--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:50:39 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0837/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -528.38 -532.05
2 -528.42 -531.04
--------------------------------------
TOTAL -528.40 -531.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900658 0.092611 0.365219 1.500311 0.868094 1501.00 1501.00 1.000
r(A<->C){all} 0.176594 0.019789 0.000001 0.456062 0.143700 196.04 220.17 1.005
r(A<->G){all} 0.157882 0.018917 0.000004 0.428793 0.121342 179.25 191.91 1.000
r(A<->T){all} 0.165016 0.021719 0.000025 0.463584 0.120503 187.18 187.97 1.000
r(C<->G){all} 0.167988 0.019107 0.000013 0.439835 0.133919 107.50 239.23 1.001
r(C<->T){all} 0.167833 0.019936 0.000001 0.446411 0.133091 204.78 292.39 1.004
r(G<->T){all} 0.164687 0.018953 0.000101 0.433610 0.128741 258.69 271.38 1.000
pi(A){all} 0.219022 0.000434 0.180638 0.261814 0.218461 1333.43 1361.25 1.000
pi(C){all} 0.249387 0.000469 0.204265 0.289641 0.249177 1285.78 1393.39 1.000
pi(G){all} 0.279489 0.000517 0.237580 0.325740 0.279100 1333.31 1337.69 1.001
pi(T){all} 0.252102 0.000491 0.212248 0.298121 0.251451 1255.02 1270.94 1.001
alpha{1,2} 0.422326 0.238581 0.000178 1.416390 0.246950 1158.11 1329.55 1.000
alpha{3} 0.469314 0.243453 0.000252 1.493609 0.302912 1076.64 1214.93 1.000
pinvar{all} 0.995783 0.000025 0.986942 0.999999 0.997378 1134.73 1219.44 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -506.456613
Model 2: PositiveSelection -506.456608
Model 0: one-ratio -506.456616
Model 7: beta -506.456591
Model 8: beta&w>1 -506.456606
Model 0 vs 1 5.999999984851456E-6
Model 2 vs 1 9.999999974752427E-6
Model 8 vs 7 3.000000003794412E-5
>C1
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C2
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C3
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C4
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C5
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C6
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=127
C1 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C2 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C3 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C4 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C5 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C6 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
**************************************************
C1 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C2 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C3 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C4 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C5 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C6 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
**************************************************
C1 IRRTIAIPVFGDHADISRVGIDIERHL
C2 IRRTIAIPVFGDHADISRVGIDIERHL
C3 IRRTIAIPVFGDHADISRVGIDIERHL
C4 IRRTIAIPVFGDHADISRVGIDIERHL
C5 IRRTIAIPVFGDHADISRVGIDIERHL
C6 IRRTIAIPVFGDHADISRVGIDIERHL
***************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3810]--->[3810]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.461 Mb, Max= 30.657 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C2 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C3 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C4 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C5 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
C6 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
**************************************************
C1 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C2 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C3 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C4 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C5 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
C6 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
**************************************************
C1 IRRTIAIPVFGDHADISRVGIDIERHL
C2 IRRTIAIPVFGDHADISRVGIDIERHL
C3 IRRTIAIPVFGDHADISRVGIDIERHL
C4 IRRTIAIPVFGDHADISRVGIDIERHL
C5 IRRTIAIPVFGDHADISRVGIDIERHL
C6 IRRTIAIPVFGDHADISRVGIDIERHL
***************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
C2 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
C3 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
C4 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
C5 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
C6 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
**************************************************
C1 AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
C2 AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
C3 AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
C4 AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
C5 AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
C6 AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
**************************************************
C1 TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
C2 TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
C3 TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
C4 TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
C5 TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
C6 TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
**************************************************
C1 TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
C2 TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
C3 TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
C4 TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
C5 TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
C6 TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
**************************************************
C1 TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
C2 TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
C3 TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
C4 TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
C5 TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
C6 TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
**************************************************
C1 TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
C2 TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
C3 TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
C4 TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
C5 TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
C6 TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
**************************************************
C1 ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
C2 ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
C3 ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
C4 ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
