of split frequencies: 0.012355
630500 -- [-768.513] (-772.283) (-770.112) (-770.573) * (-768.574) (-770.825) (-769.978) [-769.103] -- 0:00:24
631000 -- (-769.403) (-769.074) (-768.595) [-771.817] * (-769.134) (-771.631) [-769.746] (-770.689) -- 0:00:24
631500 -- (-770.157) [-768.268] (-769.804) (-767.508) * (-769.719) (-771.002) [-772.050] (-769.992) -- 0:00:24
632000 -- (-768.963) (-767.275) [-767.859] (-771.871) * (-774.720) (-770.131) (-768.809) [-770.971] -- 0:00:24
632500 -- (-769.473) (-768.294) (-769.879) [-770.437] * (-770.908) [-770.510] (-771.059) (-767.009) -- 0:00:24
633000 -- (-768.094) (-767.396) [-769.017] (-768.849) * (-770.573) [-768.342] (-768.129) (-769.941) -- 0:00:24
633500 -- [-767.283] (-772.776) (-767.706) (-767.543) * (-767.177) (-771.805) [-767.884] (-769.039) -- 0:00:24
634000 -- [-769.093] (-772.666) (-771.242) (-767.532) * (-770.303) (-772.682) (-771.239) [-769.884] -- 0:00:24
634500 -- (-767.589) [-769.755] (-770.456) (-767.073) * [-770.287] (-771.342) (-769.820) (-769.194) -- 0:00:24
635000 -- (-769.074) [-770.457] (-768.720) (-769.873) * (-770.494) (-770.169) [-770.211] (-768.578) -- 0:00:24
Average standard deviation of split frequencies: 0.011510
635500 -- (-772.107) (-770.424) [-771.270] (-768.874) * [-770.189] (-769.347) (-769.189) (-769.401) -- 0:00:24
636000 -- (-772.967) (-768.849) (-771.006) [-769.382] * (-769.321) [-768.536] (-769.728) (-769.693) -- 0:00:24
636500 -- [-770.794] (-771.096) (-769.937) (-772.015) * (-772.147) (-768.836) (-769.304) [-769.207] -- 0:00:23
637000 -- (-768.664) [-770.855] (-769.575) (-772.029) * [-774.689] (-767.068) (-768.748) (-775.522) -- 0:00:23
637500 -- (-767.804) [-768.763] (-768.519) (-768.585) * [-767.433] (-767.068) (-768.724) (-770.574) -- 0:00:23
638000 -- (-768.340) [-768.382] (-768.930) (-770.034) * (-769.170) [-767.447] (-769.459) (-772.147) -- 0:00:23
638500 -- (-769.527) (-770.041) (-770.801) [-768.972] * [-769.451] (-777.393) (-769.073) (-767.933) -- 0:00:23
639000 -- (-771.196) [-769.964] (-770.722) (-771.479) * (-768.114) (-771.865) [-768.443] (-768.979) -- 0:00:23
639500 -- (-770.886) (-769.696) [-770.010] (-773.349) * (-768.325) (-770.674) [-771.695] (-767.804) -- 0:00:23
640000 -- (-771.172) (-771.633) (-768.276) [-768.624] * (-772.784) [-769.197] (-771.697) (-767.309) -- 0:00:23
Average standard deviation of split frequencies: 0.010777
640500 -- (-770.874) [-768.260] (-767.829) (-768.051) * [-769.138] (-771.374) (-777.281) (-772.412) -- 0:00:23
641000 -- [-771.943] (-773.734) (-768.254) (-767.377) * (-770.993) (-767.531) [-772.527] (-770.419) -- 0:00:24
641500 -- (-767.997) (-772.222) (-770.228) [-769.870] * (-770.334) (-768.694) [-770.524] (-771.036) -- 0:00:24
642000 -- [-767.799] (-769.774) (-768.011) (-770.113) * (-769.066) (-767.853) (-768.403) [-767.433] -- 0:00:23
642500 -- (-769.305) (-770.845) [-769.530] (-769.537) * [-770.652] (-769.979) (-767.816) (-768.765) -- 0:00:23
643000 -- (-768.745) (-769.279) [-770.146] (-769.375) * (-768.139) [-768.297] (-767.802) (-771.712) -- 0:00:23
643500 -- [-769.264] (-768.979) (-770.537) (-772.008) * (-767.433) (-771.580) [-768.257] (-771.838) -- 0:00:23
644000 -- (-771.358) (-767.912) (-774.604) [-769.989] * (-770.727) (-769.946) (-767.263) [-771.047] -- 0:00:23
644500 -- [-771.449] (-768.798) (-773.424) (-768.312) * (-770.635) [-768.784] (-769.281) (-771.020) -- 0:00:23
645000 -- [-768.656] (-768.477) (-768.295) (-769.226) * (-768.146) [-768.487] (-768.370) (-769.903) -- 0:00:23
Average standard deviation of split frequencies: 0.010603
645500 -- (-772.374) (-767.793) [-768.737] (-767.966) * (-767.873) [-770.525] (-768.448) (-771.182) -- 0:00:23
646000 -- (-767.941) [-768.648] (-770.961) (-769.028) * (-769.603) (-769.186) [-769.107] (-768.977) -- 0:00:23
646500 -- (-770.517) [-768.676] (-767.693) (-774.060) * (-770.846) [-768.689] (-769.333) (-770.401) -- 0:00:23
647000 -- [-770.708] (-774.235) (-768.786) (-774.931) * (-767.692) (-769.998) [-768.291] (-768.827) -- 0:00:23
647500 -- (-768.544) [-768.958] (-768.668) (-768.915) * (-767.324) (-768.468) (-768.225) [-772.620] -- 0:00:23
648000 -- [-768.388] (-768.870) (-772.111) (-769.162) * (-772.990) (-767.381) [-771.044] (-767.938) -- 0:00:23
648500 -- (-769.276) (-769.596) (-769.928) [-769.022] * [-769.885] (-772.821) (-769.894) (-769.018) -- 0:00:23
649000 -- (-769.435) (-767.146) (-768.019) [-768.203] * (-776.362) [-767.898] (-769.075) (-773.387) -- 0:00:23
649500 -- (-768.849) (-767.632) (-768.876) [-769.908] * (-767.661) (-769.049) (-767.373) [-770.758] -- 0:00:23
650000 -- [-770.199] (-768.003) (-767.730) (-771.631) * [-773.948] (-767.708) (-769.580) (-769.571) -- 0:00:23
Average standard deviation of split frequencies: 0.011336
650500 -- (-769.269) (-770.458) [-767.890] (-771.422) * (-770.490) (-769.712) [-768.190] (-772.282) -- 0:00:23
651000 -- [-767.862] (-772.488) (-769.834) (-782.528) * [-769.134] (-769.957) (-772.472) (-770.664) -- 0:00:23
651500 -- [-767.490] (-769.163) (-768.965) (-771.427) * (-771.339) (-771.426) (-769.865) [-768.216] -- 0:00:23
652000 -- (-767.452) [-767.172] (-767.607) (-770.683) * (-769.292) (-768.521) [-767.543] (-767.841) -- 0:00:22
652500 -- (-767.932) (-768.774) [-768.596] (-768.387) * (-767.891) (-773.401) [-769.070] (-767.224) -- 0:00:22
653000 -- (-774.254) (-771.116) (-770.804) [-771.226] * (-767.460) (-770.965) [-768.338] (-768.540) -- 0:00:22
653500 -- (-771.658) (-771.065) (-769.007) [-769.947] * (-770.235) (-770.506) [-769.587] (-768.535) -- 0:00:22
654000 -- (-772.284) (-774.248) [-768.124] (-769.915) * (-769.143) (-768.062) (-774.171) [-767.699] -- 0:00:22
654500 -- [-772.499] (-771.070) (-768.321) (-770.995) * (-772.506) [-770.011] (-767.933) (-767.560) -- 0:00:22
655000 -- (-772.873) (-768.539) (-768.000) [-774.854] * (-768.493) (-769.921) (-771.941) [-770.794] -- 0:00:22
Average standard deviation of split frequencies: 0.011582
655500 -- (-770.842) (-772.214) [-767.707] (-772.193) * (-769.592) (-770.542) [-770.219] (-773.266) -- 0:00:22
656000 -- [-771.627] (-767.613) (-771.846) (-770.293) * (-769.460) [-770.956] (-769.637) (-767.375) -- 0:00:22
656500 -- (-773.470) (-770.109) (-770.609) [-768.279] * (-768.326) [-768.251] (-769.106) (-769.199) -- 0:00:23
657000 -- [-774.553] (-768.811) (-767.237) (-768.791) * (-768.762) (-768.396) (-768.285) [-768.280] -- 0:00:22
657500 -- (-773.219) (-767.172) [-768.554] (-770.880) * (-771.850) [-769.558] (-767.790) (-769.961) -- 0:00:22
658000 -- (-770.858) (-768.450) [-768.462] (-767.226) * (-769.394) [-768.336] (-769.899) (-775.126) -- 0:00:22
658500 -- [-770.173] (-768.178) (-769.740) (-769.266) * (-769.071) (-768.361) [-768.589] (-768.204) -- 0:00:22
659000 -- (-773.838) (-770.254) (-768.301) [-768.842] * (-772.942) (-768.215) (-768.735) [-771.662] -- 0:00:22
659500 -- (-769.951) (-772.440) [-767.984] (-768.841) * (-769.934) (-768.668) (-769.192) [-769.526] -- 0:00:22
660000 -- (-773.273) (-773.120) [-768.694] (-769.256) * [-771.511] (-768.949) (-770.476) (-767.798) -- 0:00:22
Average standard deviation of split frequencies: 0.011416
660500 -- [-768.105] (-769.391) (-770.573) (-771.065) * (-769.755) (-769.641) [-768.570] (-768.828) -- 0:00:22
661000 -- (-767.381) (-768.314) [-770.954] (-776.330) * (-771.103) (-770.121) [-770.272] (-770.560) -- 0:00:22
661500 -- (-768.799) (-770.950) (-768.600) [-769.879] * [-776.336] (-769.146) (-768.568) (-771.922) -- 0:00:22
662000 -- [-770.139] (-770.197) (-769.052) (-772.581) * (-770.928) (-769.240) [-768.379] (-774.338) -- 0:00:22
662500 -- (-768.478) [-767.227] (-768.815) (-769.417) * (-770.499) (-770.650) [-768.506] (-768.775) -- 0:00:22
663000 -- (-768.574) (-772.691) [-767.295] (-772.972) * [-767.978] (-770.159) (-769.626) (-768.698) -- 0:00:22
663500 -- (-768.819) (-773.674) (-767.623) [-770.040] * [-768.887] (-767.978) (-770.193) (-770.077) -- 0:00:22
664000 -- [-769.807] (-769.611) (-767.643) (-771.304) * (-771.358) (-771.323) [-769.728] (-771.372) -- 0:00:22
664500 -- (-771.526) (-769.188) (-770.308) [-770.099] * (-770.313) (-768.601) (-769.905) [-768.405] -- 0:00:22
665000 -- [-769.503] (-767.818) (-767.558) (-767.501) * (-769.121) (-769.829) (-770.452) [-767.426] -- 0:00:22
Average standard deviation of split frequencies: 0.011533
665500 -- (-767.748) [-767.936] (-767.359) (-767.977) * (-768.789) [-769.992] (-768.585) (-768.331) -- 0:00:22
666000 -- (-767.984) (-769.626) [-768.299] (-767.690) * (-772.205) (-767.504) (-767.986) [-767.560] -- 0:00:22
666500 -- [-767.512] (-769.667) (-771.365) (-768.495) * [-773.076] (-767.929) (-767.860) (-767.336) -- 0:00:22
667000 -- (-768.359) (-767.397) (-769.728) [-768.972] * (-773.533) (-769.590) [-766.897] (-769.322) -- 0:00:21
667500 -- [-770.792] (-768.090) (-768.904) (-769.815) * [-767.847] (-770.050) (-768.508) (-769.612) -- 0:00:21
668000 -- (-771.877) [-767.443] (-771.797) (-772.975) * [-768.461] (-769.367) (-771.986) (-768.744) -- 0:00:21
668500 -- [-768.276] (-769.918) (-769.341) (-768.402) * [-772.118] (-769.146) (-770.300) (-767.855) -- 0:00:21
669000 -- [-768.426] (-770.659) (-769.133) (-767.485) * (-769.775) (-770.240) [-769.355] (-768.374) -- 0:00:21
669500 -- (-767.534) (-769.634) (-768.839) [-768.722] * (-768.630) (-771.603) [-768.871] (-770.669) -- 0:00:21
670000 -- (-767.822) [-771.830] (-769.713) (-772.698) * (-772.120) (-768.529) [-767.722] (-769.070) -- 0:00:21
Average standard deviation of split frequencies: 0.010455
670500 -- [-768.142] (-769.053) (-768.594) (-773.516) * (-770.421) (-771.877) (-770.925) [-768.386] -- 0:00:21
671000 -- (-767.655) (-770.213) (-770.109) [-768.054] * (-770.461) (-769.313) [-769.003] (-769.189) -- 0:00:21
671500 -- (-767.497) [-768.549] (-770.430) (-768.831) * (-768.521) (-769.985) [-769.083] (-768.783) -- 0:00:21
672000 -- [-767.502] (-772.440) (-767.937) (-770.796) * (-767.467) (-767.966) [-769.409] (-768.714) -- 0:00:21
672500 -- (-772.344) (-770.238) [-768.456] (-768.679) * (-768.878) [-767.983] (-779.081) (-768.579) -- 0:00:21
673000 -- (-769.541) [-767.565] (-768.247) (-768.304) * [-769.762] (-768.698) (-770.734) (-771.991) -- 0:00:21
673500 -- (-770.951) [-767.543] (-768.729) (-767.928) * (-768.350) [-768.813] (-775.553) (-771.869) -- 0:00:21
674000 -- (-769.501) [-769.084] (-769.842) (-769.916) * (-769.620) (-769.417) [-768.539] (-767.605) -- 0:00:21
674500 -- (-769.976) (-769.880) [-767.281] (-769.743) * (-769.954) (-768.418) (-770.067) [-767.179] -- 0:00:21
675000 -- (-768.073) (-767.549) [-769.559] (-768.168) * (-771.173) (-768.701) (-772.920) [-769.370] -- 0:00:21
Average standard deviation of split frequencies: 0.010242
675500 -- (-768.152) (-769.290) (-769.216) [-769.191] * (-772.073) (-768.417) [-771.583] (-769.829) -- 0:00:21
676000 -- (-772.157) (-767.829) (-768.751) [-768.345] * [-770.894] (-769.761) (-772.203) (-769.158) -- 0:00:21
676500 -- (-771.228) [-767.214] (-768.023) (-769.479) * (-768.466) (-769.303) (-773.966) [-769.184] -- 0:00:21
677000 -- (-770.495) (-769.987) [-769.005] (-773.092) * [-767.593] (-771.813) (-778.945) (-769.266) -- 0:00:21
677500 -- (-769.255) (-768.968) (-771.511) [-769.609] * (-768.384) (-771.908) (-772.233) [-770.369] -- 0:00:21
678000 -- [-769.883] (-771.007) (-778.239) (-767.488) * (-768.565) [-767.539] (-772.327) (-770.052) -- 0:00:21
678500 -- (-768.787) [-768.967] (-775.140) (-767.515) * (-770.700) [-767.243] (-768.941) (-767.315) -- 0:00:21
679000 -- (-768.736) [-768.405] (-770.912) (-768.272) * (-768.345) (-768.750) [-768.377] (-769.526) -- 0:00:21
679500 -- (-769.154) [-771.380] (-771.223) (-768.133) * (-769.294) (-767.941) (-771.275) [-768.578] -- 0:00:21
680000 -- (-767.861) [-769.078] (-770.812) (-773.239) * (-767.328) (-775.340) (-771.028) [-768.244] -- 0:00:21
Average standard deviation of split frequencies: 0.009912
680500 -- (-768.084) (-767.422) [-769.746] (-769.258) * (-767.443) (-769.867) [-768.701] (-768.390) -- 0:00:21
681000 -- [-768.553] (-768.878) (-772.523) (-769.119) * (-767.913) (-771.623) (-767.906) [-768.711] -- 0:00:21
681500 -- [-768.502] (-769.268) (-768.445) (-768.058) * (-775.114) [-768.919] (-768.955) (-775.928) -- 0:00:21
682000 -- [-768.823] (-768.362) (-769.163) (-768.056) * (-770.713) (-769.028) [-770.138] (-772.723) -- 0:00:20
682500 -- [-769.632] (-770.642) (-768.368) (-769.012) * (-769.387) (-772.124) [-768.981] (-771.739) -- 0:00:20
683000 -- (-767.662) (-768.463) (-769.744) [-769.791] * (-771.369) (-770.593) [-769.284] (-769.912) -- 0:00:20
683500 -- [-767.777] (-769.573) (-774.184) (-772.684) * [-769.896] (-770.678) (-769.578) (-770.458) -- 0:00:20
684000 -- (-768.268) (-768.714) (-770.250) [-767.449] * (-767.983) [-769.291] (-768.438) (-768.206) -- 0:00:20
684500 -- (-769.254) [-768.221] (-768.609) (-770.451) * (-772.476) (-767.662) [-768.692] (-769.793) -- 0:00:20
685000 -- (-769.477) (-770.954) [-770.234] (-769.585) * (-771.721) [-767.704] (-768.900) (-771.995) -- 0:00:20
Average standard deviation of split frequencies: 0.009749
685500 -- [-767.281] (-769.089) (-768.836) (-767.887) * (-769.742) [-767.850] (-767.331) (-769.635) -- 0:00:20
686000 -- (-767.583) [-768.160] (-769.536) (-768.710) * (-774.036) [-769.766] (-767.202) (-768.737) -- 0:00:20
686500 -- [-771.052] (-767.341) (-769.165) (-769.532) * (-773.330) (-769.042) [-768.004] (-768.911) -- 0:00:20
687000 -- (-773.201) [-771.059] (-772.768) (-773.106) * [-771.090] (-768.348) (-767.694) (-769.024) -- 0:00:20
687500 -- (-773.297) (-772.158) [-769.205] (-773.703) * (-769.230) [-767.480] (-768.944) (-770.584) -- 0:00:20
688000 -- [-769.463] (-769.176) (-767.134) (-770.540) * (-769.001) (-773.978) (-769.600) [-768.498] -- 0:00:20
688500 -- (-770.058) [-768.644] (-770.410) (-770.493) * (-769.537) [-769.594] (-770.067) (-767.611) -- 0:00:20
689000 -- (-769.805) [-768.797] (-772.308) (-770.601) * (-767.803) [-767.209] (-768.641) (-767.951) -- 0:00:20
689500 -- [-772.155] (-771.257) (-772.109) (-768.938) * (-768.616) (-768.627) [-767.578] (-772.781) -- 0:00:20
690000 -- (-768.017) (-769.023) [-768.399] (-767.902) * (-769.021) (-770.700) [-767.755] (-768.607) -- 0:00:20
Average standard deviation of split frequencies: 0.010110