C5 ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
C6 ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
**************************************************
C1 GCGCGTCGGCATCGATATTGAGCGTCATCTG
C2 GCGCGTCGGCATCGATATTGAGCGTCATCTG
C3 GCGCGTCGGCATCGATATTGAGCGTCATCTG
C4 GCGCGTCGGCATCGATATTGAGCGTCATCTG
C5 GCGCGTCGGCATCGATATTGAGCGTCATCTG
C6 GCGCGTCGGCATCGATATTGAGCGTCATCTG
*******************************
>C1
ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
GCGCGTCGGCATCGATATTGAGCGTCATCTG
>C2
ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
GCGCGTCGGCATCGATATTGAGCGTCATCTG
>C3
ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
GCGCGTCGGCATCGATATTGAGCGTCATCTG
>C4
ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
GCGCGTCGGCATCGATATTGAGCGTCATCTG
>C5
ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
GCGCGTCGGCATCGATATTGAGCGTCATCTG
>C6
ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT
AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG
TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG
TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA
TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG
TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG
ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC
GCGCGTCGGCATCGATATTGAGCGTCATCTG
>C1
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C2
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C3
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C4
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C5
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
>C6
MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
IRRTIAIPVFGDHADISRVGIDIERHL
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 381 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579798165
Setting output file names to "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 43047956
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0347073948
Seed = 613713338
Swapseed = 1579798165
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -852.696134 -- -24.965149
Chain 2 -- -852.696264 -- -24.965149
Chain 3 -- -852.696264 -- -24.965149
Chain 4 -- -852.696215 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -852.696264 -- -24.965149
Chain 2 -- -852.696134 -- -24.965149
Chain 3 -- -852.696264 -- -24.965149
Chain 4 -- -852.696134 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-852.696] (-852.696) (-852.696) (-852.696) * [-852.696] (-852.696) (-852.696) (-852.696)
500 -- (-540.260) (-532.871) [-540.073] (-534.306) * [-539.652] (-538.103) (-539.151) (-541.617) -- 0:00:00
1000 -- [-535.404] (-537.465) (-534.279) (-538.339) * (-534.758) (-535.134) [-542.177] (-552.685) -- 0:00:00
1500 -- [-536.946] (-544.167) (-542.796) (-530.834) * (-546.635) [-532.714] (-537.819) (-534.442) -- 0:00:00
2000 -- [-536.522] (-544.879) (-535.101) (-539.388) * [-543.939] (-538.244) (-538.510) (-543.282) -- 0:00:00
2500 -- (-534.735) (-540.551) [-534.745] (-540.566) * [-532.495] (-538.002) (-538.018) (-541.847) -- 0:00:00
3000 -- (-536.156) (-540.403) [-534.294] (-539.644) * (-542.052) (-546.614) [-539.631] (-536.497) -- 0:00:00
3500 -- (-540.092) [-538.451] (-543.513) (-535.613) * [-535.120] (-543.054) (-537.827) (-536.419) -- 0:00:00
4000 -- (-534.595) (-532.567) [-539.683] (-536.825) * (-548.226) [-536.205] (-543.790) (-540.153) -- 0:00:00
4500 -- (-534.001) (-536.697) [-537.451] (-536.184) * [-536.864] (-545.666) (-535.061) (-535.200) -- 0:00:00
5000 -- (-533.587) [-535.396] (-556.307) (-535.515) * (-532.413) (-547.631) [-537.207] (-542.359) -- 0:00:00
Average standard deviation of split frequencies: 0.092852
5500 -- (-550.121) (-532.726) (-538.834) [-536.911] * (-552.721) [-539.116] (-543.059) (-536.460) -- 0:00:00
6000 -- (-542.531) (-534.749) (-534.802) [-535.220] * (-540.386) [-533.752] (-549.897) (-535.681) -- 0:00:00
6500 -- (-538.387) [-536.046] (-536.469) (-539.377) * (-540.577) (-538.839) (-535.474) [-538.910] -- 0:00:00
7000 -- (-537.858) (-533.888) (-539.493) [-534.798] * (-539.378) [-535.714] (-529.359) (-542.014) -- 0:00:00
7500 -- [-539.963] (-538.122) (-542.643) (-538.114) * [-535.649] (-536.435) (-530.059) (-548.222) -- 0:00:00
8000 -- [-540.443] (-538.962) (-534.806) (-541.554) * (-535.906) [-544.375] (-532.532) (-534.933) -- 0:00:00
8500 -- (-542.878) (-538.664) (-537.973) [-542.618] * [-534.786] (-547.347) (-530.197) (-533.594) -- 0:00:00
9000 -- (-541.419) (-538.100) (-540.885) [-538.308] * (-536.329) (-532.549) (-528.626) [-528.035] -- 0:00:00
9500 -- (-539.261) (-535.529) [-536.445] (-538.880) * (-543.770) [-529.638] (-528.760) (-530.042) -- 0:00:00
10000 -- (-547.017) (-543.325) (-535.748) [-537.514] * (-534.873) [-531.172] (-528.979) (-531.199) -- 0:00:00
Average standard deviation of split frequencies: 0.057452
10500 -- (-540.058) (-542.234) (-539.180) [-536.537] * (-536.185) (-527.520) (-533.465) [-530.079] -- 0:00:00
11000 -- [-534.663] (-534.546) (-535.544) (-539.324) * (-536.431) [-527.028] (-530.179) (-530.458) -- 0:00:00
11500 -- (-540.180) (-539.373) (-539.234) [-532.284] * (-541.659) [-528.623] (-529.680) (-535.344) -- 0:00:00
12000 -- [-537.246] (-532.595) (-548.277) (-538.527) * [-532.928] (-527.891) (-529.036) (-534.173) -- 0:00:00
12500 -- (-538.133) [-544.902] (-546.828) (-537.011) * (-532.489) [-528.815] (-528.645) (-527.180) -- 0:00:00
13000 -- (-534.932) (-540.635) [-535.705] (-536.664) * [-534.653] (-530.152) (-529.841) (-530.938) -- 0:00:00
13500 -- (-535.001) (-536.985) (-538.469) [-534.492] * (-533.925) (-528.256) (-531.405) [-528.637] -- 0:00:00
14000 -- (-543.464) (-539.006) [-534.612] (-536.249) * [-530.686] (-531.490) (-529.858) (-530.366) -- 0:00:00
14500 -- (-548.700) [-540.175] (-536.304) (-537.924) * (-539.966) [-533.854] (-529.729) (-530.537) -- 0:00:00
15000 -- [-542.232] (-547.311) (-536.607) (-544.251) * (-544.292) [-527.881] (-529.674) (-529.720) -- 0:00:00
Average standard deviation of split frequencies: 0.070383
15500 -- (-537.529) [-535.551] (-533.987) (-540.056) * [-532.437] (-527.794) (-529.178) (-528.271) -- 0:01:03
16000 -- [-531.732] (-534.991) (-543.956) (-537.676) * (-538.894) [-527.703] (-530.476) (-527.632) -- 0:01:01
16500 -- [-534.956] (-537.291) (-535.128) (-533.970) * [-541.155] (-527.762) (-528.846) (-528.857) -- 0:00:59
17000 -- (-536.006) [-534.961] (-538.863) (-538.528) * [-532.233] (-528.501) (-528.534) (-529.336) -- 0:00:57
17500 -- (-542.109) [-537.798] (-536.394) (-536.569) * [-541.809] (-529.456) (-527.933) (-530.069) -- 0:00:56
18000 -- [-539.889] (-538.323) (-543.315) (-537.537) * (-538.464) (-528.551) (-534.043) [-528.909] -- 0:00:54
18500 -- [-536.400] (-541.502) (-540.890) (-538.124) * (-538.438) (-529.928) (-532.237) [-528.058] -- 0:00:53
19000 -- (-536.169) [-539.380] (-536.823) (-534.482) * [-540.424] (-531.856) (-530.391) (-533.754) -- 0:00:51
19500 -- (-540.601) [-534.664] (-540.932) (-536.812) * [-541.212] (-529.654) (-531.454) (-526.838) -- 0:00:50
20000 -- (-539.242) (-539.451) [-538.494] (-535.711) * (-534.164) [-528.045] (-532.607) (-529.631) -- 0:00:49
Average standard deviation of split frequencies: 0.055758
20500 -- [-536.256] (-540.401) (-539.222) (-539.275) * (-547.468) (-528.190) [-527.174] (-534.721) -- 0:00:47
21000 -- (-539.712) (-540.714) (-538.143) [-531.306] * (-539.661) (-530.256) [-527.496] (-530.498) -- 0:00:46
21500 -- (-529.721) (-540.934) [-536.712] (-552.791) * (-538.376) [-528.915] (-531.871) (-530.702) -- 0:00:45
22000 -- (-531.457) (-540.331) [-537.452] (-534.851) * (-540.227) [-528.426] (-528.493) (-533.022) -- 0:00:44
22500 -- [-540.271] (-539.767) (-538.729) (-535.367) * (-542.223) (-532.603) (-531.047) [-528.925] -- 0:00:43
23000 -- (-548.731) (-547.475) [-531.904] (-542.846) * [-536.550] (-529.705) (-534.218) (-530.503) -- 0:00:42
23500 -- (-537.466) (-539.885) [-540.264] (-541.989) * (-542.784) [-529.244] (-533.627) (-527.622) -- 0:00:41
24000 -- (-533.942) (-538.278) (-538.771) [-536.875] * (-535.270) (-527.450) [-528.508] (-528.122) -- 0:00:40
24500 -- (-533.236) (-533.657) (-540.132) [-540.793] * (-536.837) [-530.062] (-533.882) (-529.018) -- 0:00:39
25000 -- (-536.927) (-534.000) (-537.009) [-534.706] * (-535.935) (-531.638) (-531.621) [-528.613] -- 0:00:39
Average standard deviation of split frequencies: 0.046151
25500 -- (-537.915) [-535.913] (-539.205) (-538.098) * (-537.269) (-529.414) (-533.294) [-527.880] -- 0:00:38
26000 -- (-543.636) (-552.413) [-534.037] (-539.385) * (-538.146) (-529.344) [-530.759] (-529.340) -- 0:00:37
26500 -- (-535.266) [-536.252] (-543.536) (-543.303) * (-534.896) (-529.499) (-530.755) [-528.027] -- 0:00:36
27000 -- (-532.469) (-542.794) (-536.537) [-542.313] * (-539.852) (-527.812) (-528.268) [-532.147] -- 0:00:36
27500 -- (-536.721) [-532.924] (-540.159) (-539.720) * (-542.486) (-527.533) (-528.330) [-529.630] -- 0:00:35
28000 -- (-540.819) (-530.548) [-539.249] (-535.251) * (-537.540) (-529.290) (-528.926) [-530.402] -- 0:00:34
28500 -- (-538.042) (-528.437) (-537.171) [-548.641] * (-539.596) (-530.251) [-528.318] (-529.172) -- 0:00:34
29000 -- [-536.908] (-528.399) (-543.856) (-537.294) * (-543.727) (-530.965) [-529.816] (-527.816) -- 0:00:33
29500 -- (-540.798) (-531.171) (-528.788) [-540.368] * [-533.446] (-529.686) (-528.067) (-527.685) -- 0:00:32
30000 -- [-530.407] (-528.377) (-530.331) (-532.720) * (-549.762) [-528.924] (-527.634) (-530.390) -- 0:00:32
Average standard deviation of split frequencies: 0.037661
30500 -- (-537.479) (-528.216) (-529.135) [-534.272] * (-540.540) (-533.147) [-527.809] (-532.134) -- 0:00:31
31000 -- (-534.544) (-528.005) (-530.344) [-533.174] * (-536.278) (-531.631) [-528.041] (-529.658) -- 0:00:31
31500 -- (-541.120) (-529.862) (-530.620) [-533.172] * [-539.053] (-529.758) (-528.535) (-532.167) -- 0:00:30
32000 -- (-544.319) [-530.114] (-533.246) (-544.070) * (-542.374) (-528.229) (-530.175) [-531.710] -- 0:01:00
32500 -- (-540.683) (-529.983) (-528.565) [-530.754] * (-537.054) [-532.113] (-531.829) (-528.680) -- 0:00:59
33000 -- [-533.973] (-529.727) (-528.367) (-538.452) * [-537.251] (-529.530) (-530.981) (-529.100) -- 0:00:58
33500 -- [-536.160] (-527.616) (-527.341) (-536.881) * (-537.963) (-529.231) [-529.176] (-528.713) -- 0:00:57
34000 -- (-536.433) [-528.890] (-531.573) (-536.844) * [-533.759] (-528.470) (-527.180) (-528.737) -- 0:00:56
34500 -- (-543.520) (-527.401) (-528.226) [-541.739] * [-533.051] (-529.469) (-533.340) (-532.622) -- 0:00:55
35000 -- (-538.512) (-527.679) [-530.453] (-534.279) * (-538.500) (-531.392) [-529.140] (-527.237) -- 0:00:55
Average standard deviation of split frequencies: 0.037905
35500 -- [-535.800] (-528.666) (-531.504) (-532.926) * (-534.701) [-527.957] (-529.257) (-527.976) -- 0:00:54
36000 -- (-543.279) (-530.866) (-531.588) [-535.434] * (-546.146) [-528.759] (-529.492) (-529.211) -- 0:00:53
36500 -- (-547.718) [-529.064] (-532.535) (-538.120) * (-540.886) (-531.597) [-527.817] (-527.518) -- 0:00:52
37000 -- (-532.989) (-527.900) (-529.518) [-542.361] * (-536.182) [-528.666] (-528.272) (-528.978) -- 0:00:52
37500 -- (-554.050) [-527.464] (-530.648) (-536.456) * (-544.821) (-527.962) (-530.649) [-527.476] -- 0:00:51
38000 -- (-544.931) (-530.110) (-529.943) [-539.385] * (-536.360) [-528.186] (-529.490) (-532.540) -- 0:00:50
38500 -- [-540.920] (-530.630) (-531.915) (-539.308) * (-536.352) (-527.465) [-528.871] (-529.232) -- 0:00:49
39000 -- (-551.532) [-528.241] (-528.087) (-544.349) * (-536.097) [-527.282] (-528.740) (-527.101) -- 0:00:49
39500 -- (-539.063) (-531.241) [-527.156] (-543.874) * (-541.988) (-527.747) (-527.148) [-531.565] -- 0:00:48
40000 -- [-534.742] (-529.212) (-531.353) (-544.821) * (-536.529) (-527.916) [-529.148] (-529.629) -- 0:00:48
Average standard deviation of split frequencies: 0.039657
40500 -- (-535.453) (-531.622) (-537.081) [-534.613] * (-548.088) (-527.206) (-531.420) [-527.546] -- 0:00:47
41000 -- (-535.207) [-529.216] (-529.585) (-540.877) * (-542.721) [-530.457] (-531.654) (-527.326) -- 0:00:46
41500 -- (-536.851) [-531.565] (-528.464) (-533.716) * [-537.272] (-530.521) (-532.904) (-527.360) -- 0:00:46
42000 -- (-539.816) (-530.740) (-535.964) [-538.136] * (-547.216) (-528.900) [-527.214] (-529.057) -- 0:00:45
42500 -- [-536.731] (-530.818) (-529.770) (-537.105) * (-531.254) (-528.686) (-527.283) [-530.019] -- 0:00:45
43000 -- (-539.973) (-528.816) [-528.437] (-535.564) * (-538.761) (-528.749) (-527.766) [-527.467] -- 0:00:44
43500 -- (-537.389) (-527.902) (-528.980) [-536.079] * [-533.805] (-528.131) (-528.797) (-532.576) -- 0:00:43
44000 -- [-540.640] (-529.906) (-532.058) (-532.019) * (-540.276) (-527.230) (-528.304) [-528.419] -- 0:00:43
44500 -- (-537.677) (-527.113) [-532.159] (-538.598) * (-536.499) (-528.318) [-529.444] (-529.030) -- 0:00:42
45000 -- [-547.101] (-528.225) (-528.682) (-538.985) * (-534.592) (-531.417) (-531.350) [-529.534] -- 0:00:42
Average standard deviation of split frequencies: 0.038003
45500 -- (-558.932) (-526.988) [-528.622] (-537.349) * (-537.064) (-530.735) [-527.796] (-529.626) -- 0:00:41
46000 -- (-536.433) (-528.377) (-530.348) [-537.283] * [-537.821] (-528.698) (-527.195) (-528.197) -- 0:00:41
46500 -- (-548.824) (-528.841) [-530.621] (-534.714) * (-539.905) (-527.615) (-528.885) [-530.220] -- 0:00:41
47000 -- [-538.707] (-527.637) (-532.680) (-540.820) * (-542.629) (-528.503) (-530.244) [-528.543] -- 0:00:40
47500 -- (-534.268) [-527.409] (-533.875) (-536.573) * (-535.380) [-529.212] (-529.360) (-527.292) -- 0:01:00
48000 -- [-538.638] (-529.548) (-530.541) (-540.251) * (-561.943) [-527.656] (-529.944) (-528.710) -- 0:00:59