690500 -- (-769.000) (-772.752) (-768.280) [-771.361] * (-770.351) [-770.512] (-767.613) (-771.424) -- 0:00:20
691000 -- (-770.864) (-770.182) (-771.612) [-769.028] * (-767.982) (-769.416) [-767.310] (-770.841) -- 0:00:20
691500 -- [-770.185] (-768.454) (-774.277) (-775.074) * (-770.487) (-770.796) (-769.051) [-770.494] -- 0:00:20
692000 -- (-770.466) [-767.792] (-769.776) (-769.521) * (-767.294) (-770.307) [-769.525] (-772.958) -- 0:00:20
692500 -- (-771.265) (-770.399) [-768.164] (-774.842) * (-769.020) (-767.646) [-767.997] (-771.387) -- 0:00:20
693000 -- (-770.739) [-767.420] (-772.124) (-772.838) * (-769.412) [-769.185] (-771.576) (-769.612) -- 0:00:20
693500 -- (-768.165) [-767.286] (-768.085) (-769.113) * (-768.887) [-769.220] (-771.260) (-767.773) -- 0:00:20
694000 -- (-767.273) [-769.394] (-769.934) (-772.576) * (-769.121) (-773.030) (-771.030) [-768.094] -- 0:00:20
694500 -- (-769.124) (-767.076) (-772.712) [-771.769] * (-770.103) (-770.175) [-769.713] (-769.886) -- 0:00:20
695000 -- (-767.903) (-769.103) (-769.349) [-771.534] * (-772.399) (-772.667) [-767.657] (-770.995) -- 0:00:20
Average standard deviation of split frequencies: 0.010202
695500 -- [-768.097] (-768.388) (-767.361) (-773.407) * (-768.268) (-770.056) (-767.709) [-768.399] -- 0:00:20
696000 -- (-768.196) [-768.362] (-767.813) (-769.615) * (-769.056) [-769.084] (-773.110) (-769.657) -- 0:00:20
696500 -- (-768.637) (-772.105) [-767.766] (-768.980) * (-768.838) (-770.932) (-768.569) [-770.291] -- 0:00:20
697000 -- (-770.631) [-768.416] (-767.651) (-771.494) * (-768.153) (-772.384) [-770.373] (-767.174) -- 0:00:19
697500 -- (-769.696) (-767.890) [-771.527] (-773.089) * (-769.943) (-771.364) (-768.865) [-769.750] -- 0:00:19
698000 -- (-770.594) [-769.353] (-773.836) (-768.507) * (-768.923) (-774.179) (-770.783) [-767.881] -- 0:00:19
698500 -- (-768.098) (-769.421) (-777.369) [-767.722] * (-768.133) [-770.608] (-772.718) (-770.445) -- 0:00:19
699000 -- (-771.491) (-767.813) (-770.574) [-767.725] * (-768.927) (-770.093) (-767.175) [-773.200] -- 0:00:19
699500 -- (-769.024) [-767.555] (-774.701) (-771.743) * (-768.768) [-771.628] (-768.248) (-775.643) -- 0:00:19
700000 -- (-768.624) (-769.223) (-771.379) [-768.285] * (-768.180) (-771.208) [-769.173] (-770.708) -- 0:00:19
Average standard deviation of split frequencies: 0.010092
700500 -- (-768.539) (-766.929) (-770.143) [-768.397] * [-768.376] (-768.067) (-768.193) (-768.118) -- 0:00:19
701000 -- (-767.704) (-767.968) (-767.493) [-768.868] * [-767.343] (-768.044) (-771.208) (-767.682) -- 0:00:19
701500 -- (-773.399) [-768.222] (-778.234) (-768.734) * (-768.549) [-766.972] (-769.275) (-770.201) -- 0:00:19
702000 -- (-771.590) (-768.903) (-769.399) [-771.032] * (-770.435) (-767.119) (-768.305) [-768.825] -- 0:00:19
702500 -- (-771.758) (-768.820) [-769.353] (-776.225) * (-768.696) (-768.550) (-767.310) [-769.172] -- 0:00:19
703000 -- (-768.707) [-769.642] (-769.133) (-772.249) * (-772.545) (-769.903) [-770.782] (-771.240) -- 0:00:19
703500 -- (-771.302) (-774.314) (-770.012) [-768.091] * [-769.632] (-772.408) (-769.600) (-768.475) -- 0:00:19
704000 -- [-770.808] (-768.519) (-768.292) (-772.770) * (-767.299) (-770.061) (-774.030) [-767.484] -- 0:00:19
704500 -- (-780.051) (-768.060) [-768.502] (-769.363) * (-769.149) [-769.212] (-767.899) (-770.354) -- 0:00:19
705000 -- (-767.935) [-768.256] (-768.956) (-767.904) * (-771.389) [-768.115] (-768.161) (-770.934) -- 0:00:19
Average standard deviation of split frequencies: 0.009932
705500 -- [-770.977] (-768.951) (-768.330) (-768.328) * (-768.325) (-772.082) (-770.027) [-772.391] -- 0:00:19
706000 -- (-770.676) (-771.029) (-767.712) [-768.319] * (-770.203) (-772.149) (-768.862) [-768.286] -- 0:00:19
706500 -- (-770.049) (-767.814) (-768.006) [-770.373] * [-767.548] (-770.639) (-768.956) (-769.313) -- 0:00:19
707000 -- (-771.993) [-767.779] (-770.790) (-772.312) * (-769.511) (-767.866) (-770.737) [-769.472] -- 0:00:19
707500 -- (-771.956) [-770.872] (-769.357) (-767.970) * (-767.463) (-771.290) [-772.451] (-768.643) -- 0:00:19
708000 -- (-770.245) (-768.962) [-769.088] (-768.022) * (-769.459) (-771.043) [-769.124] (-769.886) -- 0:00:19
708500 -- (-771.799) [-770.995] (-770.710) (-770.488) * (-769.933) (-769.741) (-769.154) [-767.695] -- 0:00:19
709000 -- (-770.063) [-769.457] (-770.213) (-770.140) * [-767.234] (-773.825) (-769.159) (-772.621) -- 0:00:19
709500 -- (-768.865) (-767.201) (-772.444) [-770.550] * [-769.735] (-768.477) (-769.880) (-770.555) -- 0:00:19
710000 -- [-768.599] (-768.432) (-770.296) (-771.161) * (-769.777) (-771.163) (-768.702) [-767.404] -- 0:00:19
Average standard deviation of split frequencies: 0.010340
710500 -- (-770.788) [-769.718] (-769.589) (-768.871) * (-771.871) (-769.684) [-767.303] (-768.325) -- 0:00:19
711000 -- (-769.666) (-769.700) (-768.732) [-768.568] * (-767.818) (-769.090) [-767.726] (-770.176) -- 0:00:19
711500 -- (-771.142) [-769.071] (-769.264) (-769.897) * (-767.878) (-770.358) [-771.252] (-770.509) -- 0:00:19
712000 -- (-770.677) (-768.944) (-775.987) [-768.169] * (-771.541) [-769.559] (-772.922) (-768.244) -- 0:00:19
712500 -- (-769.293) (-768.168) (-773.246) [-773.011] * (-768.870) [-768.295] (-773.313) (-768.691) -- 0:00:18
713000 -- (-786.125) (-768.818) (-768.194) [-772.758] * [-769.654] (-774.118) (-769.589) (-771.776) -- 0:00:18
713500 -- [-771.640] (-767.303) (-768.853) (-771.410) * (-768.092) (-769.450) (-767.551) [-769.922] -- 0:00:18
714000 -- (-774.008) (-767.349) (-770.777) [-770.394] * (-768.131) (-768.154) (-768.238) [-769.101] -- 0:00:18
714500 -- (-771.113) (-767.195) (-769.703) [-768.757] * (-768.400) (-773.326) [-770.060] (-768.164) -- 0:00:18
715000 -- [-771.672] (-771.133) (-767.955) (-771.300) * (-775.010) (-768.180) (-769.680) [-768.552] -- 0:00:18
Average standard deviation of split frequencies: 0.009656
715500 -- (-767.611) (-772.275) [-770.339] (-768.362) * (-768.891) (-768.225) (-771.125) [-768.509] -- 0:00:18
716000 -- [-767.784] (-774.122) (-774.740) (-767.590) * (-768.665) [-767.878] (-768.480) (-768.713) -- 0:00:18
716500 -- [-768.533] (-768.249) (-771.884) (-772.950) * (-770.911) (-768.182) (-768.815) [-770.090] -- 0:00:18
717000 -- (-775.803) [-769.072] (-768.087) (-769.102) * (-773.933) [-769.387] (-769.688) (-770.219) -- 0:00:18
717500 -- (-768.889) [-768.316] (-768.032) (-770.729) * [-768.760] (-769.317) (-767.759) (-769.865) -- 0:00:18
718000 -- (-768.846) [-767.230] (-769.598) (-767.647) * (-770.475) (-769.580) [-768.019] (-770.803) -- 0:00:18
718500 -- (-768.846) (-769.524) (-768.945) [-768.216] * (-771.129) (-769.376) (-767.817) [-768.497] -- 0:00:18
719000 -- (-770.500) (-773.040) [-770.387] (-769.834) * [-771.404] (-771.000) (-768.523) (-769.772) -- 0:00:18
719500 -- (-770.164) (-770.213) [-769.783] (-773.378) * (-769.518) [-768.002] (-769.183) (-769.003) -- 0:00:18
720000 -- [-773.029] (-769.490) (-769.705) (-771.879) * [-771.331] (-767.294) (-767.765) (-769.511) -- 0:00:18
Average standard deviation of split frequencies: 0.009550
720500 -- [-768.072] (-773.660) (-770.102) (-770.380) * (-767.759) (-770.734) [-768.464] (-770.483) -- 0:00:18
721000 -- (-771.591) (-770.402) (-771.079) [-769.540] * (-769.378) [-768.243] (-770.434) (-768.925) -- 0:00:18
721500 -- (-768.857) (-778.162) (-770.301) [-768.591] * (-768.331) (-770.976) [-772.769] (-768.453) -- 0:00:18
722000 -- (-769.805) (-772.361) [-771.884] (-767.955) * (-771.736) (-769.063) [-774.874] (-770.867) -- 0:00:18
722500 -- [-772.367] (-769.066) (-771.131) (-769.359) * (-769.990) (-767.931) [-768.818] (-770.493) -- 0:00:18
723000 -- [-770.428] (-767.759) (-770.687) (-769.392) * [-770.010] (-767.296) (-771.897) (-768.734) -- 0:00:18
723500 -- [-768.501] (-771.949) (-768.835) (-767.740) * (-771.465) (-767.888) [-768.307] (-769.190) -- 0:00:18
724000 -- (-770.607) (-767.352) (-768.538) [-770.473] * (-768.030) (-772.132) [-768.625] (-767.270) -- 0:00:18
724500 -- (-771.053) (-769.204) (-769.282) [-767.981] * (-769.705) (-768.549) [-770.978] (-768.774) -- 0:00:18
725000 -- (-770.890) [-770.270] (-768.148) (-769.367) * (-767.967) (-769.994) (-769.099) [-768.013] -- 0:00:18
Average standard deviation of split frequencies: 0.010024
725500 -- (-775.993) [-768.056] (-769.135) (-768.358) * (-767.989) [-769.410] (-773.709) (-770.586) -- 0:00:18
726000 -- (-772.728) [-768.438] (-767.781) (-768.585) * [-768.302] (-768.596) (-769.243) (-768.396) -- 0:00:18
726500 -- (-768.787) (-774.709) [-767.695] (-768.531) * (-768.821) (-770.344) (-769.045) [-770.321] -- 0:00:18
727000 -- (-767.666) [-767.911] (-767.403) (-767.438) * (-770.704) (-770.122) [-769.001] (-771.975) -- 0:00:18
727500 -- [-768.885] (-769.286) (-768.826) (-767.430) * (-770.859) (-770.116) (-767.863) [-771.479] -- 0:00:17
728000 -- (-771.215) [-769.172] (-769.918) (-768.436) * (-768.316) (-768.187) (-767.942) [-769.887] -- 0:00:17
728500 -- (-768.075) (-772.543) [-769.780] (-769.607) * (-768.445) (-770.700) [-769.092] (-770.272) -- 0:00:17
729000 -- (-769.491) (-777.019) [-769.455] (-771.548) * (-767.476) (-768.421) (-770.306) [-770.449] -- 0:00:17
729500 -- (-768.571) (-770.059) [-769.538] (-768.282) * (-768.382) (-770.434) [-767.565] (-768.930) -- 0:00:17
730000 -- [-767.612] (-770.975) (-769.096) (-769.169) * (-769.778) [-768.643] (-772.264) (-767.904) -- 0:00:17
Average standard deviation of split frequencies: 0.010081
730500 -- (-769.985) (-771.635) [-769.236] (-770.019) * (-771.579) [-769.567] (-771.235) (-767.665) -- 0:00:17
731000 -- (-769.767) (-772.035) [-768.613] (-769.228) * (-769.514) [-769.455] (-772.472) (-767.081) -- 0:00:17
731500 -- [-768.483] (-772.566) (-771.919) (-768.498) * [-769.537] (-768.260) (-767.117) (-768.032) -- 0:00:17
732000 -- (-768.161) (-768.589) (-769.875) [-768.179] * (-769.373) (-770.346) (-767.396) [-767.279] -- 0:00:17
732500 -- (-770.236) [-767.259] (-769.978) (-768.117) * (-769.839) (-770.056) (-766.906) [-770.237] -- 0:00:17
733000 -- [-769.019] (-769.080) (-769.763) (-769.725) * (-767.945) (-771.784) [-770.516] (-772.028) -- 0:00:17
733500 -- [-770.410] (-771.899) (-770.577) (-767.660) * [-771.473] (-767.853) (-768.173) (-770.270) -- 0:00:17
734000 -- (-770.321) [-769.632] (-772.648) (-768.260) * (-770.379) (-770.185) [-771.705] (-769.724) -- 0:00:17
734500 -- [-768.836] (-767.566) (-767.955) (-768.589) * (-768.577) [-769.460] (-774.330) (-769.921) -- 0:00:17
735000 -- (-767.531) (-769.802) [-767.870] (-772.428) * (-768.996) (-770.490) (-779.748) [-769.267] -- 0:00:17
Average standard deviation of split frequencies: 0.009888
735500 -- (-767.834) [-768.684] (-775.080) (-768.227) * [-768.258] (-767.508) (-768.182) (-770.233) -- 0:00:17
736000 -- (-770.583) [-769.379] (-773.002) (-769.411) * (-770.550) [-767.508] (-769.599) (-769.648) -- 0:00:17
736500 -- [-768.460] (-768.093) (-770.624) (-769.390) * (-767.964) (-769.563) (-768.377) [-768.207] -- 0:00:17
737000 -- (-768.731) (-772.124) [-768.610] (-768.727) * (-768.209) [-767.118] (-771.418) (-769.841) -- 0:00:17
737500 -- [-768.124] (-768.253) (-768.245) (-771.956) * (-767.976) (-768.594) [-768.245] (-771.207) -- 0:00:17
738000 -- (-767.721) [-768.447] (-777.577) (-768.104) * (-768.485) (-769.147) (-769.325) [-767.994] -- 0:00:17
738500 -- (-769.024) [-770.431] (-772.695) (-768.313) * (-769.391) (-769.757) (-769.263) [-768.321] -- 0:00:17
739000 -- (-770.220) [-768.427] (-769.561) (-769.431) * (-773.004) (-769.441) (-769.496) [-768.282] -- 0:00:17
739500 -- [-772.477] (-768.900) (-769.635) (-768.897) * (-769.738) (-768.733) (-768.497) [-768.741] -- 0:00:17
740000 -- (-768.295) (-767.058) (-769.443) [-770.212] * (-769.245) (-770.779) (-771.260) [-771.331] -- 0:00:17
Average standard deviation of split frequencies: 0.010342
740500 -- (-769.302) (-768.596) (-771.393) [-768.217] * (-769.980) [-770.207] (-770.459) (-770.244) -- 0:00:17
741000 -- (-769.284) (-768.396) [-770.415] (-772.649) * (-768.804) (-771.354) [-769.690] (-772.879) -- 0:00:17
741500 -- (-767.110) [-768.116] (-769.746) (-774.303) * [-768.580] (-769.389) (-769.410) (-771.398) -- 0:00:17
742000 -- (-767.110) (-768.118) (-772.554) [-769.262] * [-770.961] (-767.776) (-771.117) (-769.247) -- 0:00:17
742500 -- (-770.761) [-768.044] (-769.596) (-768.916) * (-773.744) [-767.443] (-772.804) (-767.691) -- 0:00:16
743000 -- (-768.681) (-768.054) [-768.291] (-767.080) * (-769.272) (-768.841) (-770.571) [-767.525] -- 0:00:16
743500 -- (-769.392) (-768.600) [-768.402] (-767.949) * (-772.743) [-768.121] (-771.205) (-768.061) -- 0:00:16
744000 -- [-768.869] (-768.591) (-768.472) (-770.697) * [-767.411] (-768.880) (-767.978) (-768.341) -- 0:00:16
744500 -- (-770.022) [-771.281] (-770.238) (-769.011) * (-767.941) (-768.252) (-770.174) [-767.970] -- 0:00:16
745000 -- (-768.883) [-771.848] (-768.320) (-767.729) * (-767.992) (-770.769) [-767.451] (-770.090) -- 0:00:16
Average standard deviation of split frequencies: 0.010427
745500 -- (-769.119) (-773.252) [-768.256] (-768.246) * (-769.344) (-770.448) [-769.727] (-770.262) -- 0:00:16
746000 -- (-770.955) (-768.388) (-767.834) [-769.353] * (-769.267) (-768.021) (-769.427) [-768.419] -- 0:00:16
746500 -- (-771.903) (-768.305) (-769.793) [-768.523] * (-770.041) [-769.310] (-767.585) (-768.450) -- 0:00:16
747000 -- (-767.792) [-769.118] (-768.135) (-769.035) * (-773.979) (-772.093) (-767.849) [-767.797] -- 0:00:16
747500 -- (-772.830) (-775.138) (-769.562) [-767.749] * (-773.716) [-770.693] (-770.052) (-768.939) -- 0:00:16
748000 -- (-769.405) (-774.033) [-767.969] (-769.852) * (-767.978) [-769.577] (-775.400) (-769.994) -- 0:00:16
748500 -- [-767.649] (-769.315) (-769.272) (-769.457) * (-769.570) [-772.083] (-768.803) (-768.239) -- 0:00:16
749000 -- [-769.512] (-767.935) (-767.724) (-768.130) * (-769.452) (-773.358) [-768.261] (-769.483) -- 0:00:16
749500 -- (-773.224) (-771.469) (-768.132) [-768.091] * (-768.254) [-771.922] (-768.376) (-768.786) -- 0:00:16
750000 -- (-772.851) (-776.692) (-768.607) [-769.350] * (-767.638) [-767.790] (-775.367) (-768.816) -- 0:00:16
Average standard deviation of split frequencies: 0.010244