48500 -- (-540.124) (-529.448) (-529.194) [-537.368] * (-534.443) [-528.399] (-529.555) (-533.964) -- 0:00:58
49000 -- (-539.319) (-530.255) [-531.333] (-539.408) * (-532.160) (-528.709) [-528.822] (-533.962) -- 0:00:58
49500 -- (-539.730) [-531.216] (-527.619) (-537.872) * [-528.741] (-527.296) (-529.790) (-528.547) -- 0:00:57
50000 -- (-535.250) (-532.166) [-530.526] (-543.462) * (-529.325) [-532.677] (-527.323) (-529.232) -- 0:00:57
Average standard deviation of split frequencies: 0.037216
50500 -- (-538.309) (-532.697) [-527.703] (-540.139) * (-532.132) (-529.931) [-528.634] (-529.484) -- 0:00:56
51000 -- [-539.057] (-530.705) (-531.565) (-532.166) * (-528.381) (-528.940) (-529.757) [-528.167] -- 0:00:55
51500 -- [-533.235] (-527.258) (-529.454) (-534.646) * [-530.536] (-530.707) (-536.609) (-531.788) -- 0:00:55
52000 -- (-539.334) [-528.782] (-529.856) (-543.060) * (-531.109) (-528.827) [-529.173] (-529.644) -- 0:00:54
52500 -- (-536.823) (-531.966) [-527.912] (-540.157) * (-529.132) (-530.914) [-528.196] (-532.135) -- 0:00:54
53000 -- (-534.261) [-530.372] (-528.289) (-539.270) * (-530.802) (-529.576) [-528.437] (-530.324) -- 0:00:53
53500 -- (-536.257) [-531.374] (-534.928) (-555.714) * (-529.212) (-528.727) [-527.121] (-529.352) -- 0:00:53
54000 -- (-543.112) (-530.290) [-530.201] (-529.980) * (-526.933) [-528.413] (-526.874) (-528.276) -- 0:00:52
54500 -- (-541.752) (-530.076) [-530.032] (-528.784) * [-528.150] (-528.954) (-529.166) (-531.395) -- 0:00:52
55000 -- (-547.795) (-531.886) (-529.076) [-530.407] * (-528.690) [-528.348] (-531.909) (-529.395) -- 0:00:51
Average standard deviation of split frequencies: 0.027358
55500 -- (-539.761) (-532.477) (-531.134) [-527.771] * [-526.892] (-530.168) (-529.393) (-528.728) -- 0:00:51
56000 -- (-535.932) (-529.572) [-528.385] (-527.654) * (-527.999) [-527.330] (-529.457) (-528.758) -- 0:00:50
56500 -- [-536.924] (-528.331) (-532.737) (-528.635) * [-529.155] (-528.157) (-530.194) (-530.550) -- 0:00:50
57000 -- (-537.172) (-527.704) (-527.256) [-528.634] * (-536.251) [-527.873] (-529.851) (-529.718) -- 0:00:49
57500 -- [-538.660] (-530.916) (-530.054) (-529.669) * [-528.300] (-530.749) (-528.665) (-528.853) -- 0:00:49
58000 -- (-538.458) [-530.893] (-530.821) (-529.265) * [-529.886] (-530.648) (-527.968) (-527.884) -- 0:00:48
58500 -- (-542.111) (-530.231) (-533.553) [-528.932] * (-530.475) (-529.456) [-528.438] (-528.301) -- 0:00:48
59000 -- [-538.205] (-528.043) (-528.323) (-528.263) * [-532.016] (-527.873) (-528.911) (-529.726) -- 0:00:47
59500 -- (-537.137) [-527.499] (-530.417) (-527.691) * (-533.203) [-527.157] (-528.864) (-527.895) -- 0:00:47
60000 -- (-535.514) (-529.896) [-528.197] (-527.043) * [-528.694] (-530.288) (-531.247) (-529.215) -- 0:00:47
Average standard deviation of split frequencies: 0.026333
60500 -- (-537.277) [-526.992] (-528.012) (-529.048) * (-529.116) (-528.509) [-529.280] (-529.439) -- 0:00:46
61000 -- [-541.531] (-527.793) (-532.178) (-530.532) * (-530.931) (-528.951) (-527.860) [-528.531] -- 0:00:46
61500 -- (-550.134) [-527.693] (-529.351) (-529.036) * (-529.406) [-531.823] (-527.852) (-530.411) -- 0:00:45
62000 -- (-536.773) (-529.853) (-528.147) [-528.736] * (-530.127) [-530.262] (-528.027) (-531.553) -- 0:00:45
62500 -- [-544.091] (-528.240) (-528.241) (-529.256) * [-532.485] (-531.131) (-527.682) (-528.825) -- 0:00:45
63000 -- (-542.253) (-529.636) (-530.384) [-528.358] * (-528.914) (-529.044) [-527.330] (-531.838) -- 0:00:44
63500 -- (-538.016) [-532.255] (-529.712) (-528.375) * (-529.566) (-530.696) [-529.304] (-526.917) -- 0:00:58
64000 -- (-536.090) (-534.643) (-532.006) [-530.136] * (-531.197) [-529.515] (-531.082) (-529.442) -- 0:00:58
64500 -- (-544.953) (-529.421) [-533.224] (-529.699) * (-529.329) [-527.744] (-532.096) (-530.055) -- 0:00:58
65000 -- (-533.833) [-530.418] (-533.302) (-528.999) * (-530.337) (-531.471) (-527.805) [-528.475] -- 0:00:57
Average standard deviation of split frequencies: 0.026869
65500 -- (-542.515) (-530.993) [-530.431] (-529.755) * [-531.741] (-528.906) (-528.943) (-530.320) -- 0:00:57
66000 -- (-544.298) (-529.560) [-527.896] (-534.322) * [-528.862] (-527.002) (-528.004) (-532.302) -- 0:00:56
66500 -- (-533.693) (-531.540) [-527.636] (-530.761) * (-529.248) (-527.629) (-528.742) [-531.439] -- 0:00:56
67000 -- (-541.964) (-529.779) [-531.108] (-529.146) * (-529.602) [-529.930] (-528.253) (-534.297) -- 0:00:55
67500 -- (-545.052) [-529.400] (-528.681) (-528.213) * (-528.396) (-530.460) [-529.298] (-533.326) -- 0:00:55
68000 -- (-541.157) (-527.482) [-529.876] (-530.527) * [-529.045] (-530.577) (-530.768) (-528.440) -- 0:00:54
68500 -- (-531.710) [-527.744] (-527.745) (-528.387) * [-529.246] (-528.225) (-530.005) (-528.559) -- 0:00:54
69000 -- (-542.483) [-529.147] (-527.119) (-530.051) * (-530.453) (-527.531) (-530.960) [-534.889] -- 0:00:53
69500 -- (-535.635) [-528.382] (-527.867) (-529.460) * (-529.518) [-528.154] (-533.298) (-532.741) -- 0:00:53
70000 -- (-549.535) (-527.245) (-528.874) [-528.702] * [-528.375] (-530.049) (-527.613) (-528.569) -- 0:00:53
Average standard deviation of split frequencies: 0.025279
70500 -- (-537.457) [-527.332] (-527.159) (-531.875) * (-527.683) (-529.394) [-529.811] (-527.031) -- 0:00:52
71000 -- (-536.074) (-527.715) (-532.859) [-531.555] * (-527.959) (-534.674) [-528.413] (-528.639) -- 0:00:52
71500 -- (-538.451) [-529.296] (-527.661) (-532.010) * (-530.608) (-530.217) [-527.555] (-533.045) -- 0:00:51
72000 -- (-539.285) (-529.709) [-527.675] (-531.802) * (-530.832) (-528.021) (-527.620) [-529.885] -- 0:00:51
72500 -- (-539.183) (-528.853) (-528.136) [-532.329] * (-532.193) [-527.018] (-527.323) (-528.853) -- 0:00:51
73000 -- (-537.150) (-528.365) [-527.593] (-531.192) * (-533.273) (-531.501) (-532.130) [-533.052] -- 0:00:50
73500 -- (-539.030) (-530.370) (-527.582) [-529.617] * (-527.184) (-532.141) [-532.312] (-527.100) -- 0:00:50
74000 -- [-538.858] (-530.378) (-530.791) (-530.808) * (-527.442) [-529.771] (-529.104) (-527.604) -- 0:00:50
74500 -- (-539.213) (-527.656) [-528.482] (-530.643) * [-529.009] (-531.569) (-529.210) (-528.092) -- 0:00:49
75000 -- [-539.289] (-528.994) (-528.574) (-528.948) * (-527.397) [-528.435] (-528.552) (-530.960) -- 0:00:49
Average standard deviation of split frequencies: 0.018263
75500 -- (-536.084) [-527.130] (-528.169) (-527.862) * (-527.630) (-529.220) (-529.870) [-533.840] -- 0:00:48
76000 -- (-536.190) (-528.186) (-527.201) [-527.192] * (-529.393) (-528.684) [-528.955] (-532.353) -- 0:00:48
76500 -- (-540.209) [-527.981] (-529.616) (-527.386) * (-527.882) (-530.250) (-529.115) [-528.082] -- 0:00:48
77000 -- (-540.789) (-532.473) [-528.955] (-533.481) * (-530.229) [-529.282] (-529.758) (-529.875) -- 0:00:47