750500 -- (-773.787) (-770.290) [-769.748] (-768.122) * (-769.555) (-770.104) (-771.334) [-770.647] -- 0:00:16
751000 -- (-773.123) [-768.215] (-767.759) (-769.345) * (-767.936) (-771.294) [-770.551] (-768.217) -- 0:00:16
751500 -- (-769.986) [-768.717] (-769.638) (-772.966) * [-768.501] (-769.337) (-770.913) (-767.712) -- 0:00:16
752000 -- (-769.516) (-770.078) [-768.986] (-773.513) * (-767.373) (-769.204) [-767.562] (-770.236) -- 0:00:16
752500 -- (-771.575) [-767.678] (-771.938) (-775.815) * (-769.477) (-767.878) [-768.259] (-770.245) -- 0:00:16
753000 -- (-769.707) (-768.018) [-767.857] (-769.150) * (-770.196) (-770.090) (-771.696) [-768.520] -- 0:00:16
753500 -- (-767.991) (-768.762) [-769.833] (-769.055) * (-768.296) (-768.845) [-770.897] (-771.268) -- 0:00:16
754000 -- (-767.426) (-768.757) (-769.062) [-768.517] * (-767.226) (-767.684) (-770.056) [-768.862] -- 0:00:16
754500 -- [-768.599] (-769.538) (-769.715) (-769.155) * (-769.883) [-767.690] (-769.956) (-770.318) -- 0:00:16
755000 -- (-770.536) (-769.006) (-768.989) [-768.067] * (-768.928) (-769.097) (-774.298) [-769.168] -- 0:00:16
Average standard deviation of split frequencies: 0.010172
755500 -- [-772.031] (-768.600) (-768.823) (-770.932) * (-770.542) [-771.312] (-770.003) (-772.870) -- 0:00:16
756000 -- (-771.486) (-768.548) [-767.671] (-769.853) * (-769.746) [-770.293] (-768.668) (-769.879) -- 0:00:16
756500 -- (-773.621) [-768.707] (-771.863) (-770.680) * [-768.190] (-768.922) (-767.501) (-767.872) -- 0:00:16
757000 -- (-768.052) (-769.040) [-767.674] (-769.534) * (-770.289) [-770.862] (-769.885) (-770.315) -- 0:00:16
757500 -- [-772.315] (-770.455) (-767.576) (-769.208) * (-771.311) (-770.953) (-767.499) [-768.723] -- 0:00:16
758000 -- (-770.874) (-768.428) (-767.460) [-768.456] * (-771.475) [-770.049] (-769.030) (-769.412) -- 0:00:15
758500 -- [-769.566] (-770.196) (-768.758) (-772.829) * [-769.263] (-769.544) (-769.562) (-771.994) -- 0:00:15
759000 -- (-769.138) (-768.706) (-769.388) [-769.666] * [-770.640] (-769.209) (-769.117) (-768.210) -- 0:00:15
759500 -- [-768.608] (-768.949) (-770.264) (-773.693) * (-769.883) (-769.491) [-771.137] (-769.668) -- 0:00:15
760000 -- (-772.368) [-772.806] (-767.615) (-768.110) * [-768.864] (-772.891) (-770.932) (-768.978) -- 0:00:15
Average standard deviation of split frequencies: 0.009954
760500 -- (-771.294) [-768.430] (-773.874) (-768.786) * (-768.798) (-769.763) [-771.110] (-768.722) -- 0:00:15
761000 -- (-771.097) (-767.358) (-769.589) [-767.796] * (-769.049) [-770.132] (-771.070) (-767.891) -- 0:00:15
761500 -- (-772.361) [-768.088] (-771.550) (-769.327) * (-771.732) [-769.615] (-767.932) (-773.897) -- 0:00:15
762000 -- (-770.096) (-768.486) (-769.398) [-770.186] * (-769.763) (-770.232) (-768.065) [-769.071] -- 0:00:15
762500 -- (-770.978) [-770.309] (-774.912) (-773.346) * (-768.848) (-772.001) [-767.968] (-772.971) -- 0:00:15
763000 -- (-769.127) [-769.906] (-767.568) (-770.313) * [-767.973] (-769.767) (-770.045) (-768.166) -- 0:00:15
763500 -- (-770.307) [-771.541] (-768.579) (-773.232) * (-767.309) (-767.439) [-770.366] (-768.125) -- 0:00:15
764000 -- [-769.484] (-768.068) (-771.589) (-770.489) * (-767.567) (-769.030) [-768.950] (-769.465) -- 0:00:15
764500 -- (-768.679) (-770.087) [-770.277] (-777.162) * (-772.337) (-768.172) (-771.695) [-773.919] -- 0:00:15
765000 -- [-774.154] (-771.382) (-771.742) (-768.757) * [-768.039] (-772.970) (-770.719) (-771.894) -- 0:00:15
Average standard deviation of split frequencies: 0.010231
765500 -- (-775.787) [-770.209] (-772.447) (-769.205) * [-770.355] (-767.300) (-768.324) (-770.468) -- 0:00:15
766000 -- (-769.194) (-768.667) (-771.044) [-771.618] * (-770.033) (-768.664) [-772.083] (-769.362) -- 0:00:15
766500 -- (-771.678) (-767.149) (-771.042) [-767.052] * (-772.916) (-771.171) (-767.680) [-767.569] -- 0:00:15
767000 -- (-769.576) (-767.149) [-768.705] (-767.941) * [-769.313] (-768.362) (-767.620) (-767.795) -- 0:00:15
767500 -- [-769.123] (-767.386) (-769.298) (-769.915) * (-769.009) (-771.423) (-769.726) [-768.876] -- 0:00:15
768000 -- [-769.220] (-769.497) (-770.043) (-771.217) * (-772.866) (-773.225) (-770.751) [-770.504] -- 0:00:15
768500 -- (-770.820) (-770.092) (-770.136) [-767.830] * (-768.430) (-767.587) [-768.784] (-769.537) -- 0:00:15
769000 -- [-768.481] (-774.422) (-770.207) (-777.372) * (-772.420) (-768.172) (-769.178) [-771.124] -- 0:00:15
769500 -- [-771.391] (-773.157) (-772.508) (-774.357) * [-768.944] (-770.680) (-769.784) (-769.297) -- 0:00:15
770000 -- (-769.239) (-769.724) (-768.336) [-770.208] * (-770.483) [-771.925] (-768.526) (-769.443) -- 0:00:15
Average standard deviation of split frequencies: 0.010016
770500 -- (-771.430) (-774.009) (-767.838) [-770.055] * (-768.987) (-767.825) [-769.754] (-768.012) -- 0:00:15
771000 -- [-769.055] (-774.172) (-770.253) (-770.963) * (-770.252) (-767.700) [-768.874] (-768.356) -- 0:00:15
771500 -- (-770.088) (-774.208) [-770.367] (-771.652) * (-771.842) (-767.419) [-768.895] (-768.446) -- 0:00:15
772000 -- (-767.495) (-769.945) (-769.418) [-767.991] * [-768.452] (-767.619) (-772.480) (-767.725) -- 0:00:15
772500 -- (-767.483) (-771.253) [-768.382] (-769.265) * (-768.706) (-769.922) (-768.732) [-767.812] -- 0:00:15
773000 -- (-767.374) (-768.549) (-773.130) [-768.982] * (-773.089) (-769.206) (-768.264) [-767.269] -- 0:00:14
773500 -- (-767.502) (-768.198) (-773.198) [-770.385] * [-769.844] (-767.919) (-767.588) (-768.276) -- 0:00:14
774000 -- (-771.215) [-771.013] (-768.743) (-772.661) * (-769.784) (-768.347) (-770.031) [-769.472] -- 0:00:14
774500 -- [-769.750] (-773.554) (-767.684) (-770.580) * (-767.839) [-768.433] (-770.138) (-769.788) -- 0:00:14
775000 -- (-772.468) [-769.809] (-767.763) (-771.581) * (-772.171) (-769.136) (-769.260) [-769.681] -- 0:00:14
Average standard deviation of split frequencies: 0.009682
775500 -- (-771.682) [-767.214] (-771.822) (-770.391) * (-771.169) [-769.561] (-768.499) (-773.536) -- 0:00:14
776000 -- (-774.191) (-770.818) [-768.232] (-772.437) * (-768.843) (-769.223) (-767.836) [-767.747] -- 0:00:14
776500 -- (-773.053) (-767.981) [-769.302] (-767.654) * (-767.105) [-769.182] (-767.796) (-769.980) -- 0:00:14
777000 -- (-774.301) [-769.439] (-770.266) (-769.807) * (-769.355) [-770.145] (-768.450) (-769.272) -- 0:00:14
777500 -- [-769.205] (-767.371) (-768.931) (-772.824) * (-767.390) (-768.945) [-769.091] (-769.319) -- 0:00:14
778000 -- (-767.236) (-769.022) [-769.692] (-780.120) * (-769.003) (-768.058) [-770.099] (-770.685) -- 0:00:14
778500 -- (-770.615) (-768.388) (-769.886) [-774.633] * (-771.563) (-774.119) (-770.693) [-770.228] -- 0:00:14
779000 -- (-771.851) (-769.126) (-768.779) [-768.586] * [-767.589] (-773.913) (-773.927) (-768.501) -- 0:00:14
779500 -- [-770.543] (-768.780) (-767.596) (-767.494) * (-771.602) [-769.193] (-768.499) (-774.031) -- 0:00:14
780000 -- (-768.987) (-769.830) (-768.764) [-770.489] * (-769.702) (-772.579) (-775.680) [-768.694] -- 0:00:14
Average standard deviation of split frequencies: 0.009548
780500 -- [-770.394] (-770.995) (-772.336) (-769.168) * [-770.836] (-769.202) (-768.741) (-770.786) -- 0:00:14
781000 -- (-769.835) (-772.847) [-769.842] (-768.639) * (-770.819) (-769.817) [-770.975] (-773.554) -- 0:00:14
781500 -- (-767.058) [-772.149] (-769.658) (-768.339) * [-770.175] (-768.036) (-768.247) (-770.661) -- 0:00:14
782000 -- (-772.952) (-772.634) (-769.331) [-769.018] * (-769.719) (-768.157) [-767.669] (-768.639) -- 0:00:14
782500 -- [-770.297] (-773.029) (-767.934) (-768.955) * (-769.677) (-769.584) [-767.656] (-770.253) -- 0:00:14
783000 -- (-773.310) (-773.781) (-769.943) [-767.627] * (-772.211) (-769.792) [-768.154] (-771.713) -- 0:00:14
783500 -- (-772.328) (-772.914) (-770.680) [-769.465] * (-773.819) (-772.162) [-767.864] (-768.576) -- 0:00:14
784000 -- (-769.755) [-767.069] (-769.907) (-768.912) * (-770.925) (-769.559) (-768.666) [-768.729] -- 0:00:14
784500 -- (-769.859) (-767.805) (-768.055) [-767.393] * [-769.613] (-767.790) (-768.768) (-768.594) -- 0:00:14
785000 -- (-768.525) (-772.326) [-767.243] (-770.627) * [-767.952] (-767.905) (-769.761) (-770.809) -- 0:00:14
Average standard deviation of split frequencies: 0.009708
785500 -- (-768.639) (-767.822) [-767.895] (-771.273) * [-770.337] (-767.213) (-770.597) (-773.369) -- 0:00:14
786000 -- (-770.136) (-769.406) (-768.415) [-771.664] * (-770.371) [-767.215] (-768.954) (-771.230) -- 0:00:14
786500 -- (-776.199) [-769.853] (-770.915) (-771.780) * (-769.870) (-769.179) (-772.066) [-772.309] -- 0:00:14
787000 -- [-770.225] (-767.961) (-772.000) (-767.457) * (-767.294) [-768.363] (-767.991) (-771.904) -- 0:00:14
787500 -- (-769.899) [-770.048] (-773.173) (-767.918) * (-767.238) [-769.893] (-769.768) (-774.653) -- 0:00:14
788000 -- (-770.790) (-770.507) (-773.139) [-770.355] * (-767.623) (-770.550) (-767.661) [-767.750] -- 0:00:13
788500 -- [-768.617] (-768.808) (-770.166) (-771.246) * [-767.585] (-769.285) (-768.962) (-768.735) -- 0:00:13
789000 -- (-771.296) (-771.041) [-769.105] (-772.679) * (-767.623) [-771.185] (-768.532) (-770.825) -- 0:00:13
789500 -- (-773.213) (-773.037) (-769.971) [-767.973] * [-769.586] (-770.194) (-769.221) (-767.695) -- 0:00:13
790000 -- (-769.655) [-770.654] (-770.160) (-766.915) * (-767.477) [-769.006] (-768.734) (-770.700) -- 0:00:13
Average standard deviation of split frequencies: 0.009241
790500 -- [-769.034] (-770.895) (-768.098) (-767.724) * (-768.716) [-768.007] (-768.681) (-772.865) -- 0:00:13
791000 -- (-770.544) (-768.451) [-767.573] (-767.025) * (-768.674) (-768.739) (-768.548) [-768.130] -- 0:00:13
791500 -- (-769.227) (-767.960) [-769.799] (-770.859) * [-770.161] (-772.976) (-769.203) (-769.679) -- 0:00:13
792000 -- [-767.664] (-767.427) (-770.995) (-769.032) * (-769.803) (-771.313) [-767.805] (-767.279) -- 0:00:13
792500 -- (-768.650) (-767.614) [-770.175] (-768.848) * (-772.705) (-768.067) [-769.945] (-770.607) -- 0:00:13
793000 -- (-768.689) (-770.052) (-771.451) [-768.183] * (-769.962) (-768.919) [-770.291] (-767.599) -- 0:00:13
793500 -- (-769.178) (-771.254) [-768.417] (-770.283) * (-770.855) (-771.148) (-771.223) [-769.786] -- 0:00:13
794000 -- (-768.624) [-772.154] (-767.443) (-770.428) * (-768.316) [-770.130] (-772.655) (-769.647) -- 0:00:13
794500 -- (-768.496) (-771.360) (-768.188) [-770.504] * (-770.884) (-775.362) (-767.691) [-768.772] -- 0:00:13
795000 -- (-767.084) (-770.095) [-769.449] (-767.582) * [-767.874] (-768.054) (-771.119) (-770.130) -- 0:00:13
Average standard deviation of split frequencies: 0.009068
795500 -- (-769.665) (-771.983) [-767.317] (-767.548) * (-767.796) (-770.582) (-769.815) [-770.229] -- 0:00:13
796000 -- (-768.863) (-768.377) (-768.003) [-769.238] * (-768.449) (-768.083) [-769.934] (-768.022) -- 0:00:13
796500 -- (-773.986) (-768.621) [-768.364] (-768.806) * [-770.775] (-768.604) (-768.261) (-768.281) -- 0:00:13
797000 -- (-771.143) (-772.585) [-767.514] (-768.777) * (-769.296) (-770.429) (-769.941) [-771.334] -- 0:00:13
797500 -- (-768.954) (-774.550) [-768.357] (-770.395) * [-770.318] (-768.316) (-769.112) (-768.867) -- 0:00:13
798000 -- (-769.212) [-769.671] (-770.633) (-773.393) * (-768.631) (-768.746) [-771.773] (-771.416) -- 0:00:13
798500 -- [-768.745] (-769.389) (-772.482) (-767.788) * (-768.581) (-769.220) (-770.386) [-770.513] -- 0:00:13
799000 -- (-767.982) [-771.266] (-773.591) (-773.512) * [-771.861] (-770.381) (-768.991) (-769.824) -- 0:00:13
799500 -- [-768.897] (-773.565) (-769.603) (-770.927) * (-770.304) (-768.722) (-768.857) [-768.047] -- 0:00:13
800000 -- [-769.656] (-768.279) (-773.498) (-770.274) * (-767.684) [-768.366] (-770.850) (-767.624) -- 0:00:13
Average standard deviation of split frequencies: 0.008792
800500 -- (-769.836) (-768.845) (-772.053) [-767.681] * (-768.429) [-768.171] (-770.928) (-770.711) -- 0:00:13
801000 -- [-767.953] (-768.707) (-771.707) (-770.008) * (-768.580) [-768.607] (-769.736) (-771.934) -- 0:00:13
801500 -- (-767.022) (-768.508) [-770.942] (-769.055) * [-768.881] (-773.096) (-769.020) (-769.350) -- 0:00:13
802000 -- (-768.191) (-767.514) (-769.858) [-772.390] * (-768.748) (-770.848) [-768.829] (-769.577) -- 0:00:13
802500 -- (-768.632) (-769.459) (-769.207) [-768.105] * (-769.240) [-768.864] (-768.681) (-767.494) -- 0:00:13
803000 -- (-769.383) (-768.844) [-769.099] (-770.059) * (-770.751) [-768.122] (-771.757) (-767.440) -- 0:00:13
803500 -- (-770.614) [-769.487] (-772.066) (-767.954) * (-771.652) [-768.609] (-771.545) (-771.914) -- 0:00:12
804000 -- (-768.108) (-769.253) (-768.981) [-768.658] * (-767.919) (-767.955) (-770.264) [-771.909] -- 0:00:12
804500 -- (-771.712) [-770.059] (-775.460) (-772.805) * (-768.371) [-769.289] (-770.541) (-773.376) -- 0:00:12
805000 -- (-768.453) [-768.164] (-768.023) (-768.031) * (-767.411) (-769.863) [-767.284] (-768.149) -- 0:00:12
Average standard deviation of split frequencies: 0.009029
805500 -- (-767.871) (-769.834) (-767.514) [-768.980] * [-767.745] (-769.253) (-769.832) (-768.702) -- 0:00:12
806000 -- (-767.831) (-768.416) (-769.570) [-769.445] * (-768.208) [-772.323] (-768.992) (-768.485) -- 0:00:12
806500 -- (-769.243) (-768.673) [-769.298] (-768.886) * (-768.828) [-778.223] (-770.306) (-768.236) -- 0:00:12
807000 -- (-770.902) (-769.556) [-769.704] (-767.825) * (-769.845) (-771.000) [-770.096] (-771.461) -- 0:00:12
807500 -- [-767.849] (-769.062) (-767.850) (-769.505) * [-767.666] (-767.947) (-769.892) (-769.400) -- 0:00:12
808000 -- [-769.891] (-770.663) (-768.238) (-768.596) * (-768.761) (-767.262) (-776.720) [-770.246] -- 0:00:12
808500 -- (-767.691) (-773.126) (-767.615) [-771.228] * (-767.805) [-766.966] (-773.312) (-769.174) -- 0:00:12
809000 -- (-769.461) (-768.234) [-767.760] (-770.900) * (-769.851) [-767.448] (-774.402) (-771.693) -- 0:00:12
809500 -- (-769.256) (-772.928) (-769.928) [-767.550] * (-769.311) (-768.022) (-768.617) [-770.149] -- 0:00:12
810000 -- [-768.157] (-769.301) (-769.466) (-768.503) * (-769.691) (-770.547) (-767.594) [-767.452] -- 0:00:12
Average standard deviation of split frequencies: 0.009704
810500 -- (-768.439) [-770.008] (-769.768) (-767.792) * [-769.629] (-770.025) (-768.740) (-768.703) -- 0:00:12
811000 -- (-769.672) [-767.572] (-770.091) (-770.117) * (-771.072) [-771.360] (-767.581) (-768.743) -- 0:00:12
811500 -- [-768.150] (-769.153) (-768.750) (-768.114) * (-771.511) (-773.887) [-767.897] (-768.731) -- 0:00:12
812000 -- (-768.207) [-768.282] (-772.247) (-767.610) * (-772.973) [-770.621] (-768.560) (-768.277) -- 0:00:12
812500 -- (-768.932) [-768.429] (-769.375) (-768.312) * (-769.047) (-769.476) (-770.066) [-769.617] -- 0:00:12
813000 -- (-767.970) [-767.269] (-768.413) (-772.987) * (-768.711) (-769.806) [-768.073] (-769.124) -- 0:00:12
813500 -- (-768.707) [-770.953] (-767.839) (-772.760) * (-769.629) (-768.678) (-768.647) [-768.654] -- 0:00:12
814000 -- (-770.183) (-768.852) [-770.098] (-770.997) * (-771.441) (-769.349) (-772.311) [-768.308] -- 0:00:12
814500 -- [-769.766] (-769.270) (-770.812) (-767.243) * [-768.193] (-768.770) (-770.623) (-772.624) -- 0:00:12
815000 -- (-771.027) (-769.724) (-768.880) [-774.117] * [-772.899] (-768.004) (-770.045) (-771.278) -- 0:00:12
Average standard deviation of split frequencies: 0.009713
815500 -- (-767.298) [-767.452] (-774.834) (-769.789) * (-768.131) [-769.019] (-772.349) (-770.976) -- 0:00:12
816000 -- (-768.707) (-769.283) [-768.957] (-772.054) * (-769.570) (-772.133) [-770.476] (-768.144) -- 0:00:12
816500 -- (-773.147) (-769.043) [-769.739] (-769.550) * (-769.073) (-769.373) [-768.707] (-771.269) -- 0:00:12
817000 -- (-767.771) (-768.462) [-769.398] (-768.074) * (-769.467) (-772.080) [-768.060] (-768.722) -- 0:00:12
817500 -- (-769.478) [-767.738] (-769.010) (-767.088) * (-771.482) (-772.285) (-768.317) [-768.748] -- 0:00:12
818000 -- [-769.714] (-769.621) (-775.110) (-767.284) * (-767.475) (-767.378) (-770.818) [-768.033] -- 0:00:12
818500 -- (-768.794) (-770.437) (-768.157) [-768.689] * (-767.938) [-771.066] (-769.307) (-772.474) -- 0:00:11
819000 -- (-773.074) (-768.746) (-768.912) [-768.720] * [-770.214] (-769.659) (-773.284) (-767.192) -- 0:00:11
819500 -- (-775.041) [-773.219] (-767.832) (-772.406) * (-769.076) (-767.654) [-768.471] (-771.267) -- 0:00:11
820000 -- [-770.587] (-770.713) (-774.289) (-768.672) * [-768.524] (-769.837) (-767.725) (-767.859) -- 0:00:11
Average standard deviation of split frequencies: 0.009837
820500 -- (-768.940) (-771.112) (-769.121) [-767.285] * (-774.729) (-772.791) [-769.879] (-774.757) -- 0:00:11
821000 -- (-769.420) (-771.431) [-767.968] (-768.069) * (-767.644) [-768.277] (-767.328) (-771.504) -- 0:00:11
821500 -- [-768.364] (-769.571) (-771.456) (-773.265) * (-768.879) (-768.118) (-767.541) [-768.296] -- 0:00:11
822000 -- (-771.500) (-774.985) (-769.262) [-769.846] * (-769.778) [-767.251] (-770.419) (-767.819) -- 0:00:11
822500 -- (-773.796) [-769.358] (-770.060) (-774.191) * [-773.041] (-767.902) (-771.702) (-768.707) -- 0:00:11
823000 -- [-770.824] (-769.858) (-771.677) (-771.174) * (-771.977) [-767.993] (-771.658) (-768.340) -- 0:00:11
823500 -- (-773.727) (-769.670) [-767.289] (-769.011) * (-769.961) (-768.411) [-773.348] (-768.457) -- 0:00:11
824000 -- (-771.569) (-767.559) (-767.753) [-769.321] * [-767.872] (-767.853) (-768.541) (-768.736) -- 0:00:11
824500 -- (-769.211) (-769.401) [-767.737] (-768.231) * (-771.262) (-767.447) (-770.618) [-768.212] -- 0:00:11
825000 -- (-771.133) (-768.945) [-768.219] (-769.372) * [-772.621] (-768.539) (-770.720) (-768.646) -- 0:00:11
Average standard deviation of split frequencies: 0.009809
825500 -- [-769.548] (-773.235) (-767.755) (-770.483) * [-767.849] (-767.300) (-771.156) (-778.276) -- 0:00:11
826000 -- [-772.543] (-772.178) (-768.406) (-771.169) * (-770.019) [-767.105] (-769.929) (-773.007) -- 0:00:11
826500 -- (-767.748) (-770.665) (-770.498) [-770.163] * [-771.046] (-772.105) (-769.237) (-767.843) -- 0:00:11
827000 -- [-767.540] (-769.565) (-767.748) (-769.734) * (-768.617) (-768.201) (-773.085) [-768.205] -- 0:00:11
827500 -- [-767.521] (-768.542) (-768.454) (-768.890) * [-769.015] (-769.339) (-769.302) (-771.117) -- 0:00:11
828000 -- (-768.130) (-769.754) (-767.376) [-769.588] * [-769.784] (-768.954) (-769.710) (-769.358) -- 0:00:11
828500 -- [-767.754] (-768.468) (-769.230) (-770.710) * [-769.462] (-768.942) (-769.992) (-768.242) -- 0:00:11
829000 -- (-774.023) (-769.040) [-770.832] (-772.636) * [-769.185] (-770.420) (-768.244) (-769.939) -- 0:00:11
829500 -- [-772.045] (-771.682) (-769.498) (-768.384) * (-770.288) (-768.695) (-769.182) [-768.144] -- 0:00:11
830000 -- [-770.870] (-767.465) (-769.286) (-769.060) * (-767.175) [-768.096] (-768.768) (-767.392) -- 0:00:11
Average standard deviation of split frequencies: 0.009860
830500 -- (-768.494) [-775.119] (-769.602) (-770.116) * [-767.377] (-768.540) (-766.885) (-767.573) -- 0:00:11
831000 -- (-767.862) (-779.103) (-771.251) [-770.963] * (-770.609) (-774.671) [-768.802] (-772.186) -- 0:00:11
831500 -- (-770.406) [-769.726] (-770.050) (-767.704) * (-767.862) (-770.395) [-768.120] (-772.117) -- 0:00:11
832000 -- (-769.784) [-771.184] (-768.363) (-768.282) * (-769.615) (-769.870) [-768.668] (-775.648) -- 0:00:11
832500 -- (-767.511) (-771.086) (-768.346) [-768.857] * [-768.869] (-770.612) (-767.933) (-777.376) -- 0:00:11
833000 -- [-769.260] (-769.350) (-768.104) (-770.082) * (-769.999) (-769.539) [-769.161] (-768.308) -- 0:00:11
833500 -- (-768.856) (-775.011) (-767.520) [-767.954] * (-771.140) (-767.660) [-768.630] (-773.261) -- 0:00:10
834000 -- (-768.114) [-767.895] (-773.144) (-771.596) * (-767.874) [-767.087] (-767.788) (-769.008) -- 0:00:10
834500 -- (-768.691) (-767.413) (-773.303) [-774.111] * (-768.266) (-768.749) (-769.485) [-768.790] -- 0:00:10
835000 -- (-768.991) [-767.850] (-771.546) (-768.091) * [-767.864] (-767.482) (-771.672) (-769.568) -- 0:00:10
Average standard deviation of split frequencies: 0.009445
835500 -- (-774.157) (-767.614) (-772.989) [-767.913] * (-770.127) (-768.742) [-773.224] (-769.294) -- 0:00:10
836000 -- (-773.748) (-768.824) (-770.729) [-768.513] * (-769.476) [-770.948] (-770.202) (-769.257) -- 0:00:10
836500 -- (-769.395) (-769.753) [-769.391] (-768.959) * (-767.797) [-768.716] (-770.062) (-773.248) -- 0:00:10
837000 -- [-768.959] (-770.807) (-768.835) (-768.171) * (-767.411) (-768.848) (-770.615) [-771.829] -- 0:00:10
837500 -- (-771.926) (-769.645) [-772.066] (-773.817) * (-768.082) (-769.678) (-767.662) [-767.782] -- 0:00:10
838000 -- (-768.336) [-768.354] (-768.530) (-777.880) * [-769.026] (-769.022) (-768.315) (-768.549) -- 0:00:10
838500 -- (-768.750) [-770.676] (-767.991) (-769.411) * (-768.819) (-768.092) (-771.659) [-770.326] -- 0:00:10
839000 -- [-769.507] (-770.752) (-767.900) (-769.080) * (-767.607) (-767.286) [-774.429] (-769.974) -- 0:00:10
839500 -- (-768.096) [-767.228] (-771.982) (-771.659) * [-769.331] (-767.435) (-771.991) (-769.011) -- 0:00:10
840000 -- (-768.075) (-771.176) [-769.880] (-769.955) * (-767.897) (-767.291) (-772.844) [-770.599] -- 0:00:10
Average standard deviation of split frequencies: 0.008972
840500 -- (-769.498) [-768.646] (-772.064) (-769.412) * (-767.716) (-768.619) [-769.329] (-768.901) -- 0:00:10
841000 -- [-769.036] (-771.275) (-772.979) (-769.254) * [-769.227] (-769.284) (-769.464) (-768.430) -- 0:00:10
841500 -- (-768.063) (-769.251) [-767.191] (-769.174) * (-768.159) (-770.037) [-767.659] (-768.518) -- 0:00:10
842000 -- (-769.447) (-773.687) [-770.144] (-771.324) * (-769.115) (-771.584) (-767.704) [-768.274] -- 0:00:10
842500 -- (-768.034) [-768.287] (-769.817) (-768.781) * (-768.051) (-770.200) (-769.468) [-769.451] -- 0:00:10
843000 -- (-768.878) [-770.597] (-770.328) (-770.053) * (-767.820) (-769.926) [-768.520] (-770.133) -- 0:00:10
843500 -- (-770.603) (-770.685) [-768.041] (-768.369) * (-768.469) (-770.512) [-768.602] (-769.781) -- 0:00:10
844000 -- (-768.142) (-769.183) [-769.390] (-768.394) * (-767.508) [-768.674] (-768.417) (-768.575) -- 0:00:10
844500 -- (-768.675) [-770.269] (-767.592) (-771.689) * (-767.356) [-770.150] (-769.387) (-769.249) -- 0:00:10
845000 -- (-768.397) (-769.757) [-767.742] (-768.676) * [-767.598] (-772.130) (-776.074) (-779.608) -- 0:00:10
Average standard deviation of split frequencies: 0.009055
845500 -- (-768.989) (-768.759) (-768.518) [-768.328] * (-767.782) [-770.820] (-771.483) (-770.092) -- 0:00:10
846000 -- (-771.355) (-771.405) [-771.855] (-768.253) * [-769.995] (-768.655) (-770.016) (-769.153) -- 0:00:10
846500 -- (-772.338) (-772.143) [-768.025] (-768.678) * (-769.014) [-768.292] (-770.317) (-767.694) -- 0:00:10
847000 -- [-772.102] (-773.782) (-767.769) (-768.569) * (-768.917) [-767.500] (-769.665) (-768.522) -- 0:00:10
847500 -- (-770.668) (-772.202) (-768.057) [-769.250] * (-768.193) (-769.111) [-772.738] (-770.426) -- 0:00:10
848000 -- (-768.689) (-768.390) (-773.907) [-769.436] * (-774.133) (-769.096) (-770.140) [-768.991] -- 0:00:10
848500 -- (-771.119) [-767.615] (-775.387) (-772.987) * [-770.202] (-768.834) (-769.849) (-770.497) -- 0:00:09
849000 -- (-769.031) (-768.491) [-771.312] (-770.335) * (-768.660) (-770.615) (-773.474) [-768.382] -- 0:00:09
849500 -- [-770.935] (-770.915) (-767.657) (-769.643) * (-767.799) (-768.802) [-768.624] (-772.312) -- 0:00:09
850000 -- [-768.870] (-768.287) (-767.495) (-767.871) * (-769.452) [-770.309] (-768.657) (-774.209) -- 0:00:09
Average standard deviation of split frequencies: 0.009490
850500 -- (-770.582) [-768.395] (-770.922) (-768.482) * (-770.314) [-769.398] (-768.966) (-769.396) -- 0:00:09
851000 -- (-769.142) (-768.812) [-767.563] (-767.647) * (-772.345) (-772.827) [-771.630] (-767.906) -- 0:00:09
851500 -- (-768.975) [-774.252] (-769.041) (-767.687) * (-768.962) (-773.079) [-770.033] (-768.126) -- 0:00:09
852000 -- (-769.808) (-769.567) (-768.113) [-767.934] * [-768.470] (-768.085) (-767.655) (-771.120) -- 0:00:09
852500 -- [-770.112] (-768.189) (-767.778) (-771.059) * (-771.860) (-772.862) [-771.183] (-769.160) -- 0:00:09
853000 -- (-767.459) (-767.657) [-767.763] (-767.475) * (-768.497) (-771.599) [-767.735] (-768.413) -- 0:00:09
853500 -- (-768.567) (-769.106) [-770.191] (-768.468) * [-768.870] (-780.191) (-767.591) (-769.571) -- 0:00:09
854000 -- (-767.826) (-770.298) [-768.036] (-768.702) * (-772.287) [-768.927] (-767.631) (-775.117) -- 0:00:09
854500 -- (-770.802) (-769.707) (-768.048) [-768.010] * [-769.085] (-770.913) (-768.264) (-771.096) -- 0:00:09
855000 -- (-770.683) (-768.441) (-769.709) [-767.823] * (-772.192) (-768.299) [-768.664] (-774.046) -- 0:00:09
Average standard deviation of split frequencies: 0.009399
855500 -- (-768.916) (-769.503) (-771.168) [-767.957] * (-772.673) (-768.920) [-768.828] (-768.133) -- 0:00:09
856000 -- (-768.934) (-770.015) (-773.636) [-769.482] * (-769.344) (-769.882) (-768.291) [-769.434] -- 0:00:09
856500 -- [-768.624] (-767.305) (-771.699) (-769.103) * (-769.866) (-767.536) (-769.357) [-771.552] -- 0:00:09
857000 -- (-767.598) [-768.737] (-769.989) (-768.752) * (-769.063) [-768.983] (-771.220) (-775.939) -- 0:00:09
857500 -- [-768.487] (-767.814) (-770.331) (-768.165) * [-769.081] (-771.138) (-770.983) (-773.207) -- 0:00:09
858000 -- [-767.122] (-767.805) (-768.875) (-767.382) * [-767.038] (-768.247) (-769.606) (-769.128) -- 0:00:09
858500 -- (-770.633) (-770.192) (-768.598) [-767.990] * (-772.304) (-775.816) (-769.528) [-767.887] -- 0:00:09
859000 -- (-771.552) (-768.982) (-770.780) [-768.155] * (-768.309) (-767.991) (-768.610) [-767.707] -- 0:00:09
859500 -- (-769.722) [-767.907] (-769.097) (-768.297) * (-768.274) (-768.493) (-773.055) [-768.261] -- 0:00:09
860000 -- (-769.954) (-769.864) (-770.918) [-770.670] * (-768.607) [-769.865] (-769.139) (-775.039) -- 0:00:09
Average standard deviation of split frequencies: 0.009603
860500 -- [-770.004] (-770.304) (-769.350) (-769.287) * (-768.713) [-769.709] (-768.371) (-773.183) -- 0:00:09
861000 -- (-769.007) [-769.484] (-771.797) (-770.653) * (-770.491) (-769.603) [-769.517] (-773.830) -- 0:00:09
861500 -- (-767.517) [-768.490] (-768.349) (-773.485) * (-773.653) [-768.897] (-773.419) (-767.183) -- 0:00:09
862000 -- [-768.084] (-769.149) (-769.194) (-770.563) * [-767.910] (-770.329) (-772.999) (-769.222) -- 0:00:09
862500 -- (-767.737) (-768.042) [-769.076] (-772.326) * (-772.274) (-771.951) [-769.104] (-769.598) -- 0:00:09
863000 -- (-767.672) [-770.529] (-769.601) (-767.791) * (-769.134) [-771.029] (-771.254) (-769.150) -- 0:00:09
863500 -- [-773.795] (-770.521) (-769.749) (-769.048) * (-769.808) (-769.936) [-768.336] (-767.355) -- 0:00:09
864000 -- (-770.930) (-768.819) [-768.169] (-768.662) * [-768.281] (-771.201) (-771.764) (-767.303) -- 0:00:08
864500 -- [-769.637] (-773.260) (-770.034) (-767.866) * (-767.375) [-771.938] (-767.709) (-772.295) -- 0:00:08
865000 -- [-767.458] (-770.624) (-769.169) (-769.811) * [-768.651] (-769.833) (-768.295) (-773.284) -- 0:00:08
Average standard deviation of split frequencies: 0.009581
865500 -- (-768.268) [-768.684] (-769.073) (-768.615) * (-770.412) (-769.110) [-770.629] (-770.005) -- 0:00:08
866000 -- [-767.801] (-768.643) (-769.650) (-768.700) * [-769.223] (-767.471) (-767.694) (-768.833) -- 0:00:08
866500 -- [-769.892] (-768.976) (-769.442) (-767.483) * (-768.428) (-768.003) [-768.175] (-769.445) -- 0:00:08
867000 -- (-773.603) (-770.447) [-769.142] (-767.140) * (-769.211) [-768.752] (-767.587) (-771.993) -- 0:00:08
867500 -- (-770.663) (-774.908) [-768.193] (-767.000) * (-768.463) (-769.032) (-768.343) [-767.760] -- 0:00:08
868000 -- [-769.841] (-769.209) (-769.389) (-767.017) * (-768.472) [-770.758] (-768.077) (-768.160) -- 0:00:08
868500 -- (-771.680) [-769.772] (-769.461) (-767.446) * (-772.099) [-769.086] (-768.352) (-767.908) -- 0:00:08
869000 -- (-771.581) (-769.760) [-767.773] (-769.748) * (-769.306) [-768.497] (-769.166) (-768.172) -- 0:00:08
869500 -- (-771.295) [-768.618] (-769.800) (-769.882) * [-767.648] (-769.414) (-768.914) (-769.492) -- 0:00:08
870000 -- (-768.420) (-767.783) (-770.621) [-768.195] * [-767.679] (-777.926) (-768.413) (-770.012) -- 0:00:08
Average standard deviation of split frequencies: 0.009204