77500 -- (-543.211) (-528.314) [-529.323] (-531.382) * (-529.877) (-529.697) [-527.198] (-533.821) -- 0:00:47
78000 -- (-537.057) (-532.671) [-529.027] (-530.234) * (-529.503) [-529.503] (-529.947) (-535.593) -- 0:00:47
78500 -- (-534.176) [-528.843] (-527.842) (-527.001) * (-532.294) (-528.730) (-527.755) [-531.737] -- 0:00:46
79000 -- (-550.824) [-527.971] (-527.378) (-531.891) * (-532.099) [-532.774] (-529.425) (-527.432) -- 0:00:46
79500 -- [-537.161] (-534.845) (-528.608) (-529.193) * (-529.923) (-527.367) (-527.518) [-528.360] -- 0:00:46
80000 -- (-540.386) (-530.808) (-528.948) [-528.580] * (-533.993) [-529.932] (-527.160) (-528.900) -- 0:00:57
Average standard deviation of split frequencies: 0.017188
80500 -- (-527.800) (-528.645) (-529.039) [-530.693] * (-527.447) (-528.338) [-528.878] (-530.461) -- 0:00:57
81000 -- (-530.477) (-532.404) [-530.800] (-536.930) * (-529.871) (-528.978) (-528.733) [-527.952] -- 0:00:56
81500 -- [-530.471] (-528.065) (-529.822) (-534.100) * (-527.860) [-528.686] (-529.629) (-528.161) -- 0:00:56
82000 -- (-529.061) (-528.856) (-531.645) [-528.525] * (-530.180) (-527.156) (-530.926) [-526.947] -- 0:00:55
82500 -- (-531.782) (-529.587) [-531.806] (-531.469) * (-532.831) [-529.249] (-532.425) (-530.889) -- 0:00:55
83000 -- (-527.331) (-534.054) [-530.542] (-529.468) * [-531.092] (-528.223) (-535.258) (-530.921) -- 0:00:55
83500 -- (-531.723) (-530.168) (-527.886) [-527.072] * [-528.430] (-528.266) (-531.666) (-529.992) -- 0:00:54
84000 -- (-528.770) [-527.736] (-530.336) (-527.725) * (-528.969) [-528.857] (-528.246) (-527.839) -- 0:00:54
84500 -- (-531.438) [-527.916] (-527.759) (-528.683) * (-535.390) [-527.928] (-532.337) (-527.315) -- 0:00:54
85000 -- (-532.523) (-528.303) (-527.583) [-528.583] * (-532.616) (-528.728) [-528.527] (-529.958) -- 0:00:53
Average standard deviation of split frequencies: 0.018089
85500 -- (-527.982) (-528.977) [-532.311] (-528.126) * (-530.037) (-527.371) (-529.932) [-528.844] -- 0:00:53
86000 -- [-528.080] (-528.375) (-529.958) (-528.612) * (-529.325) (-527.444) [-530.627] (-528.784) -- 0:00:53
86500 -- [-529.513] (-529.794) (-529.529) (-529.902) * (-531.461) (-526.896) [-529.363] (-528.460) -- 0:00:52
87000 -- (-529.838) (-529.025) (-533.564) [-529.915] * (-530.361) [-529.327] (-527.863) (-529.653) -- 0:00:52
87500 -- [-529.454] (-529.669) (-530.692) (-529.722) * (-529.426) (-530.274) [-529.485] (-529.170) -- 0:00:52
88000 -- [-529.866] (-536.445) (-527.737) (-527.136) * (-530.194) (-528.213) (-530.206) [-529.799] -- 0:00:51
88500 -- [-528.199] (-533.689) (-528.250) (-527.577) * (-528.414) [-528.787] (-528.101) (-532.026) -- 0:00:51
89000 -- (-530.403) [-528.446] (-531.014) (-526.961) * [-533.108] (-528.514) (-528.412) (-529.121) -- 0:00:51
89500 -- (-533.173) (-533.186) (-528.636) [-527.145] * (-528.970) (-530.251) (-528.259) [-526.811] -- 0:00:50
90000 -- (-531.672) (-528.823) [-530.121] (-527.636) * [-528.372] (-531.440) (-527.607) (-528.692) -- 0:00:50
Average standard deviation of split frequencies: 0.022530
90500 -- (-527.303) [-531.400] (-528.386) (-528.016) * (-528.440) [-527.374] (-527.169) (-531.518) -- 0:00:50
91000 -- [-528.510] (-528.173) (-528.005) (-529.916) * [-528.083] (-528.124) (-529.274) (-530.765) -- 0:00:49
91500 -- (-528.489) (-527.350) (-528.500) [-528.852] * (-530.488) [-528.071] (-529.285) (-529.795) -- 0:00:49
92000 -- (-529.479) (-528.792) (-530.600) [-528.670] * (-531.698) [-528.733] (-528.327) (-530.422) -- 0:00:49
92500 -- (-527.987) [-529.286] (-528.311) (-530.756) * (-529.785) (-528.905) [-528.958] (-528.103) -- 0:00:49
93000 -- (-527.412) (-532.176) (-528.024) [-531.145] * (-533.521) [-530.319] (-528.677) (-533.932) -- 0:00:48
93500 -- [-528.021] (-530.656) (-527.444) (-527.051) * (-533.060) (-528.611) [-528.476] (-532.688) -- 0:00:48
94000 -- (-529.509) [-529.789] (-529.311) (-528.549) * (-532.008) (-529.678) (-528.568) [-529.286] -- 0:00:48
94500 -- (-529.407) (-532.108) (-529.935) [-531.174] * (-532.261) (-527.566) [-529.608] (-531.610) -- 0:00:47
95000 -- (-528.355) [-530.410] (-526.941) (-530.986) * (-530.690) [-528.181] (-528.021) (-530.782) -- 0:00:47
Average standard deviation of split frequencies: 0.023816
95500 -- (-529.086) (-530.344) [-527.022] (-528.463) * (-535.433) (-528.527) [-528.075] (-528.194) -- 0:00:47
96000 -- [-528.913] (-529.091) (-532.947) (-529.013) * (-531.411) (-533.014) (-528.427) [-530.314] -- 0:00:47
96500 -- (-528.308) (-528.028) [-528.923] (-531.747) * (-529.632) (-528.109) (-529.851) [-528.218] -- 0:00:46
97000 -- (-528.879) (-529.873) [-530.057] (-530.000) * (-529.234) (-528.201) (-529.852) [-527.592] -- 0:00:46
97500 -- (-529.476) (-528.780) (-527.934) [-531.484] * (-533.371) [-529.774] (-533.077) (-530.388) -- 0:00:55
98000 -- [-531.517] (-531.288) (-528.646) (-530.844) * [-527.734] (-528.766) (-532.487) (-528.594) -- 0:00:55
98500 -- [-529.651] (-527.399) (-532.698) (-530.831) * (-530.569) [-529.723] (-528.625) (-529.554) -- 0:00:54
99000 -- (-529.978) (-526.762) [-528.312] (-528.421) * [-530.597] (-531.068) (-526.972) (-530.109) -- 0:00:54
99500 -- (-531.564) (-530.893) (-530.644) [-529.367] * (-530.110) (-531.398) [-528.167] (-527.490) -- 0:00:54
100000 -- [-531.434] (-527.561) (-529.816) (-528.872) * (-530.982) (-530.402) [-535.446] (-529.671) -- 0:00:54
Average standard deviation of split frequencies: 0.022374
100500 -- [-528.837] (-529.526) (-533.917) (-528.774) * (-529.589) [-527.645] (-529.567) (-528.735) -- 0:00:53
101000 -- (-530.345) (-528.866) [-536.132] (-528.324) * (-529.930) (-530.246) (-529.144) [-527.802] -- 0:00:53
101500 -- (-527.998) (-527.414) (-534.839) [-528.446] * (-531.252) (-530.543) (-528.167) [-529.823] -- 0:00:53
102000 -- [-527.230] (-527.793) (-528.154) (-530.140) * (-528.816) [-528.803] (-528.468) (-529.850) -- 0:00:52
102500 -- (-528.608) (-529.098) [-530.543] (-529.638) * (-528.652) [-530.789] (-528.559) (-528.247) -- 0:00:52
103000 -- (-529.205) (-529.845) (-528.898) [-527.472] * (-532.497) (-527.185) (-530.403) [-531.511] -- 0:00:52
103500 -- [-528.486] (-529.198) (-529.952) (-528.553) * (-526.855) [-528.476] (-529.401) (-528.651) -- 0:00:51
104000 -- (-529.490) (-527.681) [-528.369] (-529.077) * (-528.700) (-530.115) [-529.259] (-527.448) -- 0:00:51
104500 -- (-530.362) (-528.594) [-528.085] (-529.212) * (-529.087) [-527.781] (-529.630) (-527.828) -- 0:00:51
105000 -- (-530.491) [-527.299] (-529.012) (-528.367) * [-530.502] (-527.610) (-529.224) (-527.706) -- 0:00:51
Average standard deviation of split frequencies: 0.020754
105500 -- (-528.483) [-526.741] (-527.117) (-528.718) * (-528.691) (-531.820) [-528.940] (-529.488) -- 0:00:50
106000 -- (-530.844) (-529.148) [-527.608] (-528.525) * (-529.616) [-527.893] (-530.802) (-529.789) -- 0:00:50