870500 -- (-770.428) (-768.217) (-768.141) [-774.243] * [-767.769] (-776.109) (-767.698) (-771.525) -- 0:00:08
871000 -- (-769.303) (-772.710) [-768.281] (-770.600) * (-772.232) [-767.728] (-769.483) (-770.315) -- 0:00:08
871500 -- (-779.355) [-770.153] (-769.314) (-772.009) * (-773.461) [-768.018] (-768.997) (-767.942) -- 0:00:08
872000 -- (-771.848) [-768.114] (-771.674) (-770.378) * [-774.097] (-770.929) (-768.671) (-769.568) -- 0:00:08
872500 -- (-769.069) (-769.931) (-771.172) [-772.927] * (-772.561) [-768.604] (-768.901) (-770.886) -- 0:00:08
873000 -- [-768.238] (-770.785) (-768.188) (-769.837) * (-772.523) (-768.157) (-766.949) [-772.667] -- 0:00:08
873500 -- (-775.438) (-768.476) [-774.452] (-773.662) * (-767.885) [-767.358] (-767.415) (-771.069) -- 0:00:08
874000 -- (-772.869) [-771.304] (-768.809) (-769.367) * [-769.832] (-769.930) (-767.745) (-769.378) -- 0:00:08
874500 -- [-775.061] (-770.240) (-768.477) (-768.350) * (-768.101) (-771.894) [-771.877] (-768.845) -- 0:00:08
875000 -- (-772.440) (-767.721) (-769.613) [-769.620] * [-770.267] (-771.810) (-769.557) (-767.969) -- 0:00:08
Average standard deviation of split frequencies: 0.009435
875500 -- (-769.288) (-770.426) (-767.575) [-770.110] * (-768.905) (-772.289) [-769.433] (-769.973) -- 0:00:08
876000 -- (-770.141) (-768.807) [-769.565] (-771.205) * (-767.762) (-772.210) [-769.435] (-768.906) -- 0:00:08
876500 -- (-766.982) (-767.450) [-769.438] (-770.085) * (-771.705) [-768.775] (-769.677) (-768.020) -- 0:00:08
877000 -- [-767.307] (-769.349) (-768.942) (-769.620) * (-769.078) [-769.490] (-770.642) (-768.605) -- 0:00:08
877500 -- (-767.165) (-771.824) [-768.902] (-773.005) * (-774.540) (-770.120) (-772.696) [-769.007] -- 0:00:08
878000 -- [-769.875] (-768.171) (-771.492) (-769.462) * (-771.631) [-768.675] (-770.771) (-774.141) -- 0:00:08
878500 -- [-771.689] (-768.451) (-769.338) (-770.600) * [-770.644] (-768.662) (-771.110) (-769.985) -- 0:00:08
879000 -- (-771.139) (-769.349) [-773.695] (-770.863) * [-772.234] (-768.200) (-770.671) (-770.400) -- 0:00:07
879500 -- (-769.437) (-769.429) (-768.334) [-767.619] * (-768.781) [-768.902] (-767.313) (-769.768) -- 0:00:07
880000 -- [-767.840] (-768.694) (-768.648) (-768.295) * (-773.187) [-767.688] (-767.486) (-767.888) -- 0:00:07
Average standard deviation of split frequencies: 0.009778
880500 -- (-769.072) (-768.671) [-769.509] (-767.814) * (-771.781) (-769.664) (-769.702) [-768.624] -- 0:00:07
881000 -- (-770.074) (-767.568) (-770.309) [-767.779] * (-768.729) [-767.394] (-768.253) (-768.701) -- 0:00:07
881500 -- [-771.646] (-768.998) (-769.296) (-767.650) * [-768.620] (-769.962) (-768.493) (-774.867) -- 0:00:07
882000 -- (-768.582) (-769.189) (-771.988) [-771.320] * (-769.719) [-772.725] (-771.328) (-770.379) -- 0:00:07
882500 -- (-774.758) [-768.638] (-768.074) (-769.814) * [-769.521] (-771.522) (-768.127) (-769.228) -- 0:00:07
883000 -- (-767.352) (-770.266) [-768.257] (-768.265) * (-768.331) (-768.793) (-772.069) [-767.944] -- 0:00:07
883500 -- (-767.785) (-771.951) [-770.769] (-767.362) * [-771.275] (-769.443) (-767.677) (-768.335) -- 0:00:07
884000 -- [-768.729] (-768.132) (-769.911) (-771.524) * (-769.680) (-770.924) [-770.197] (-768.106) -- 0:00:07
884500 -- [-768.686] (-768.849) (-769.056) (-770.701) * (-768.031) (-767.473) (-774.522) [-769.013] -- 0:00:07
885000 -- (-773.566) (-772.674) [-768.443] (-769.275) * [-767.828] (-767.081) (-767.795) (-767.900) -- 0:00:07
Average standard deviation of split frequencies: 0.010009
885500 -- [-769.350] (-772.742) (-767.222) (-767.640) * (-772.619) (-768.240) [-767.934] (-769.391) -- 0:00:07
886000 -- (-767.585) (-769.538) (-769.248) [-768.017] * (-773.107) (-767.419) (-768.263) [-772.273] -- 0:00:07
886500 -- (-768.707) (-771.101) (-769.992) [-768.709] * [-770.048] (-767.956) (-767.106) (-768.615) -- 0:00:07
887000 -- (-770.134) (-772.219) [-769.960] (-769.948) * (-771.411) (-770.010) [-770.831] (-768.627) -- 0:00:07
887500 -- [-769.635] (-771.264) (-773.280) (-771.309) * (-770.887) (-770.437) [-769.941] (-768.151) -- 0:00:07
888000 -- (-768.948) (-775.214) [-770.832] (-768.869) * (-769.533) (-768.349) [-769.630] (-770.089) -- 0:00:07
888500 -- (-769.040) (-771.888) [-769.546] (-768.528) * (-769.118) [-770.009] (-767.307) (-769.638) -- 0:00:07
889000 -- [-771.526] (-770.168) (-769.743) (-768.405) * (-772.165) [-768.647] (-771.579) (-769.723) -- 0:00:07
889500 -- (-769.449) (-771.266) [-769.279] (-768.555) * (-768.794) (-771.572) (-769.637) [-768.437] -- 0:00:07
890000 -- [-771.016] (-769.677) (-768.414) (-768.552) * (-768.685) [-767.593] (-769.618) (-768.858) -- 0:00:07
Average standard deviation of split frequencies: 0.009492
890500 -- (-769.468) (-769.206) [-768.186] (-769.517) * (-769.901) [-769.206] (-769.319) (-767.946) -- 0:00:07
891000 -- (-768.718) (-768.625) (-767.711) [-767.888] * (-768.446) [-768.682] (-769.616) (-770.854) -- 0:00:07
891500 -- (-772.795) (-767.514) [-770.918] (-770.965) * (-768.028) (-767.678) [-767.409] (-767.626) -- 0:00:07
892000 -- (-769.671) (-767.397) (-770.925) [-769.381] * (-770.097) (-771.156) (-767.256) [-770.746] -- 0:00:07
892500 -- (-769.815) [-768.632] (-772.650) (-768.745) * (-769.432) (-774.934) (-769.798) [-768.160] -- 0:00:07
893000 -- (-769.563) (-769.677) (-771.990) [-769.896] * (-773.348) (-776.099) [-767.362] (-768.221) -- 0:00:07
893500 -- (-767.221) (-768.153) [-767.988] (-768.250) * (-768.618) (-775.587) (-769.691) [-769.145] -- 0:00:07
894000 -- (-767.807) [-767.524] (-768.908) (-767.239) * (-768.039) (-770.340) (-768.847) [-767.867] -- 0:00:06
894500 -- (-769.783) (-770.071) [-771.197] (-770.628) * (-768.884) (-772.543) [-768.405] (-770.001) -- 0:00:06
895000 -- (-768.726) (-769.455) (-770.302) [-768.097] * (-769.429) (-768.545) (-769.237) [-769.152] -- 0:00:06
Average standard deviation of split frequencies: 0.009505
895500 -- (-767.542) (-770.652) (-769.274) [-769.954] * (-768.481) [-769.900] (-769.775) (-771.658) -- 0:00:06
896000 -- (-770.773) (-770.916) (-772.115) [-768.423] * (-769.563) [-767.579] (-767.973) (-769.835) -- 0:00:06
896500 -- (-769.809) (-770.062) [-768.243] (-769.336) * [-769.685] (-769.329) (-769.370) (-769.800) -- 0:00:06
897000 -- (-767.552) [-766.960] (-771.485) (-771.076) * (-770.000) [-769.402] (-768.363) (-769.727) -- 0:00:06
897500 -- (-767.932) [-771.256] (-774.666) (-773.605) * (-769.414) (-769.958) [-767.963] (-769.294) -- 0:00:06
898000 -- [-769.159] (-773.318) (-769.234) (-769.071) * [-770.735] (-767.818) (-768.999) (-768.040) -- 0:00:06
898500 -- (-769.360) (-771.176) [-772.119] (-770.719) * [-771.154] (-770.790) (-770.636) (-767.469) -- 0:00:06
899000 -- (-773.146) (-770.640) (-771.508) [-768.167] * (-769.862) (-771.450) (-767.937) [-771.970] -- 0:00:06
899500 -- [-769.677] (-773.391) (-769.256) (-768.314) * (-768.718) [-771.759] (-770.785) (-769.835) -- 0:00:06
900000 -- (-769.534) (-774.303) (-768.105) [-770.339] * (-768.917) (-772.653) [-774.712] (-771.051) -- 0:00:06
Average standard deviation of split frequencies: 0.009561
900500 -- [-767.858] (-768.339) (-768.319) (-771.474) * (-768.463) (-767.815) [-770.381] (-769.721) -- 0:00:06
901000 -- (-771.351) (-767.655) [-772.034] (-768.452) * [-769.115] (-770.921) (-770.800) (-771.518) -- 0:00:06
901500 -- (-770.821) (-769.406) [-769.317] (-768.903) * (-767.898) (-768.578) (-769.175) [-769.127] -- 0:00:06
902000 -- [-767.444] (-769.474) (-773.054) (-769.398) * [-767.157] (-771.816) (-771.677) (-768.168) -- 0:00:06
902500 -- [-770.025] (-769.392) (-769.539) (-768.792) * (-767.757) (-769.597) [-771.337] (-767.311) -- 0:00:06
903000 -- (-770.708) (-771.071) (-767.944) [-767.442] * (-769.396) (-770.500) (-768.929) [-767.731] -- 0:00:06
903500 -- (-768.068) (-772.814) (-767.598) [-769.228] * [-768.059] (-767.789) (-772.805) (-771.060) -- 0:00:06
904000 -- (-767.003) [-771.737] (-767.630) (-769.191) * (-768.985) [-770.724] (-768.363) (-767.600) -- 0:00:06
904500 -- (-767.005) (-769.353) (-771.341) [-769.609] * (-768.342) (-774.756) (-768.649) [-768.812] -- 0:00:06
905000 -- [-767.859] (-771.822) (-771.046) (-772.038) * (-770.326) (-771.959) (-771.945) [-769.374] -- 0:00:06
Average standard deviation of split frequencies: 0.009886
905500 -- [-771.953] (-769.475) (-769.976) (-771.464) * (-770.484) (-768.011) (-772.332) [-767.269] -- 0:00:06
906000 -- (-772.355) (-769.386) (-768.545) [-772.504] * [-769.905] (-768.993) (-772.817) (-770.280) -- 0:00:06
906500 -- (-767.766) [-767.169] (-768.852) (-772.477) * [-774.087] (-769.713) (-770.420) (-771.132) -- 0:00:06
907000 -- [-771.494] (-769.248) (-768.139) (-774.392) * [-770.884] (-770.413) (-769.241) (-770.735) -- 0:00:06
907500 -- [-767.829] (-769.185) (-771.128) (-770.181) * (-771.653) (-769.736) [-769.937] (-770.296) -- 0:00:06
908000 -- (-767.316) (-769.603) [-768.948] (-769.602) * (-769.997) (-769.055) (-771.556) [-767.342] -- 0:00:06
908500 -- (-768.993) [-767.410] (-769.227) (-768.020) * (-769.334) [-767.299] (-767.392) (-769.605) -- 0:00:06
909000 -- (-769.764) (-768.031) [-768.070] (-768.411) * [-768.232] (-769.311) (-774.132) (-767.980) -- 0:00:06
909500 -- (-767.553) [-768.034] (-768.535) (-768.524) * (-768.838) (-769.995) [-768.163] (-767.827) -- 0:00:05
910000 -- [-767.295] (-770.508) (-769.245) (-767.771) * (-768.282) (-769.463) (-769.458) [-768.093] -- 0:00:05
Average standard deviation of split frequencies: 0.010126
910500 -- (-770.636) (-771.204) [-769.125] (-768.776) * (-768.799) (-769.217) [-769.702] (-769.542) -- 0:00:05
911000 -- (-772.427) [-769.182] (-767.629) (-768.573) * [-769.261] (-769.307) (-769.813) (-769.369) -- 0:00:05
911500 -- [-770.980] (-767.332) (-767.912) (-770.176) * [-768.725] (-774.245) (-770.525) (-770.632) -- 0:00:05
912000 -- (-768.979) [-768.047] (-768.816) (-768.001) * (-769.726) (-773.072) [-769.085] (-769.663) -- 0:00:05
912500 -- [-771.904] (-773.084) (-769.365) (-768.024) * (-768.457) (-770.361) (-770.222) [-767.693] -- 0:00:05
913000 -- (-769.707) (-769.777) [-769.721] (-767.879) * [-767.473] (-769.270) (-768.907) (-768.602) -- 0:00:05
913500 -- (-768.582) (-770.982) (-770.637) [-771.056] * (-769.101) [-768.454] (-768.477) (-767.976) -- 0:00:05
914000 -- (-767.615) (-772.607) [-767.875] (-773.501) * (-771.327) (-771.088) (-768.575) [-768.419] -- 0:00:05
914500 -- (-768.171) (-770.049) [-773.988] (-770.798) * [-771.161] (-769.314) (-772.638) (-767.487) -- 0:00:05
915000 -- (-768.710) (-768.861) (-770.268) [-770.904] * (-770.282) (-769.807) (-769.779) [-767.416] -- 0:00:05
Average standard deviation of split frequencies: 0.009469
915500 -- (-768.729) (-769.245) (-768.230) [-773.014] * (-767.819) (-772.154) (-767.245) [-769.918] -- 0:00:05
916000 -- (-768.763) [-767.463] (-767.176) (-768.778) * (-768.315) (-770.278) (-767.830) [-770.608] -- 0:00:05
916500 -- (-768.926) [-767.921] (-768.880) (-769.456) * (-767.633) (-769.044) (-767.848) [-767.995] -- 0:00:05
917000 -- [-768.090] (-768.689) (-767.282) (-769.764) * (-770.214) (-768.900) [-770.380] (-767.611) -- 0:00:05
917500 -- (-767.183) (-769.298) [-768.514] (-768.967) * (-771.523) (-770.819) (-769.859) [-766.972] -- 0:00:05
918000 -- (-771.321) (-772.458) [-770.364] (-768.645) * (-773.713) (-768.044) (-770.920) [-767.348] -- 0:00:05
918500 -- (-768.767) (-768.116) [-768.719] (-771.626) * (-772.473) (-769.351) [-768.670] (-774.281) -- 0:00:05
919000 -- (-768.932) (-773.850) [-769.261] (-770.663) * (-776.794) (-768.211) [-768.570] (-768.493) -- 0:00:05
919500 -- (-769.569) (-770.954) (-771.386) [-768.498] * [-771.174] (-767.784) (-771.279) (-771.050) -- 0:00:05
920000 -- [-769.528] (-774.462) (-767.474) (-769.176) * (-768.052) [-768.089] (-770.808) (-769.943) -- 0:00:05
Average standard deviation of split frequencies: 0.009148
920500 -- (-768.203) (-776.602) (-767.797) [-770.120] * [-768.147] (-768.401) (-768.759) (-772.151) -- 0:00:05
921000 -- (-768.436) (-775.378) (-774.641) [-768.576] * (-768.533) (-770.245) (-771.045) [-773.305] -- 0:00:05
921500 -- [-767.556] (-776.618) (-768.363) (-769.218) * (-768.061) (-768.842) [-769.301] (-771.195) -- 0:00:05
922000 -- (-769.610) (-768.120) [-767.611] (-767.822) * (-773.219) (-768.832) [-767.745] (-773.621) -- 0:00:05
922500 -- (-768.321) [-770.257] (-768.800) (-767.696) * [-769.098] (-768.563) (-767.022) (-767.762) -- 0:00:05
923000 -- (-770.907) (-768.235) (-768.152) [-767.828] * (-769.172) (-773.066) (-767.168) [-768.222] -- 0:00:05
923500 -- (-769.045) [-768.500] (-768.066) (-771.625) * (-771.145) [-771.456] (-767.264) (-768.717) -- 0:00:05
924000 -- (-769.948) (-767.940) [-768.788] (-771.830) * (-769.525) [-770.254] (-767.156) (-769.400) -- 0:00:05
924500 -- (-769.299) [-769.662] (-768.153) (-769.371) * (-769.438) [-768.750] (-767.994) (-772.124) -- 0:00:04
925000 -- (-771.239) (-772.978) (-767.496) [-769.555] * [-769.411] (-770.027) (-767.223) (-767.958) -- 0:00:04
Average standard deviation of split frequencies: 0.009163
925500 -- (-769.368) (-771.298) (-767.990) [-770.059] * [-769.851] (-768.247) (-769.169) (-769.174) -- 0:00:04
926000 -- (-773.206) (-772.175) (-768.773) [-767.689] * (-773.409) (-768.051) (-767.921) [-767.521] -- 0:00:04
926500 -- (-767.679) (-772.066) (-775.000) [-767.949] * (-775.795) (-768.263) [-770.093] (-767.748) -- 0:00:04
927000 -- (-772.265) (-771.003) [-768.917] (-769.289) * (-773.375) [-767.712] (-770.613) (-767.883) -- 0:00:04
927500 -- [-772.941] (-772.663) (-770.429) (-768.932) * (-772.373) (-768.390) (-768.784) [-769.359] -- 0:00:04
928000 -- (-771.033) (-770.216) [-770.775] (-768.838) * (-770.993) [-767.533] (-768.888) (-769.706) -- 0:00:04
928500 -- (-770.879) [-771.299] (-770.875) (-768.715) * (-773.487) (-769.512) [-768.419] (-770.717) -- 0:00:04
929000 -- [-767.657] (-771.464) (-776.492) (-768.777) * [-771.497] (-770.943) (-770.913) (-768.792) -- 0:00:04
929500 -- [-767.966] (-772.308) (-775.556) (-769.194) * [-768.598] (-769.763) (-772.210) (-769.081) -- 0:00:04
930000 -- [-767.099] (-769.549) (-772.159) (-769.087) * (-768.401) (-768.502) (-768.245) [-774.832] -- 0:00:04
Average standard deviation of split frequencies: 0.009117