106500 -- (-529.202) (-529.868) [-527.671] (-528.556) * (-531.551) (-527.563) [-530.803] (-529.167) -- 0:00:50
107000 -- [-529.411] (-533.017) (-530.145) (-530.117) * (-530.089) (-533.069) (-529.606) [-528.732] -- 0:00:50
107500 -- (-530.933) (-532.800) [-531.567] (-531.923) * (-528.499) (-529.457) (-528.379) [-531.384] -- 0:00:49
108000 -- (-528.664) [-529.510] (-531.239) (-528.476) * [-530.307] (-528.332) (-533.382) (-527.645) -- 0:00:49
108500 -- (-528.318) [-527.733] (-529.999) (-528.725) * (-527.778) [-527.726] (-527.295) (-528.801) -- 0:00:49
109000 -- [-530.238] (-528.215) (-534.232) (-528.028) * (-531.936) (-527.705) (-527.086) [-528.882] -- 0:00:49
109500 -- (-527.458) (-529.979) (-528.325) [-529.237] * [-532.223] (-528.279) (-529.746) (-528.371) -- 0:00:48
110000 -- (-529.009) (-528.699) [-528.317] (-530.802) * (-530.829) [-528.235] (-530.194) (-529.273) -- 0:00:48
Average standard deviation of split frequencies: 0.019270
110500 -- [-529.324] (-528.151) (-529.835) (-527.770) * (-529.701) (-528.855) [-532.150] (-528.701) -- 0:00:48
111000 -- [-527.654] (-528.948) (-532.526) (-527.928) * (-529.660) [-528.476] (-531.401) (-530.786) -- 0:00:48
111500 -- (-529.463) (-527.921) [-528.265] (-530.133) * [-530.886] (-528.335) (-533.301) (-528.239) -- 0:00:47
112000 -- (-529.035) (-528.949) [-529.836] (-529.656) * (-531.416) [-529.049] (-528.669) (-531.017) -- 0:00:47
112500 -- [-528.715] (-527.512) (-528.617) (-530.624) * (-527.189) [-530.488] (-528.936) (-529.518) -- 0:00:47
113000 -- [-528.362] (-530.248) (-528.602) (-530.853) * [-529.625] (-528.937) (-529.944) (-528.912) -- 0:00:47
113500 -- (-529.114) [-529.380] (-527.473) (-531.284) * (-528.273) (-528.449) [-528.436] (-529.485) -- 0:00:46
114000 -- [-530.940] (-528.575) (-530.558) (-528.871) * (-529.601) (-528.613) [-526.977] (-529.979) -- 0:00:46
114500 -- (-532.989) [-527.263] (-531.009) (-529.394) * (-528.067) (-527.930) [-535.529] (-527.419) -- 0:00:54
115000 -- [-532.811] (-527.683) (-529.721) (-528.757) * [-528.496] (-527.964) (-530.000) (-528.713) -- 0:00:53
Average standard deviation of split frequencies: 0.020747
115500 -- [-530.645] (-529.234) (-531.379) (-530.611) * (-536.052) [-527.914] (-529.063) (-531.856) -- 0:00:53
116000 -- (-528.784) (-527.359) (-530.009) [-529.193] * [-527.999] (-530.061) (-528.373) (-532.254) -- 0:00:53
116500 -- (-532.264) (-527.331) (-529.582) [-527.575] * (-528.483) (-532.187) [-528.937] (-533.560) -- 0:00:53
117000 -- (-532.513) [-529.135] (-528.170) (-529.296) * (-526.841) (-535.372) [-528.685] (-535.370) -- 0:00:52
117500 -- [-532.335] (-528.893) (-530.596) (-530.205) * (-529.620) (-535.757) [-530.244] (-535.515) -- 0:00:52
118000 -- (-529.294) (-528.304) (-528.615) [-528.244] * (-527.879) (-533.443) [-528.692] (-530.985) -- 0:00:52
118500 -- (-528.197) (-528.393) (-528.935) [-529.828] * (-529.090) (-535.073) [-528.156] (-531.637) -- 0:00:52
119000 -- (-528.049) [-527.020] (-527.198) (-531.215) * (-528.856) (-532.209) [-528.953] (-529.357) -- 0:00:51
119500 -- (-528.367) (-527.786) (-528.071) [-527.795] * (-528.857) [-530.077] (-527.919) (-528.614) -- 0:00:51
120000 -- (-529.163) (-528.743) (-527.282) [-529.043] * [-530.033] (-531.026) (-528.247) (-531.263) -- 0:00:51
Average standard deviation of split frequencies: 0.017477
120500 -- (-531.091) [-527.378] (-527.989) (-528.284) * (-531.477) (-533.799) [-528.440] (-529.562) -- 0:00:51
121000 -- (-530.268) (-528.879) (-529.991) [-532.998] * [-530.826] (-528.895) (-529.537) (-528.907) -- 0:00:50
121500 -- [-530.422] (-531.915) (-529.083) (-532.723) * (-528.903) [-528.901] (-528.170) (-529.328) -- 0:00:50
122000 -- [-528.580] (-530.170) (-528.108) (-530.860) * [-528.687] (-527.384) (-529.469) (-529.081) -- 0:00:50
122500 -- (-528.960) (-529.980) (-528.447) [-529.221] * (-527.434) [-528.275] (-527.685) (-527.570) -- 0:00:50
123000 -- (-527.221) (-528.611) [-527.547] (-528.254) * (-528.064) [-530.471] (-527.347) (-527.714) -- 0:00:49
123500 -- [-529.663] (-529.008) (-528.046) (-527.522) * (-529.959) [-533.003] (-528.299) (-528.024) -- 0:00:49
124000 -- (-528.635) (-528.764) (-528.254) [-528.925] * (-528.485) (-533.491) (-529.280) [-527.079] -- 0:00:49
124500 -- [-527.576] (-533.746) (-530.268) (-527.055) * [-533.348] (-531.493) (-529.169) (-528.148) -- 0:00:49
125000 -- (-528.876) (-529.760) (-529.821) [-528.482] * (-529.399) (-530.413) (-527.879) [-529.026] -- 0:00:49
Average standard deviation of split frequencies: 0.018885
125500 -- (-530.809) (-532.033) [-527.549] (-527.980) * [-531.334] (-527.997) (-528.853) (-532.464) -- 0:00:48
126000 -- (-530.226) (-530.854) [-529.098] (-528.148) * (-528.521) (-531.849) [-527.344] (-528.816) -- 0:00:48
126500 -- [-527.464] (-528.524) (-529.302) (-529.163) * [-528.101] (-529.069) (-528.310) (-527.262) -- 0:00:48
127000 -- [-527.374] (-530.534) (-529.333) (-530.034) * (-527.707) [-529.764] (-528.637) (-528.080) -- 0:00:48
127500 -- (-530.835) [-530.135] (-536.078) (-530.959) * (-529.254) [-528.412] (-527.984) (-527.940) -- 0:00:47
128000 -- (-529.000) [-527.943] (-530.969) (-527.546) * [-533.027] (-528.098) (-527.941) (-530.996) -- 0:00:47
128500 -- [-528.395] (-532.700) (-528.586) (-530.142) * (-529.578) (-527.831) [-527.041] (-528.626) -- 0:00:47
129000 -- (-527.761) (-528.367) [-530.237] (-529.197) * (-530.444) (-528.869) [-527.107] (-527.730) -- 0:00:47
129500 -- (-527.511) (-528.394) [-529.374] (-532.179) * (-529.310) [-528.962] (-527.239) (-529.320) -- 0:00:47
130000 -- (-531.399) (-529.564) (-528.696) [-529.478] * (-528.022) [-528.682] (-530.226) (-527.775) -- 0:00:46
Average standard deviation of split frequencies: 0.019662
130500 -- (-527.867) (-529.776) (-528.437) [-529.196] * (-531.619) (-532.607) (-529.728) [-527.639] -- 0:00:46
131000 -- (-528.586) (-529.318) [-529.898] (-527.459) * (-529.649) (-528.680) (-530.008) [-528.963] -- 0:00:46
131500 -- (-526.975) [-527.356] (-528.843) (-532.195) * (-529.162) (-530.299) (-528.330) [-529.372] -- 0:00:52
132000 -- (-527.833) [-527.297] (-529.595) (-529.091) * (-530.075) (-529.595) [-530.764] (-531.102) -- 0:00:52
132500 -- (-528.629) (-532.409) (-527.809) [-528.575] * (-530.941) [-528.243] (-527.223) (-530.993) -- 0:00:52
133000 -- [-527.870] (-532.686) (-528.051) (-527.909) * [-529.647] (-530.672) (-529.666) (-528.899) -- 0:00:52
133500 -- (-530.650) (-530.772) [-528.803] (-529.240) * (-527.337) (-529.183) [-528.782] (-528.976) -- 0:00:51
134000 -- (-527.255) (-531.641) (-535.399) [-530.406] * (-528.135) [-529.794] (-535.198) (-529.593) -- 0:00:51
134500 -- (-531.550) (-528.485) [-530.255] (-529.582) * (-528.057) [-528.457] (-533.151) (-527.441) -- 0:00:51
135000 -- [-528.924] (-530.103) (-530.585) (-528.333) * (-528.823) (-529.196) (-530.912) [-528.243] -- 0:00:51