930500 -- (-769.243) (-769.423) [-769.983] (-768.549) * (-768.267) (-769.903) [-769.052] (-768.564) -- 0:00:04
931000 -- (-771.462) (-768.582) (-773.626) [-771.500] * (-773.405) (-772.109) (-769.684) [-768.503] -- 0:00:04
931500 -- (-769.172) (-767.707) [-769.084] (-773.953) * [-776.321] (-769.900) (-769.017) (-771.086) -- 0:00:04
932000 -- (-773.412) (-767.486) [-772.873] (-769.124) * (-768.191) (-770.075) (-768.910) [-768.586] -- 0:00:04
932500 -- [-771.108] (-768.472) (-767.825) (-770.014) * [-768.652] (-768.419) (-770.219) (-767.266) -- 0:00:04
933000 -- (-770.201) (-767.467) (-767.040) [-772.166] * [-768.275] (-769.948) (-769.932) (-767.166) -- 0:00:04
933500 -- (-767.537) [-767.528] (-768.598) (-769.529) * (-768.320) (-770.520) [-768.162] (-767.377) -- 0:00:04
934000 -- (-768.992) [-767.601] (-767.533) (-770.338) * (-770.778) [-769.033] (-768.559) (-767.340) -- 0:00:04
934500 -- (-768.853) [-767.593] (-770.066) (-769.032) * (-768.744) [-769.228] (-768.876) (-770.337) -- 0:00:04
935000 -- [-774.248] (-768.926) (-770.877) (-767.566) * (-771.286) (-767.603) (-770.805) [-769.499] -- 0:00:04
Average standard deviation of split frequencies: 0.009065
935500 -- (-772.437) (-770.655) [-769.746] (-767.732) * (-769.469) (-771.394) [-767.785] (-770.274) -- 0:00:04
936000 -- (-769.752) [-768.842] (-769.876) (-768.612) * (-773.192) [-767.878] (-767.663) (-769.338) -- 0:00:04
936500 -- (-770.509) (-770.873) (-772.741) [-767.169] * (-768.813) [-767.925] (-767.725) (-769.687) -- 0:00:04
937000 -- (-769.745) (-770.392) (-771.548) [-767.706] * (-771.479) (-768.775) (-770.558) [-768.304] -- 0:00:04
937500 -- [-780.648] (-768.425) (-768.598) (-768.493) * (-771.501) (-769.095) [-768.190] (-769.372) -- 0:00:04
938000 -- (-769.409) (-768.851) (-769.495) [-767.474] * (-770.928) [-770.209] (-772.870) (-770.372) -- 0:00:04
938500 -- (-767.809) (-767.807) [-767.632] (-767.523) * (-768.358) [-771.244] (-767.494) (-768.080) -- 0:00:04
939000 -- (-769.537) (-770.241) [-771.798] (-767.770) * [-768.298] (-771.350) (-767.570) (-768.767) -- 0:00:04
939500 -- (-767.532) (-767.228) (-769.861) [-768.154] * (-767.964) [-771.078] (-767.789) (-770.284) -- 0:00:03
940000 -- (-768.804) [-767.605] (-768.781) (-769.333) * [-769.322] (-769.734) (-768.380) (-769.594) -- 0:00:03
Average standard deviation of split frequencies: 0.008753
940500 -- (-772.519) (-768.005) [-767.655] (-771.356) * (-769.712) (-767.445) [-771.998] (-772.833) -- 0:00:03
941000 -- (-769.438) [-768.277] (-768.006) (-769.875) * (-771.280) (-768.969) (-775.929) [-771.853] -- 0:00:03
941500 -- (-769.705) (-770.981) [-769.347] (-770.209) * (-770.928) (-769.257) (-770.728) [-768.631] -- 0:00:03
942000 -- [-770.000] (-770.275) (-768.985) (-768.840) * (-767.844) (-771.065) (-769.294) [-770.946] -- 0:00:03
942500 -- (-768.547) (-769.262) [-767.944] (-768.858) * [-769.042] (-774.623) (-770.683) (-771.296) -- 0:00:03
943000 -- (-768.621) (-771.010) (-768.126) [-768.693] * (-767.496) [-767.354] (-770.107) (-770.236) -- 0:00:03
943500 -- (-769.753) (-774.811) (-771.655) [-768.573] * (-769.745) (-767.398) [-768.355] (-769.611) -- 0:00:03
944000 -- [-771.913] (-770.334) (-770.160) (-769.057) * (-769.407) (-770.949) (-770.178) [-771.178] -- 0:00:03
944500 -- (-767.729) (-768.946) (-768.506) [-769.614] * (-769.730) (-768.453) [-773.131] (-769.760) -- 0:00:03
945000 -- (-767.550) [-769.816] (-767.419) (-771.529) * (-773.636) (-770.980) [-769.966] (-771.938) -- 0:00:03
Average standard deviation of split frequencies: 0.008405
945500 -- (-769.677) (-769.375) (-771.037) [-770.975] * (-770.870) (-776.366) [-770.687] (-768.911) -- 0:00:03
946000 -- (-768.181) (-771.750) (-768.171) [-767.349] * (-769.360) [-769.166] (-768.272) (-770.942) -- 0:00:03
946500 -- (-769.513) [-768.455] (-768.326) (-767.679) * (-770.078) (-770.329) [-767.225] (-768.339) -- 0:00:03
947000 -- (-770.694) [-771.501] (-772.296) (-767.624) * (-769.902) [-769.528] (-767.440) (-770.051) -- 0:00:03
947500 -- (-770.550) (-768.035) [-771.567] (-768.019) * (-767.850) (-768.952) [-768.458] (-768.442) -- 0:00:03
948000 -- (-773.240) (-768.020) (-772.259) [-768.201] * (-768.690) [-771.855] (-768.528) (-770.733) -- 0:00:03
948500 -- [-770.605] (-767.557) (-767.415) (-769.496) * (-769.256) (-771.851) [-767.672] (-768.290) -- 0:00:03
949000 -- (-769.605) (-770.791) [-768.207] (-768.797) * [-767.349] (-771.985) (-770.146) (-768.397) -- 0:00:03
949500 -- (-771.043) (-770.586) [-768.151] (-775.446) * (-767.342) (-770.273) [-768.950] (-772.270) -- 0:00:03
950000 -- (-774.490) (-769.833) (-771.265) [-769.561] * [-768.317] (-772.113) (-769.455) (-775.382) -- 0:00:03
Average standard deviation of split frequencies: 0.008331
950500 -- (-768.988) [-769.472] (-767.027) (-769.498) * [-767.102] (-770.107) (-768.165) (-768.494) -- 0:00:03
951000 -- (-769.519) [-771.332] (-767.418) (-768.780) * [-767.364] (-767.313) (-768.004) (-768.336) -- 0:00:03
951500 -- [-769.248] (-769.224) (-771.286) (-769.345) * [-767.404] (-769.320) (-768.677) (-767.890) -- 0:00:03
952000 -- [-768.837] (-772.348) (-772.888) (-768.995) * (-774.144) [-767.560] (-770.884) (-767.893) -- 0:00:03
952500 -- [-771.911] (-769.932) (-771.774) (-769.266) * (-772.469) (-767.658) (-771.853) [-770.133] -- 0:00:03
953000 -- (-773.908) (-769.898) [-768.034] (-769.528) * (-769.653) [-767.079] (-772.468) (-769.325) -- 0:00:03
953500 -- (-772.672) (-767.951) (-767.989) [-768.998] * [-768.026] (-767.626) (-769.087) (-769.343) -- 0:00:03
954000 -- (-776.525) (-768.485) [-769.062] (-767.157) * (-769.250) (-769.507) (-771.219) [-771.779] -- 0:00:03
954500 -- (-772.517) (-768.363) (-768.501) [-768.378] * [-770.150] (-771.849) (-771.095) (-768.933) -- 0:00:03
955000 -- (-769.725) (-768.413) (-767.872) [-769.495] * (-771.580) (-770.031) (-768.078) [-772.897] -- 0:00:02
Average standard deviation of split frequencies: 0.008153
955500 -- (-768.798) (-768.358) (-769.708) [-768.317] * (-771.186) (-768.764) [-767.695] (-768.024) -- 0:00:02
956000 -- (-767.850) [-767.655] (-771.874) (-771.938) * (-769.246) (-768.764) [-767.866] (-767.985) -- 0:00:02
956500 -- (-770.128) (-768.910) (-770.670) [-768.878] * (-770.419) (-770.437) [-772.389] (-768.287) -- 0:00:02
957000 -- (-769.712) [-768.758] (-769.227) (-768.247) * (-769.008) [-770.036] (-770.969) (-770.454) -- 0:00:02
957500 -- (-769.849) [-769.390] (-767.617) (-769.205) * (-767.913) [-770.498] (-769.149) (-768.891) -- 0:00:02
958000 -- (-774.549) (-767.506) [-767.763] (-769.965) * [-767.982] (-768.954) (-767.784) (-769.253) -- 0:00:02
958500 -- (-771.988) (-768.101) [-771.705] (-768.102) * (-767.230) (-770.529) (-768.259) [-767.428] -- 0:00:02
959000 -- (-768.800) [-768.859] (-767.215) (-770.860) * (-768.044) [-768.242] (-768.292) (-771.392) -- 0:00:02
959500 -- (-768.443) [-768.870] (-771.529) (-768.216) * (-769.407) [-771.327] (-767.742) (-775.502) -- 0:00:02
960000 -- (-768.852) (-768.640) (-771.975) [-770.139] * (-769.948) (-775.902) (-767.588) [-773.636] -- 0:00:02
Average standard deviation of split frequencies: 0.007819
960500 -- (-768.977) [-771.462] (-770.236) (-770.940) * (-769.987) (-772.041) (-768.054) [-767.208] -- 0:00:02
961000 -- (-770.856) [-767.763] (-771.377) (-769.718) * (-773.988) (-772.585) (-770.938) [-769.390] -- 0:00:02
961500 -- (-770.130) (-767.404) [-769.480] (-767.755) * [-770.977] (-768.454) (-767.356) (-772.499) -- 0:00:02
962000 -- [-767.467] (-771.490) (-768.036) (-769.430) * [-768.151] (-769.359) (-769.966) (-771.459) -- 0:00:02
962500 -- (-767.465) (-768.558) (-768.240) [-768.292] * (-771.136) (-768.935) (-771.220) [-772.452] -- 0:00:02
963000 -- (-767.675) [-768.665] (-767.993) (-770.414) * (-769.164) [-767.828] (-770.169) (-768.142) -- 0:00:02
963500 -- (-773.190) (-767.614) [-767.272] (-769.701) * (-767.177) [-770.711] (-769.363) (-768.554) -- 0:00:02
964000 -- (-770.517) (-767.035) [-769.052] (-769.094) * (-769.465) (-772.838) (-770.850) [-770.999] -- 0:00:02
964500 -- (-767.460) (-769.128) [-768.252] (-773.241) * (-768.676) (-771.651) [-771.817] (-769.493) -- 0:00:02
965000 -- (-767.384) (-769.288) [-768.421] (-773.822) * [-767.413] (-770.306) (-769.093) (-768.210) -- 0:00:02
Average standard deviation of split frequencies: 0.007418
965500 -- (-772.001) (-768.543) (-769.813) [-772.050] * (-768.475) (-768.835) (-772.787) [-772.011] -- 0:00:02
966000 -- (-770.055) (-767.526) (-771.069) [-768.952] * (-769.450) [-770.997] (-770.416) (-770.898) -- 0:00:02
966500 -- [-767.666] (-768.068) (-767.876) (-768.487) * (-769.545) (-773.549) (-770.129) [-768.118] -- 0:00:02
967000 -- (-770.037) [-767.693] (-770.142) (-768.729) * (-770.109) (-771.881) (-771.288) [-767.348] -- 0:00:02
967500 -- (-767.441) [-768.078] (-769.696) (-773.023) * [-767.453] (-773.439) (-770.146) (-767.223) -- 0:00:02
968000 -- (-767.449) (-769.059) [-770.809] (-770.806) * (-768.288) [-770.192] (-769.071) (-769.086) -- 0:00:02
968500 -- [-768.012] (-768.294) (-771.625) (-768.405) * (-767.134) (-770.446) [-769.193] (-769.086) -- 0:00:02
969000 -- (-767.091) [-770.967] (-770.678) (-769.668) * (-767.857) (-769.068) [-769.179] (-768.826) -- 0:00:02
969500 -- (-769.963) (-772.200) (-771.586) [-767.292] * (-767.743) (-767.456) [-767.861] (-769.014) -- 0:00:02
970000 -- (-775.890) (-768.861) (-768.272) [-769.149] * (-767.727) (-770.541) (-767.170) [-768.751] -- 0:00:01
Average standard deviation of split frequencies: 0.007447
970500 -- (-769.299) (-769.118) (-769.330) [-767.842] * (-768.169) (-768.741) (-768.153) [-768.622] -- 0:00:01
971000 -- (-768.910) (-768.185) (-770.426) [-768.615] * (-767.839) (-767.668) (-767.976) [-768.824] -- 0:00:01
971500 -- (-769.419) [-767.499] (-769.063) (-772.492) * (-768.404) [-770.395] (-768.770) (-769.285) -- 0:00:01
972000 -- (-770.169) (-773.325) (-770.779) [-767.694] * (-768.567) [-767.251] (-771.169) (-780.576) -- 0:00:01
972500 -- (-770.377) [-767.376] (-770.633) (-770.166) * [-769.388] (-770.381) (-770.898) (-773.150) -- 0:00:01
973000 -- (-769.153) (-774.268) [-767.850] (-770.002) * (-771.498) (-769.672) [-770.229] (-772.667) -- 0:00:01
973500 -- [-769.336] (-770.559) (-769.363) (-769.114) * (-768.798) (-767.564) [-769.758] (-770.633) -- 0:00:01
974000 -- (-769.966) (-769.111) [-767.125] (-767.261) * (-770.694) (-767.677) (-772.416) [-768.796] -- 0:00:01
974500 -- (-770.281) (-769.596) (-768.393) [-767.030] * (-769.762) (-772.709) (-769.438) [-767.778] -- 0:00:01
975000 -- [-771.130] (-769.754) (-770.473) (-767.812) * (-771.199) (-769.309) (-772.352) [-769.101] -- 0:00:01
Average standard deviation of split frequencies: 0.007148
975500 -- [-773.913] (-768.899) (-773.358) (-769.383) * [-768.344] (-768.160) (-769.123) (-768.950) -- 0:00:01
976000 -- (-771.753) (-767.671) (-768.283) [-768.514] * (-771.102) (-767.843) (-770.345) [-769.203] -- 0:00:01
976500 -- (-774.372) (-767.362) (-769.999) [-768.002] * (-769.206) (-770.054) [-768.632] (-769.977) -- 0:00:01
977000 -- (-768.130) (-771.018) [-769.659] (-769.472) * [-768.970] (-769.957) (-769.351) (-767.846) -- 0:00:01
977500 -- [-769.021] (-768.210) (-768.373) (-772.240) * (-767.942) (-771.603) [-770.093] (-769.226) -- 0:00:01
978000 -- (-768.773) (-768.324) (-771.359) [-774.161] * (-772.965) (-773.279) (-772.603) [-768.051] -- 0:00:01
978500 -- (-769.505) (-767.988) [-768.685] (-769.468) * (-773.839) [-769.054] (-769.504) (-769.696) -- 0:00:01
979000 -- (-769.003) (-769.557) [-767.385] (-770.594) * (-770.545) (-769.633) [-769.650] (-769.820) -- 0:00:01
979500 -- [-768.951] (-771.269) (-768.162) (-776.731) * [-770.655] (-771.457) (-774.907) (-768.698) -- 0:00:01
980000 -- (-770.353) (-768.517) [-767.498] (-772.284) * [-771.344] (-768.644) (-773.302) (-768.570) -- 0:00:01
Average standard deviation of split frequencies: 0.007275
980500 -- (-771.083) (-767.103) [-767.501] (-769.366) * (-770.310) [-768.425] (-767.650) (-769.405) -- 0:00:01
981000 -- (-769.010) (-767.224) [-770.126] (-769.068) * (-770.551) (-767.658) [-767.717] (-768.087) -- 0:00:01
981500 -- [-770.429] (-768.172) (-769.676) (-767.746) * (-771.114) (-774.151) [-768.995] (-772.092) -- 0:00:01
982000 -- [-768.636] (-767.083) (-771.778) (-768.158) * (-771.162) (-772.605) (-772.025) [-767.449] -- 0:00:01
982500 -- (-770.451) [-767.073] (-771.990) (-770.682) * (-770.158) [-769.003] (-770.904) (-767.720) -- 0:00:01
983000 -- (-769.184) (-768.098) (-771.444) [-771.096] * (-767.571) (-771.261) (-769.442) [-768.500] -- 0:00:01
983500 -- [-767.497] (-769.533) (-771.686) (-770.550) * (-769.318) [-768.372] (-767.844) (-769.063) -- 0:00:01
984000 -- [-767.326] (-767.289) (-768.321) (-772.569) * (-771.600) [-769.605] (-773.130) (-769.182) -- 0:00:01
984500 -- (-766.992) [-767.725] (-767.909) (-769.442) * (-772.040) [-770.158] (-769.560) (-769.746) -- 0:00:01
985000 -- [-768.220] (-768.878) (-770.527) (-768.241) * (-773.204) (-768.899) [-770.658] (-770.208) -- 0:00:00
Average standard deviation of split frequencies: 0.007331
985500 -- (-768.325) (-770.899) (-768.091) [-771.100] * (-773.772) [-767.749] (-768.496) (-768.683) -- 0:00:00
986000 -- (-769.364) [-769.274] (-766.990) (-768.535) * [-776.012] (-772.558) (-769.314) (-771.229) -- 0:00:00
986500 -- (-769.246) (-769.087) [-767.740] (-770.618) * [-771.157] (-768.441) (-773.278) (-768.247) -- 0:00:00
987000 -- (-768.791) (-768.338) (-768.529) [-767.586] * [-769.677] (-768.856) (-772.374) (-770.770) -- 0:00:00
987500 -- (-768.953) [-768.463] (-768.128) (-774.233) * (-768.520) (-767.374) [-773.226] (-774.151) -- 0:00:00
988000 -- (-768.886) [-768.730] (-767.951) (-768.145) * [-775.175] (-774.354) (-769.916) (-771.406) -- 0:00:00
988500 -- (-772.679) [-768.295] (-767.240) (-767.693) * (-769.043) [-768.351] (-771.800) (-771.193) -- 0:00:00
989000 -- (-777.292) (-768.129) [-769.878] (-767.901) * (-770.914) (-770.108) (-769.066) [-770.242] -- 0:00:00
989500 -- (-770.027) (-767.140) [-769.121] (-774.406) * (-769.289) (-768.590) [-768.481] (-773.347) -- 0:00:00
990000 -- [-766.941] (-775.000) (-769.562) (-772.469) * (-771.506) (-770.031) [-769.492] (-773.278) -- 0:00:00
Average standard deviation of split frequencies: 0.007455
990500 -- (-771.456) (-770.691) (-773.539) [-768.343] * (-769.869) [-767.411] (-768.842) (-769.897) -- 0:00:00
991000 -- (-772.717) (-768.611) (-768.141) [-768.623] * (-770.042) (-770.369) (-768.439) [-769.119] -- 0:00:00
991500 -- (-768.863) (-771.317) (-769.271) [-768.416] * (-768.805) [-768.532] (-769.703) (-770.033) -- 0:00:00
992000 -- (-769.627) [-769.005] (-770.271) (-773.496) * (-768.773) [-768.604] (-768.317) (-767.313) -- 0:00:00
992500 -- (-769.563) (-768.670) [-768.961] (-770.784) * [-768.468] (-770.065) (-768.763) (-768.402) -- 0:00:00
993000 -- (-772.035) (-769.121) (-769.290) [-769.662] * (-767.779) (-770.352) [-770.085] (-770.118) -- 0:00:00
993500 -- [-770.150] (-768.928) (-769.810) (-772.344) * [-768.863] (-769.156) (-773.109) (-769.830) -- 0:00:00
994000 -- (-768.374) [-769.396] (-769.871) (-770.756) * (-774.519) (-770.102) (-767.467) [-767.249] -- 0:00:00
994500 -- (-770.947) (-773.287) [-768.490] (-767.884) * [-769.182] (-771.320) (-769.073) (-769.089) -- 0:00:00
995000 -- (-770.913) (-769.085) (-770.017) [-770.150] * (-767.193) (-773.042) (-771.264) [-769.208] -- 0:00:00
Average standard deviation of split frequencies: 0.007573
995500 -- (-772.695) (-768.519) (-769.638) [-768.298] * (-770.957) (-771.140) [-768.698] (-768.162) -- 0:00:00
996000 -- (-770.245) (-770.950) (-770.998) [-772.220] * (-769.158) [-768.343] (-769.581) (-771.731) -- 0:00:00
996500 -- (-770.558) (-768.890) [-770.342] (-769.534) * [-770.741] (-771.186) (-770.120) (-767.531) -- 0:00:00
997000 -- (-767.520) (-772.123) (-768.023) [-771.065] * (-769.482) (-769.957) [-770.880] (-769.492) -- 0:00:00
997500 -- [-767.676] (-769.682) (-772.024) (-770.592) * (-768.406) [-769.175] (-769.048) (-768.011) -- 0:00:00
998000 -- (-773.579) [-772.421] (-771.609) (-769.623) * (-769.691) (-768.981) (-767.872) [-770.134] -- 0:00:00
998500 -- (-770.886) (-774.006) [-771.854] (-771.278) * (-770.146) (-771.330) [-767.940] (-770.296) -- 0:00:00
999000 -- (-767.224) (-771.831) (-769.786) [-767.995] * [-767.726] (-768.488) (-768.461) (-767.573) -- 0:00:00
999500 -- (-767.508) [-768.224] (-769.324) (-769.389) * (-768.113) (-769.411) (-769.211) [-768.984] -- 0:00:00
1000000 -- [-769.243] (-768.826) (-772.338) (-770.335) * (-768.469) (-768.941) (-768.942) [-769.119] -- 0:00:00
Average standard deviation of split frequencies: 0.007946
Analysis completed in 1 mins 6 seconds
Analysis used 64.40 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -766.84
Likelihood of best state for "cold" chain of run 2 was -766.84
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 60 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.9 % ( 27 %) Dirichlet(Pi{all})
31.4 % ( 34 %) Slider(Pi{all})
78.6 % ( 58 %) Multiplier(Alpha{1,2})
77.8 % ( 56 %) Multiplier(Alpha{3})
23.0 % ( 33 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.6 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 93 %) ParsSPR(Tau{all},V{all})
28.1 % ( 34 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.6 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.3 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
30.1 % ( 33 %) Dirichlet(Pi{all})
31.5 % ( 26 %) Slider(Pi{all})
79.1 % ( 50 %) Multiplier(Alpha{1,2})
77.7 % ( 53 %) Multiplier(Alpha{3})
22.0 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 95 %) ExtSPR(Tau{all},V{all})
70.3 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 31 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.3 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166164 0.82 0.67
3 | 166885 166559 0.84
4 | 166809 167086 166497
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166560 0.82 0.67
3 | 166836 166297 0.84
4 | 167248 166852 166207
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -768.44
| 1 |
| 1 1 |
| * 1 1 |
| 2 2 2 2 |
| 2 * 1 21 * 2 1 2 |
| 22 1 2 2 * * 11 21 2 2 1 |
| 1 21 1 2 11 1 1 1 2 * 21 2 * 1|
|2 * 1 *2 2 2 22 2 1 2 2 * 21121 2 2|
|1 1 1 2 1 1 2 2 2 1 2 1 2 |
| 2 1 11 1 1 2 1 2 * |
| 1 2 2 2 1 1 |
| 2 1 1 1 |
| 1 2 1 |
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -770.36
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -768.57 -773.49
2 -768.56 -771.99
--------------------------------------
TOTAL -768.56 -773.00
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890748 0.087855 0.361312 1.463604 0.855954 1265.96 1383.48 1.000
r(A<->C){all} 0.163870 0.018522 0.000009 0.438888 0.128123 218.35 238.03 1.003
r(A<->G){all} 0.164656 0.019043 0.000032 0.438647 0.127987 126.53 181.88 1.002
r(A<->T){all} 0.176172 0.022958 0.000129 0.492756 0.134067 237.91 292.19 1.000
r(C<->G){all} 0.165852 0.020204 0.000070 0.446225 0.127658 176.24 219.00 1.003
r(C<->T){all} 0.170433 0.020640 0.000014 0.470250 0.132524 108.08 184.42 1.004
r(G<->T){all} 0.159017 0.019429 0.000016 0.440817 0.120700 380.58 411.47 1.001
pi(A){all} 0.192845 0.000271 0.162477 0.226009 0.192480 1192.37 1228.17 1.000
pi(C){all} 0.259207 0.000337 0.224414 0.295955 0.258850 1010.79 1189.37 1.000
pi(G){all} 0.325008 0.000386 0.285737 0.360674 0.325183 948.87 1051.17 1.000
pi(T){all} 0.222940 0.000322 0.187893 0.259638 0.222836 1118.12 1237.35 1.000
alpha{1,2} 0.432717 0.243387 0.000121 1.392807 0.267905 840.63 1034.31 1.000
alpha{3} 0.461335 0.241727 0.000163 1.426690 0.300769 1337.01 1419.00 1.000
pinvar{all} 0.997253 0.000010 0.991265 0.999999 0.998297 1408.74 1440.23 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .***.*
9 -- .*.***
10 -- ....**
11 -- ...*.*
12 -- .**...
13 -- ..****
14 -- .**.**
15 -- .*.*..
16 -- ..**..
17 -- .****.
18 -- .*...*
19 -- ..*.*.
20 -- ..*..*
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.007537 0.145237 0.155896 2
8 450 0.149900 0.009422 0.143238 0.156562 2
9 446 0.148568 0.000942 0.147901 0.149234 2
10 441 0.146902 0.007066 0.141905 0.151899 2
11 439 0.146236 0.021199 0.131246 0.161226 2
12 434 0.144570 0.002827 0.142572 0.146569 2
13 430 0.143238 0.021670 0.127915 0.158561 2
14 427 0.142239 0.001413 0.141239 0.143238 2
15 424 0.141239 0.008480 0.135243 0.147235 2
16 423 0.140906 0.006124 0.136576 0.145237 2
17 420 0.139907 0.004711 0.136576 0.143238 2
18 414 0.137908 0.001884 0.136576 0.139241 2
19 413 0.137575 0.010835 0.129913 0.145237 2
20 409 0.136243 0.014604 0.125916 0.146569 2
21 407 0.135576 0.000471 0.135243 0.135909 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099708 0.009739 0.000069 0.290573 0.069345 1.000 2
length{all}[2] 0.097934 0.009784 0.000008 0.291845 0.066016 1.001 2
length{all}[3] 0.097083 0.009281 0.000027 0.297305 0.066827 1.000 2
length{all}[4] 0.099530 0.009721 0.000037 0.298218 0.069260 1.000 2
length{all}[5] 0.097906 0.009411 0.000153 0.295448 0.068579 1.000 2
length{all}[6] 0.098152 0.009764 0.000024 0.297911 0.068108 1.000 2
length{all}[7] 0.102042 0.011064 0.000252 0.325767 0.066418 1.000 2
length{all}[8] 0.099930 0.010390 0.000139 0.305980 0.066301 0.999 2
length{all}[9] 0.103934 0.010506 0.000004 0.301318 0.069165 1.000 2
length{all}[10] 0.101554 0.008854 0.000855 0.276713 0.075037 1.001 2
length{all}[11] 0.091358 0.008707 0.000743 0.265771 0.065366 0.998 2
length{all}[12] 0.100994 0.009276 0.000039 0.287321 0.073856 0.998 2
length{all}[13] 0.089322 0.007788 0.000028 0.279398 0.063883 0.998 2
length{all}[14] 0.102474 0.009801 0.000172 0.300582 0.071225 0.999 2
length{all}[15] 0.095122 0.008204 0.000305 0.279239 0.070954 1.005 2
length{all}[16] 0.109241 0.011356 0.000036 0.282772 0.080706 1.008 2
length{all}[17] 0.104581 0.012861 0.000018 0.325030 0.070133 0.998 2
length{all}[18] 0.093215 0.008113 0.000318 0.279187 0.067760 0.998 2
length{all}[19] 0.093949 0.008698 0.000042 0.271769 0.069629 1.000 2
length{all}[20] 0.101870 0.009579 0.000515 0.294903 0.071632 0.998 2
length{all}[21] 0.096911 0.008970 0.000136 0.284790 0.063403 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007946
Maximum standard deviation of split frequencies = 0.021670
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|----------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 47 trees
90 % credible set contains 92 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 561
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 187 / 187 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 187 / 187 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093912 0.016408 0.020251 0.104707 0.028265 0.083250 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -803.153174
Iterating by ming2
Initial: fx= 803.153174
x= 0.09391 0.01641 0.02025 0.10471 0.02827 0.08325 0.30000 1.30000
1 h-m-p 0.0000 0.0001 450.5650 ++ 785.151867 m 0.0001 13 | 1/8
2 h-m-p 0.0014 0.0173 26.4734 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 411.8773 ++ 781.629949 m 0.0000 44 | 2/8
4 h-m-p 0.0003 0.0221 21.9385 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 367.9048 ++ 775.758152 m 0.0000 74 | 3/8
6 h-m-p 0.0007 0.0227 19.1943 -----------.. | 3/8
7 h-m-p 0.0000 0.0003 318.1432 +++ 745.223564 m 0.0003 106 | 4/8
8 h-m-p 0.0062 0.0564 12.6537 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 262.0008 ++ 741.215520 m 0.0001 138 | 5/8
10 h-m-p 0.0013 0.2135 8.5997 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 185.4311 ++ 739.178937 m 0.0001 169 | 6/8
12 h-m-p 0.1681 8.0000 0.0000 +++ 739.178937 m 8.0000 181 | 6/8
13 h-m-p 0.1530 8.0000 0.0001 +++ 739.178937 m 8.0000 195 | 6/8
14 h-m-p 0.0017 0.6032 0.5709 -----C 739.178937 0 0.0000 213 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178937 m 8.0000 253 | 6/8
17 h-m-p 0.0014 0.7179 0.7042 --------Y 739.178937 0 0.0000 274 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178937 m 8.0000 290 | 6/8
19 h-m-p 0.0098 4.9093 0.4195 +++++ 739.178910 m 4.9093 306 | 7/8
20 h-m-p 0.3403 1.7016 1.1154 ++ 739.178814 m 1.7016 319 | 8/8
21 h-m-p 0.0160 8.0000 0.0000 Y 739.178814 0 0.0160 330 | 8/8
22 h-m-p 0.0160 8.0000 0.0000 Y 739.178814 0 0.0160 341
Out..
lnL = -739.178814
342 lfun, 342 eigenQcodon, 2052 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.081879 0.039726 0.028853 0.092381 0.055505 0.095598 0.000100 0.645008 0.534958
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.701530
np = 9
lnL0 = -810.697380
Iterating by ming2
Initial: fx= 810.697380
x= 0.08188 0.03973 0.02885 0.09238 0.05551 0.09560 0.00011 0.64501 0.53496
1 h-m-p 0.0000 0.0000 437.0609 ++ 809.514700 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 313.1762 +++ 779.220988 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0001 198.8627 ++ 770.930306 m 0.0001 39 | 3/9
4 h-m-p 0.0002 0.0015 115.1376 ++ 749.417196 m 0.0015 51 | 4/9
5 h-m-p 0.0000 0.0000 14116.6692 ++ 740.786886 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0001 440.1134 ++ 739.338897 m 0.0001 75 | 6/9
7 h-m-p 0.0000 0.0000 813561.8263 ++ 739.178897 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0003 ++ 739.178897 m 8.0000 99 | 7/9
9 h-m-p 0.0037 1.7967 0.5612 ----------N 739.178897 0 0.0000 123 | 7/9
10 h-m-p 0.0160 8.0000 0.0001 +++++ 739.178897 m 8.0000 140 | 7/9
11 h-m-p 0.0054 2.7059 0.2962 ---------C 739.178897 0 0.0000 163 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178897 m 8.0000 180 | 7/9
13 h-m-p 0.0069 3.4622 0.2415 ---------C 739.178897 0 0.0000 203 | 7/9
14 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/9
15 h-m-p 0.0160 8.0000 0.0001 +++++ 739.178897 m 8.0000 245 | 7/9
16 h-m-p 0.0107 5.3673 0.2037 ---------Y 739.178897 0 0.0000 268 | 7/9
17 h-m-p 0.0160 8.0000 0.0019 +++++ 739.178894 m 8.0000 285 | 7/9
18 h-m-p 0.0715 4.2759 0.2174 ------------C 739.178894 0 0.0000 311 | 7/9
19 h-m-p 0.0160 8.0000 0.0002 +++++ 739.178894 m 8.0000 328 | 7/9
20 h-m-p 0.0118 5.9233 0.1960 ---------C 739.178894 0 0.0000 351 | 7/9
21 h-m-p 0.0160 8.0000 0.0001 -----C 739.178894 0 0.0000 370 | 7/9
22 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178894 m 8.0000 387 | 7/9
23 h-m-p 0.0034 1.6907 0.1347 +++++ 739.178890 m 1.6907 404 | 8/9
24 h-m-p 0.1077 0.5384 0.4908 ++ 739.178814 m 0.5384 418 | 9/9
25 h-m-p 0.0160 8.0000 0.0000 N 739.178814 0 0.0160 431 | 9/9
26 h-m-p 0.0160 8.0000 0.0000 N 739.178814 0 0.0160 443
Out..
lnL = -739.178814
444 lfun, 1332 eigenQcodon, 5328 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.035568 0.085409 0.024606 0.101154 0.056120 0.039054 0.000100 1.381975 0.326620 0.453428 2.436269
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.827932
np = 11
lnL0 = -798.119716
Iterating by ming2
Initial: fx= 798.119716
x= 0.03557 0.08541 0.02461 0.10115 0.05612 0.03905 0.00011 1.38198 0.32662 0.45343 2.43627
1 h-m-p 0.0000 0.0000 396.2506 ++ 797.310670 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0013 157.4615 ++++ 770.772969 m 0.0013 32 | 2/11
3 h-m-p 0.0000 0.0001 384.5053 ++ 762.503423 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0003 128.9327 ++ 759.851558 m 0.0003 60 | 4/11
5 h-m-p 0.0000 0.0001 1085.2602 ++ 751.535274 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0001 2072.8310 ++ 744.947674 m 0.0001 88 | 6/11
7 h-m-p 0.0011 0.0057 8.8858 -----------.. | 6/11
8 h-m-p 0.0000 0.0000 249.4459 ++ 741.816085 m 0.0000 125 | 7/11
9 h-m-p 0.0160 8.0000 3.2639 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 180.3490 ++ 739.178919 m 0.0001 164 | 8/11
11 h-m-p 0.2077 8.0000 0.0000 +++ 739.178919 m 8.0000 179 | 8/11
12 h-m-p 0.0174 8.0000 0.0056 ------C 739.178919 0 0.0000 202 | 8/11
13 h-m-p 0.0160 8.0000 0.0001 ----N 739.178919 0 0.0000 223 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178919 m 8.0000 243 | 8/11
15 h-m-p 0.0160 8.0000 1.0284 -----------C 739.178919 0 0.0000 271 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178919 m 8.0000 288 | 8/11
17 h-m-p 0.0160 8.0000 3.5244 ----------N 739.178919 0 0.0000 315 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 -Y 739.178919 0 0.0010 330 | 8/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178919 m 8.0000 350 | 8/11
20 h-m-p 0.0160 8.0000 0.3342 ---------Y 739.178919 0 0.0000 376 | 8/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178919 m 8.0000 396 | 8/11
22 h-m-p 0.0160 8.0000 4.5040 -----------N 739.178919 0 0.0000 424 | 8/11
23 h-m-p 0.0160 8.0000 0.0000 N 739.178919 0 0.0080 438 | 8/11
24 h-m-p 0.0160 8.0000 0.0000 N 739.178919 0 0.0040 455
Out..