Average standard deviation of split frequencies: 0.020624
135500 -- (-529.843) [-527.634] (-527.359) (-528.719) * [-528.333] (-526.965) (-532.932) (-529.494) -- 0:00:51
136000 -- (-527.581) [-528.459] (-528.441) (-528.367) * (-532.634) [-527.429] (-528.652) (-528.842) -- 0:00:50
136500 -- (-530.950) [-527.739] (-532.383) (-532.226) * [-533.790] (-528.933) (-530.655) (-528.976) -- 0:00:50
137000 -- (-528.843) [-528.690] (-533.908) (-536.389) * (-531.130) (-528.795) (-526.880) [-528.356] -- 0:00:50
137500 -- (-531.968) (-526.816) [-530.772] (-530.897) * (-529.805) (-534.052) (-528.092) [-530.270] -- 0:00:50
138000 -- (-532.925) [-528.653] (-530.354) (-528.591) * [-528.535] (-529.846) (-530.837) (-530.233) -- 0:00:49
138500 -- (-534.080) [-529.012] (-527.696) (-530.112) * (-526.795) (-528.542) (-531.867) [-529.013] -- 0:00:49
139000 -- [-529.028] (-528.520) (-528.728) (-529.917) * (-529.728) [-529.084] (-529.196) (-531.997) -- 0:00:49
139500 -- (-529.852) [-528.546] (-527.308) (-527.622) * (-531.353) (-530.229) (-528.352) [-534.402] -- 0:00:49
140000 -- (-532.288) (-531.442) [-528.253] (-528.803) * [-530.501] (-529.469) (-529.561) (-533.058) -- 0:00:49
Average standard deviation of split frequencies: 0.019122
140500 -- (-529.514) (-527.519) [-528.061] (-528.146) * (-530.662) (-530.183) (-530.166) [-530.641] -- 0:00:48
141000 -- (-530.800) (-526.919) (-529.681) [-532.025] * [-528.062] (-528.129) (-528.300) (-528.648) -- 0:00:48
141500 -- [-530.565] (-532.684) (-529.612) (-529.162) * (-533.437) (-530.430) (-535.591) [-527.823] -- 0:00:48
142000 -- [-529.104] (-531.227) (-528.805) (-528.899) * (-529.218) [-528.597] (-527.889) (-534.534) -- 0:00:48
142500 -- (-528.219) (-528.027) (-528.267) [-529.467] * (-530.963) [-528.070] (-533.986) (-535.641) -- 0:00:48
143000 -- (-528.341) [-529.572] (-528.230) (-529.446) * (-529.868) [-531.070] (-528.120) (-537.387) -- 0:00:47
143500 -- [-528.691] (-529.002) (-527.391) (-528.634) * (-527.858) [-529.661] (-528.756) (-536.833) -- 0:00:47
144000 -- (-529.570) [-528.961] (-528.556) (-532.883) * (-530.861) (-529.369) [-527.983] (-528.039) -- 0:00:47
144500 -- [-528.755] (-528.925) (-527.543) (-526.991) * (-535.694) (-533.499) (-530.028) [-530.083] -- 0:00:47
145000 -- [-531.467] (-530.439) (-528.137) (-528.750) * [-527.999] (-532.413) (-531.229) (-530.121) -- 0:00:47
Average standard deviation of split frequencies: 0.017673
145500 -- (-529.027) (-533.345) [-529.260] (-527.009) * [-527.908] (-532.065) (-529.521) (-529.117) -- 0:00:46
146000 -- (-531.183) (-531.073) (-527.299) [-527.483] * (-529.872) (-527.861) (-532.819) [-529.999] -- 0:00:46
146500 -- (-531.250) (-528.943) (-530.014) [-529.081] * (-530.345) [-530.592] (-529.133) (-539.042) -- 0:00:46
147000 -- (-531.736) [-528.616] (-531.678) (-529.806) * (-532.472) [-528.056] (-528.965) (-530.019) -- 0:00:46
147500 -- (-530.392) (-528.989) (-527.841) [-528.286] * (-530.372) (-534.875) (-528.860) [-527.895] -- 0:00:46
148000 -- (-527.648) (-527.505) (-527.727) [-530.095] * (-528.435) (-529.753) (-530.812) [-527.604] -- 0:00:46
148500 -- [-527.849] (-530.490) (-529.414) (-528.389) * (-528.988) (-532.127) (-528.535) [-527.911] -- 0:00:51
149000 -- (-529.451) (-529.176) (-529.111) [-527.727] * [-529.741] (-529.752) (-529.162) (-527.419) -- 0:00:51
149500 -- (-528.653) (-528.555) (-528.106) [-528.145] * [-530.071] (-531.797) (-527.863) (-532.054) -- 0:00:51
150000 -- (-531.643) (-530.301) [-527.423] (-528.292) * [-529.561] (-534.549) (-528.547) (-529.164) -- 0:00:51
Average standard deviation of split frequencies: 0.019468
150500 -- (-529.788) [-528.578] (-528.722) (-527.097) * (-530.103) [-529.625] (-527.595) (-531.311) -- 0:00:50
151000 -- (-529.906) [-527.609] (-530.613) (-527.053) * (-540.052) [-530.967] (-527.703) (-528.510) -- 0:00:50
151500 -- (-528.707) [-528.204] (-528.475) (-528.762) * [-530.132] (-530.053) (-528.542) (-529.431) -- 0:00:50
152000 -- (-528.284) (-527.259) [-529.239] (-529.288) * (-529.309) [-531.366] (-528.594) (-528.891) -- 0:00:50
152500 -- (-529.125) (-531.905) (-530.328) [-529.103] * (-528.634) (-529.994) (-529.998) [-528.155] -- 0:00:50
153000 -- (-532.444) [-528.366] (-528.789) (-529.925) * (-530.380) (-528.048) (-533.299) [-528.377] -- 0:00:49
153500 -- (-528.004) [-529.717] (-527.953) (-529.086) * (-529.346) [-529.866] (-530.046) (-530.115) -- 0:00:49
154000 -- (-531.561) [-528.515] (-528.601) (-531.300) * (-527.742) (-528.182) [-531.553] (-529.033) -- 0:00:49
154500 -- [-529.643] (-529.017) (-528.857) (-527.763) * [-531.406] (-528.316) (-529.620) (-528.972) -- 0:00:49
155000 -- [-527.201] (-533.473) (-528.658) (-527.881) * (-528.310) (-526.986) (-527.511) [-528.273] -- 0:00:49
Average standard deviation of split frequencies: 0.020442
155500 -- (-528.395) [-530.320] (-531.681) (-527.271) * (-528.073) (-529.105) (-529.557) [-528.468] -- 0:00:48
156000 -- (-529.486) [-528.781] (-529.401) (-529.324) * (-531.058) (-529.900) (-534.929) [-527.645] -- 0:00:48
156500 -- (-531.659) [-528.025] (-527.918) (-529.286) * (-528.433) (-530.227) [-528.267] (-529.748) -- 0:00:48
157000 -- [-528.714] (-528.013) (-529.241) (-527.710) * [-528.868] (-531.314) (-528.826) (-527.867) -- 0:00:48
157500 -- (-533.764) (-527.704) [-528.170] (-528.741) * (-527.921) (-532.809) [-530.364] (-527.472) -- 0:00:48
158000 -- (-530.663) (-529.977) (-529.928) [-528.397] * (-533.021) (-529.832) (-529.045) [-529.191] -- 0:00:47
158500 -- [-530.588] (-529.963) (-528.950) (-530.558) * (-528.610) (-530.874) [-530.594] (-527.508) -- 0:00:47
159000 -- [-528.540] (-531.363) (-528.175) (-530.982) * (-528.090) (-527.479) [-532.281] (-528.249) -- 0:00:47
159500 -- (-529.212) [-530.968] (-529.887) (-528.691) * [-530.207] (-527.993) (-533.819) (-529.196) -- 0:00:47
160000 -- (-528.752) [-531.143] (-531.425) (-530.258) * (-528.486) [-531.201] (-527.598) (-532.961) -- 0:00:47
Average standard deviation of split frequencies: 0.019560
160500 -- (-529.492) (-528.792) [-527.660] (-530.112) * [-532.779] (-528.060) (-527.506) (-530.863) -- 0:00:47
161000 -- [-528.856] (-528.463) (-531.598) (-531.098) * (-529.293) (-528.682) (-527.966) [-528.757] -- 0:00:46
161500 -- [-527.129] (-530.148) (-529.296) (-531.156) * [-527.408] (-528.257) (-527.622) (-527.454) -- 0:00:46
162000 -- (-528.020) (-529.454) (-528.185) [-528.174] * (-527.831) [-529.827] (-528.793) (-530.923) -- 0:00:46
162500 -- [-528.549] (-529.410) (-527.759) (-527.945) * (-530.239) [-527.530] (-527.963) (-530.787) -- 0:00:46
163000 -- (-528.651) [-527.563] (-527.974) (-528.620) * [-528.479] (-528.344) (-531.819) (-528.770) -- 0:00:46
163500 -- (-529.429) (-526.933) [-527.835] (-527.919) * (-531.305) (-528.212) (-529.049) [-528.503] -- 0:00:46
164000 -- (-530.223) [-527.115] (-528.033) (-530.707) * (-529.990) (-527.684) [-528.728] (-532.721) -- 0:00:45