lnL = -739.178919
456 lfun, 1824 eigenQcodon, 8208 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -739.188863 S = -739.176073 -0.004897
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:04
did 20 / 52 patterns 0:05
did 30 / 52 patterns 0:05
did 40 / 52 patterns 0:05
did 50 / 52 patterns 0:05
did 52 / 52 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075962 0.017988 0.067606 0.104778 0.012716 0.097106 0.000100 0.328627 1.127691
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 23.133750
np = 9
lnL0 = -803.225492
Iterating by ming2
Initial: fx= 803.225492
x= 0.07596 0.01799 0.06761 0.10478 0.01272 0.09711 0.00011 0.32863 1.12769
1 h-m-p 0.0000 0.0000 391.4269 ++ 802.969538 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0038 59.2821 +++++ 791.945353 m 0.0038 29 | 2/9
3 h-m-p 0.0000 0.0001 99.9670 ++ 789.031989 m 0.0001 41 | 3/9
4 h-m-p 0.0002 0.0039 53.8033 +++ 781.467310 m 0.0039 54 | 4/9
5 h-m-p 0.0007 0.0037 146.6048 ++ 763.724811 m 0.0037 66 | 5/9
6 h-m-p 0.0006 0.0028 59.0183 -----------.. | 5/9
7 h-m-p 0.0000 0.0001 296.3589 ++ 756.590939 m 0.0001 99 | 6/9
8 h-m-p 0.0160 8.0000 1.2636 -------------.. | 6/9
9 h-m-p 0.0000 0.0002 241.0782 +++ 742.351527 m 0.0002 135 | 7/9
10 h-m-p 0.0466 8.0000 0.8665 --------------.. | 7/9
11 h-m-p 0.0000 0.0001 176.9818 ++ 739.178814 m 0.0001 173 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 C 739.178814 0 1.6000 185 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 Y 739.178814 0 0.4000 198
Out..
lnL = -739.178814
199 lfun, 2189 eigenQcodon, 11940 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.061600 0.100257 0.078619 0.038073 0.097605 0.089407 0.000100 0.900000 0.700980 1.169883 2.651771
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.033434
np = 11
lnL0 = -812.612843
Iterating by ming2
Initial: fx= 812.612843
x= 0.06160 0.10026 0.07862 0.03807 0.09760 0.08941 0.00011 0.90000 0.70098 1.16988 2.65177
1 h-m-p 0.0000 0.0000 340.4507 ++ 812.395843 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 867.1578 ++ 778.959743 m 0.0001 30 | 2/11
3 h-m-p 0.0000 0.0000 47253.4327 ++ 760.300799 m 0.0000 44 | 3/11
4 h-m-p 0.0021 0.0229 32.5189 ++ 739.948792 m 0.0229 58 | 4/11
5 h-m-p 0.0000 0.0000 1764.8647 ++ 739.351773 m 0.0000 72 | 5/11
6 h-m-p 0.0000 0.0001 517.7328 ++ 739.312171 m 0.0001 86 | 6/11
7 h-m-p 0.0000 0.0000 104.0050 ++ 739.305839 m 0.0000 100 | 7/11
8 h-m-p 0.0003 0.1682 14.9059 ----------.. | 7/11
9 h-m-p 0.0000 0.0000 184.5738 ++ 739.178918 m 0.0000 136 | 8/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178918 m 8.0000 153 | 8/11
11 h-m-p 0.0534 8.0000 0.0002 ---C 739.178918 0 0.0002 173 | 8/11
12 h-m-p 0.0160 8.0000 0.0003 +++++ 739.178918 m 8.0000 193 | 8/11
13 h-m-p 0.0160 8.0000 0.2830 -----------Y 739.178918 0 0.0000 221 | 8/11
14 h-m-p 0.0160 8.0000 0.0008 +++++ 739.178918 m 8.0000 241 | 8/11
15 h-m-p 0.0219 8.0000 0.2860 -------Y 739.178918 0 0.0000 265 | 8/11
16 h-m-p 0.0160 8.0000 0.0005 +++++ 739.178918 m 8.0000 285 | 8/11
17 h-m-p 0.0160 8.0000 0.2794 ----------Y 739.178918 0 0.0000 312 | 8/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178918 m 8.0000 332 | 8/11
19 h-m-p 0.0160 8.0000 0.4157 -------Y 739.178918 0 0.0000 356 | 8/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 739.178918 m 8.0000 376 | 8/11
21 h-m-p 0.0160 8.0000 0.3356 -------C 739.178918 0 0.0000 400 | 8/11
22 h-m-p 0.0160 8.0000 0.0002 +++++ 739.178918 m 8.0000 420 | 8/11
23 h-m-p 0.0160 8.0000 0.3009 ---------C 739.178918 0 0.0000 446 | 8/11
24 h-m-p 0.0160 8.0000 0.0001 ----C 739.178918 0 0.0000 467 | 8/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178918 m 8.0000 487 | 8/11
26 h-m-p 0.0160 8.0000 0.0262 --------C 739.178918 0 0.0000 512 | 8/11
27 h-m-p 0.0160 8.0000 0.0000 -Y 739.178918 0 0.0010 530 | 8/11
28 h-m-p 0.0160 8.0000 0.0000 +++++ 739.178918 m 8.0000 550 | 8/11
29 h-m-p 0.0160 8.0000 0.1200 +++++ 739.178913 m 8.0000 570 | 8/11
30 h-m-p 0.7684 3.8421 1.1890 -------------C 739.178913 0 0.0000 600 | 8/11
31 h-m-p 0.0160 8.0000 0.0000 Y 739.178913 0 0.0040 614 | 8/11
32 h-m-p 0.0160 8.0000 0.0000 -Y 739.178913 0 0.0010 632
Out..
lnL = -739.178913
633 lfun, 7596 eigenQcodon, 41778 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -739.195366 S = -739.176301 -0.008382
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:18
did 20 / 52 patterns 0:18
did 30 / 52 patterns 0:19
did 40 / 52 patterns 0:19
did 50 / 52 patterns 0:19
did 52 / 52 patterns 0:19
Time used: 0:19
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=187
NC_011896_1_WP_010908137_1_1160_MLBR_RS05440 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
NC_002677_1_NP_301813_1_685_ML1116 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS
**************************************************
NC_011896_1_WP_010908137_1_1160_MLBR_RS05440 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
NC_002677_1_NP_301813_1_685_ML1116 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095 QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI
**************************************************
NC_011896_1_WP_010908137_1_1160_MLBR_RS05440 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
NC_002677_1_NP_301813_1_685_ML1116 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095 DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV
**************************************************
NC_011896_1_WP_010908137_1_1160_MLBR_RS05440 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
NC_002677_1_NP_301813_1_685_ML1116 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095 ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
*************************************
>NC_011896_1_WP_010908137_1_1160_MLBR_RS05440 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG CTACCAACTCC >NC_002677_1_NP_301813_1_685_ML1116 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG CTACCAACTCC >NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG CTACCAACTCC >NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG CTACCAACTCC >NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG CTACCAACTCC >NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095 ATGCGTCTCAGCGTGCGGGGTAGGCGAAGCGTTTTTGCCGGTGTCGCTGT GCTGGTTAGTGCGGCGCTGGTCGTGACCGGTTGTTCCAGGTCAATTGGAG GTACGGCGGTCAAAGCGGGCTCCCATGACGTCCCACGCAACAATAATTCC CAGCAGCAATACCCGAACCTACTCAAGGAGTGCGAGGTGCTGACCACCGA CATCCTAGCTAAGACGGTGGGTGCTGATTCGCTTGACATTCAGAGTACGT TTGTCGGCGCCATCTGCCGATGGCAGGCAGCCAATCCGGCGAGTCTGATC GACATCACCCGGTTTTGGTTCGAACAGGGCAGCCTCGCCAACGAGCGCAA GGTGGCTGACTTCTTGAAGTACAAGGTTGAGAACCGTTCGATCGCGGGTG TGGATTCGATTGTGATGCGCCCGGATGACCCGAATGGTGCGTGCGGTGTC GCCAGCGATGCGGCGGGAGTGGTCGGTTGGTGGATCAATCCTCAGGCATC CGGTATTGATGCCTGTGGGCAGGCCATCAAGCTTATGGAGTTAACGCTGG CTACCAACTCC
>NC_011896_1_WP_010908137_1_1160_MLBR_RS05440 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS >NC_002677_1_NP_301813_1_685_ML1116 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS >NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS >NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS >NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS >NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095 MRLSVRGRRSVFAGVAVLVSAALVVTGCSRSIGGTAVKAGSHDVPRNNNS QQQYPNLLKECEVLTTDILAKTVGADSLDIQSTFVGAICRWQAANPASLI DITRFWFEQGSLANERKVADFLKYKVENRSIAGVDSIVMRPDDPNGACGV ASDAAGVVGWWINPQASGIDACGQAIKLMELTLATNS
#NEXUS
[ID: 5671801812]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908137_1_1160_MLBR_RS05440
NC_002677_1_NP_301813_1_685_ML1116
NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300
NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950
NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975
NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908137_1_1160_MLBR_RS05440,
2 NC_002677_1_NP_301813_1_685_ML1116,
3 NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300,
4 NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950,
5 NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975,
6 NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06934485,2:0.06601584,3:0.0668273,4:0.0692597,5:0.0685791,6:0.06810833);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06934485,2:0.06601584,3:0.0668273,4:0.0692597,5:0.0685791,6:0.06810833);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -768.57 -773.49
2 -768.56 -771.99
--------------------------------------
TOTAL -768.56 -773.00
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1116/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.890748 0.087855 0.361312 1.463604 0.855954 1265.96 1383.48 1.000
r(A<->C){all} 0.163870 0.018522 0.000009 0.438888 0.128123 218.35 238.03 1.003
r(A<->G){all} 0.164656 0.019043 0.000032 0.438647 0.127987 126.53 181.88 1.002
r(A<->T){all} 0.176172 0.022958 0.000129 0.492756 0.134067 237.91 292.19 1.000
r(C<->G){all} 0.165852 0.020204 0.000070 0.446225 0.127658 176.24 219.00 1.003
r(C<->T){all} 0.170433 0.020640 0.000014 0.470250 0.132524 108.08 184.42 1.004
r(G<->T){all} 0.159017 0.019429 0.000016 0.440817 0.120700 380.58 411.47 1.001
pi(A){all} 0.192845 0.000271 0.162477 0.226009 0.192480 1192.37 1228.17 1.000
pi(C){all} 0.259207 0.000337 0.224414 0.295955 0.258850 1010.79 1189.37 1.000
pi(G){all} 0.325008 0.000386 0.285737 0.360674 0.325183 948.87 1051.17 1.000
pi(T){all} 0.222940 0.000322 0.187893 0.259638 0.222836 1118.12 1237.35 1.000
alpha{1,2} 0.432717 0.243387 0.000121 1.392807 0.267905 840.63 1034.31 1.000
alpha{3} 0.461335 0.241727 0.000163 1.426690 0.300769 1337.01 1419.00 1.000
pinvar{all} 0.997253 0.000010 0.991265 0.999999 0.998297 1408.74 1440.23 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1116/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 187
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 2 2 2 2 2 2
TTC 2 2 2 2 2 2 | TCC 5 5 5 5 5 5 | TAC 2 2 2 2 2 2 | TGC 3 3 3 3 3 3
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 2 2 2 2 2 2
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 0 0 | CAC 0 0 0 0 0 0 | CGC 3 3 3 3 3 3
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 5 5 5 5 5 5 | CCG 4 4 4 4 4 4 | CAG 7 7 7 7 7 7 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 4 4 4 4 | Thr ACT 0 0 0 0 0 0 | Asn AAT 5 5 5 5 5 5 | Ser AGT 3 3 3 3 3 3
ATC 7 7 7 7 7 7 | ACC 5 5 5 5 5 5 | AAC 5 5 5 5 5 5 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 4 4 4 4 4 4 | AAG 6 6 6 6 6 6 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 5 5 5 5 5 5 | Asp GAT 5 5 5 5 5 5 | Gly GGT 10 10 10 10 10 10
GTC 7 7 7 7 7 7 | GCC 7 7 7 7 7 7 | GAC 6 6 6 6 6 6 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 2 2 2 2 2 2 | Glu GAA 1 1 1 1 1 1 | GGA 2 2 2 2 2 2
GTG 9 9 9 9 9 9 | GCG 9 9 9 9 9 9 | GAG 5 5 5 5 5 5 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908137_1_1160_MLBR_RS05440
position 1: T:0.14439 C:0.19251 A:0.26203 G:0.40107
position 2: T:0.27807 C:0.25134 A:0.24064 G:0.22995
position 3: T:0.24599 C:0.33155 A:0.07487 G:0.34759
Average T:0.22282 C:0.25847 A:0.19251 G:0.32620
#2: NC_002677_1_NP_301813_1_685_ML1116
position 1: T:0.14439 C:0.19251 A:0.26203 G:0.40107
position 2: T:0.27807 C:0.25134 A:0.24064 G:0.22995
position 3: T:0.24599 C:0.33155 A:0.07487 G:0.34759
Average T:0.22282 C:0.25847 A:0.19251 G:0.32620
#3: NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300
position 1: T:0.14439 C:0.19251 A:0.26203 G:0.40107
position 2: T:0.27807 C:0.25134 A:0.24064 G:0.22995
position 3: T:0.24599 C:0.33155 A:0.07487 G:0.34759
Average T:0.22282 C:0.25847 A:0.19251 G:0.32620
#4: NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950
position 1: T:0.14439 C:0.19251 A:0.26203 G:0.40107
position 2: T:0.27807 C:0.25134 A:0.24064 G:0.22995
position 3: T:0.24599 C:0.33155 A:0.07487 G:0.34759
Average T:0.22282 C:0.25847 A:0.19251 G:0.32620
#5: NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975
position 1: T:0.14439 C:0.19251 A:0.26203 G:0.40107
position 2: T:0.27807 C:0.25134 A:0.24064 G:0.22995
position 3: T:0.24599 C:0.33155 A:0.07487 G:0.34759
Average T:0.22282 C:0.25847 A:0.19251 G:0.32620
#6: NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095
position 1: T:0.14439 C:0.19251 A:0.26203 G:0.40107
position 2: T:0.27807 C:0.25134 A:0.24064 G:0.22995
position 3: T:0.24599 C:0.33155 A:0.07487 G:0.34759
Average T:0.22282 C:0.25847 A:0.19251 G:0.32620
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 12
TTC 12 | TCC 30 | TAC 12 | TGC 18
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 18 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 12
CTC 18 | CCC 0 | CAC 0 | CGC 18
CTA 12 | CCA 6 | Gln Q CAA 6 | CGA 12
CTG 30 | CCG 24 | CAG 42 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 24 | Thr T ACT 0 | Asn N AAT 30 | Ser S AGT 18
ATC 42 | ACC 30 | AAC 30 | AGC 24
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 24 | AAG 36 | AGG 12
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 30 | Asp D GAT 30 | Gly G GGT 60
GTC 42 | GCC 42 | GAC 36 | GGC 18
GTA 0 | GCA 12 | Glu E GAA 6 | GGA 12
GTG 54 | GCG 54 | GAG 30 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14439 C:0.19251 A:0.26203 G:0.40107
position 2: T:0.27807 C:0.25134 A:0.24064 G:0.22995
position 3: T:0.24599 C:0.33155 A:0.07487 G:0.34759
Average T:0.22282 C:0.25847 A:0.19251 G:0.32620
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -739.178814 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908137_1_1160_MLBR_RS05440: 0.000004, NC_002677_1_NP_301813_1_685_ML1116: 0.000004, NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300: 0.000004, NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950: 0.000004, NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975: 0.000004, NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 444.0 117.0 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 444.0 117.0 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 444.0 117.0 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 444.0 117.0 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 444.0 117.0 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 444.0 117.0 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -739.178814 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908137_1_1160_MLBR_RS05440: 0.000004, NC_002677_1_NP_301813_1_685_ML1116: 0.000004, NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300: 0.000004, NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950: 0.000004, NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975: 0.000004, NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -739.178919 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.642149 0.202929 0.000001 2.521120
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908137_1_1160_MLBR_RS05440: 0.000004, NC_002677_1_NP_301813_1_685_ML1116: 0.000004, NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300: 0.000004, NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950: 0.000004, NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975: 0.000004, NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.64215 0.20293 0.15492
w: 0.00000 1.00000 2.52112
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 444.0 117.0 0.5935 0.0000 0.0000 0.0 0.0
7..2 0.000 444.0 117.0 0.5935 0.0000 0.0000 0.0 0.0
7..3 0.000 444.0 117.0 0.5935 0.0000 0.0000 0.0 0.0
7..4 0.000 444.0 117.0 0.5935 0.0000 0.0000 0.0 0.0
7..5 0.000 444.0 117.0 0.5935 0.0000 0.0000 0.0 0.0
7..6 0.000 444.0 117.0 0.5935 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908137_1_1160_MLBR_RS05440)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908137_1_1160_MLBR_RS05440)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -739.178814 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.365988
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908137_1_1160_MLBR_RS05440: 0.000004, NC_002677_1_NP_301813_1_685_ML1116: 0.000004, NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300: 0.000004, NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950: 0.000004, NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975: 0.000004, NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.36599
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00033
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 444.0 117.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -739.178913 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.761276 0.005000 1.580506 2.036417
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908137_1_1160_MLBR_RS05440: 0.000004, NC_002677_1_NP_301813_1_685_ML1116: 0.000004, NZ_LVXE01000074_1_WP_010908137_1_2634_A3216_RS13300: 0.000004, NZ_LYPH01000021_1_WP_010908137_1_831_A8144_RS03950: 0.000004, NZ_CP029543_1_WP_010908137_1_1180_DIJ64_RS05975: 0.000004, NZ_AP014567_1_WP_010908137_1_1204_JK2ML_RS06095: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.76128 p = 0.00500 q = 1.58051
(p1 = 0.23872) w = 2.03642
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.23872
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.03642
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 444.0 117.0 0.4861 0.0000 0.0000 0.0 0.0
7..2 0.000 444.0 117.0 0.4861 0.0000 0.0000 0.0 0.0
7..3 0.000 444.0 117.0 0.4861 0.0000 0.0000 0.0 0.0
7..4 0.000 444.0 117.0 0.4861 0.0000 0.0000 0.0 0.0
7..5 0.000 444.0 117.0 0.4861 0.0000 0.0000 0.0 0.0
7..6 0.000 444.0 117.0 0.4861 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908137_1_1160_MLBR_RS05440)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908137_1_1160_MLBR_RS05440)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:19
Model 1: NearlyNeutral -739.178814 Model 2: PositiveSelection -739.178919 Model 0: one-ratio -739.178814 Model 7: beta -739.178814 Model 8: beta&w>1 -739.178913 Model 0 vs 1 0.0 Model 2 vs 1 2.0999999992454832E-4 Model 8 vs 7 1.979999999548454E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