164500 -- [-529.522] (-526.955) (-527.359) (-527.518) * [-531.146] (-528.080) (-532.949) (-536.447) -- 0:00:45
165000 -- (-530.301) (-527.756) (-527.864) [-528.123] * (-528.927) (-528.325) [-529.908] (-531.591) -- 0:00:45
Average standard deviation of split frequencies: 0.018459
165500 -- [-530.832] (-528.805) (-528.222) (-529.028) * (-527.215) (-528.677) [-527.053] (-529.067) -- 0:00:50
166000 -- (-528.738) (-528.958) (-530.314) [-529.152] * (-530.862) (-529.616) (-528.076) [-529.888] -- 0:00:50
166500 -- (-529.466) (-528.041) [-530.573] (-528.493) * (-528.922) (-528.825) (-528.342) [-530.419] -- 0:00:50
167000 -- (-528.775) (-527.713) [-527.998] (-532.038) * [-530.645] (-532.414) (-529.163) (-530.190) -- 0:00:49
167500 -- (-531.444) (-528.902) [-530.139] (-527.800) * (-529.813) (-530.035) (-530.696) [-527.662] -- 0:00:49
168000 -- [-527.318] (-529.035) (-527.187) (-529.488) * (-530.257) (-530.120) [-527.451] (-529.345) -- 0:00:49
168500 -- (-528.497) (-534.613) [-526.923] (-533.754) * [-529.773] (-528.805) (-530.292) (-529.399) -- 0:00:49
169000 -- (-528.911) (-529.258) [-529.804] (-529.320) * [-530.197] (-528.757) (-530.209) (-530.645) -- 0:00:49
169500 -- (-532.810) (-528.738) (-533.814) [-528.624] * (-529.086) [-532.143] (-527.796) (-530.551) -- 0:00:48
170000 -- (-529.804) [-529.058] (-531.933) (-528.320) * [-529.619] (-536.337) (-529.550) (-527.103) -- 0:00:48
Average standard deviation of split frequencies: 0.018414
170500 -- (-532.559) (-530.640) (-529.537) [-528.162] * [-528.127] (-536.838) (-529.363) (-530.066) -- 0:00:48
171000 -- [-529.065] (-530.846) (-529.582) (-527.752) * (-527.894) (-527.637) (-527.478) [-528.174] -- 0:00:48
171500 -- (-527.718) (-528.473) [-528.331] (-527.249) * [-529.166] (-528.558) (-527.226) (-529.962) -- 0:00:48
172000 -- (-528.395) [-529.322] (-527.557) (-528.341) * (-532.152) (-530.860) (-528.039) [-527.919] -- 0:00:48
172500 -- (-527.941) (-529.902) (-531.236) [-527.986] * [-528.613] (-528.416) (-531.510) (-528.245) -- 0:00:47
173000 -- [-530.009] (-530.220) (-528.442) (-530.992) * (-529.586) [-527.559] (-531.100) (-530.350) -- 0:00:47
173500 -- [-529.464] (-530.275) (-532.329) (-527.837) * (-531.306) [-527.092] (-529.503) (-529.801) -- 0:00:47
174000 -- (-529.383) (-528.513) [-527.520] (-528.222) * [-533.326] (-527.937) (-530.417) (-528.934) -- 0:00:47
174500 -- (-530.430) (-535.918) [-529.763] (-527.398) * (-537.264) (-527.322) (-530.063) [-528.149] -- 0:00:47
175000 -- (-528.247) (-530.370) (-530.634) [-529.785] * (-530.570) (-528.598) (-533.823) [-528.246] -- 0:00:47
Average standard deviation of split frequencies: 0.018591
175500 -- (-529.045) (-531.318) [-528.676] (-529.812) * (-531.079) (-530.689) (-531.161) [-529.917] -- 0:00:46
176000 -- (-529.996) (-529.205) (-527.807) [-532.118] * (-532.399) [-528.463] (-528.569) (-528.220) -- 0:00:46
176500 -- (-527.339) [-528.620] (-527.823) (-530.858) * [-528.653] (-527.764) (-530.304) (-527.635) -- 0:00:46
177000 -- [-530.631] (-528.490) (-529.552) (-529.394) * [-529.054] (-529.215) (-531.170) (-533.213) -- 0:00:46
177500 -- (-530.109) [-528.024] (-528.413) (-528.868) * (-530.667) (-529.915) [-529.885] (-532.353) -- 0:00:46
178000 -- (-529.561) (-529.911) (-529.507) [-528.849] * (-533.958) [-530.991] (-529.201) (-530.821) -- 0:00:46
178500 -- [-527.407] (-528.102) (-532.199) (-533.204) * [-529.281] (-533.863) (-529.005) (-528.882) -- 0:00:46
179000 -- (-526.808) [-527.191] (-530.528) (-533.114) * [-528.168] (-530.439) (-528.799) (-532.667) -- 0:00:45
179500 -- [-527.290] (-529.248) (-527.559) (-527.767) * [-528.719] (-530.421) (-528.991) (-531.506) -- 0:00:45
180000 -- (-526.825) (-531.262) [-529.657] (-530.431) * (-530.076) [-527.903] (-528.757) (-533.828) -- 0:00:45
Average standard deviation of split frequencies: 0.020059
180500 -- [-529.263] (-534.242) (-531.108) (-527.912) * (-527.021) [-529.580] (-528.277) (-528.490) -- 0:00:45
181000 -- [-527.395] (-531.347) (-528.238) (-526.953) * [-532.188] (-533.738) (-531.198) (-532.632) -- 0:00:45
181500 -- (-529.652) (-527.663) [-528.496] (-529.487) * (-529.152) [-528.321] (-530.179) (-530.356) -- 0:00:45
182000 -- [-528.080] (-529.473) (-532.660) (-529.510) * [-530.306] (-527.884) (-528.621) (-530.032) -- 0:00:44
182500 -- (-527.533) (-528.326) (-529.007) [-527.515] * (-530.545) (-533.251) (-529.471) [-528.433] -- 0:00:44
183000 -- [-527.423] (-527.739) (-535.543) (-527.977) * (-528.444) [-532.912] (-531.214) (-533.217) -- 0:00:49
183500 -- (-531.120) [-529.738] (-528.431) (-529.652) * (-532.006) (-533.064) (-528.324) [-528.745] -- 0:00:48
184000 -- (-531.825) (-528.937) (-529.986) [-528.598] * (-529.649) (-534.718) [-528.851] (-528.312) -- 0:00:48
184500 -- [-530.946] (-530.240) (-530.599) (-528.370) * (-530.579) (-530.995) (-528.459) [-531.553] -- 0:00:48
185000 -- (-528.814) [-530.961] (-530.249) (-529.154) * [-527.179] (-531.440) (-528.388) (-528.951) -- 0:00:48
Average standard deviation of split frequencies: 0.019381
185500 -- (-530.532) [-528.642] (-530.643) (-528.808) * (-532.350) [-527.898] (-528.681) (-528.027) -- 0:00:48
186000 -- (-531.318) [-528.407] (-529.987) (-529.517) * (-528.112) (-528.414) [-528.112] (-527.403) -- 0:00:48
186500 -- (-527.843) (-527.317) [-530.506] (-527.729) * (-529.199) (-529.946) [-527.215] (-527.685) -- 0:00:47
187000 -- (-532.815) (-528.269) (-529.374) [-527.304] * (-530.676) [-530.157] (-528.328) (-533.079) -- 0:00:47
187500 -- (-531.923) (-532.177) (-527.811) [-529.874] * [-528.110] (-529.159) (-528.695) (-528.213) -- 0:00:47
188000 -- (-530.285) (-530.521) (-527.902) [-528.606] * [-532.174] (-533.391) (-529.389) (-527.794) -- 0:00:47
188500 -- (-529.854) (-528.513) (-528.713) [-529.389] * (-530.226) (-530.225) [-528.224] (-527.927) -- 0:00:47
189000 -- (-527.431) (-529.903) (-530.233) [-527.439] * (-529.339) (-531.160) [-528.415] (-532.107) -- 0:00:47
189500 -- (-532.251) [-527.768] (-528.675) (-533.070) * [-528.713] (-531.862) (-533.183) (-527.361) -- 0:00:47
190000 -- (-533.445) [-533.530] (-532.048) (-536.172) * (-527.885) (-531.013) [-528.982] (-530.073) -- 0:00:46
Average standard deviation of split frequencies: 0.017307
190500 -- (-528.571) (-531.618) [-528.066] (-536.928) * (-528.139) (-529.532) [-530.111] (-529.086) -- 0:00:46
191000 -- (-532.244) (-528.495) (-528.247) [-528.061] * (-529.028) (-528.141) [-530.603] (-528.193) -- 0:00:46
191500 -- (-531.314) [-531.042] (-528.408) (-528.434) * (-530.559) (-528.167) (-530.136) [-527.944] -- 0:00:46
192000 -- (-527.332) [-527.875] (-527.030) (-527.869) * (-529.674) (-527.568) [-528.601] (-527.024) -- 0:00:46
192500 -- (-528.767) (-528.137) (-529.411) [-528.782] * (-527.987) (-529.138) (-528.055) [-530.311] -- 0:00:46
193000 -- (-527.970) (-530.551) [-529.627] (-528.264) * (-527.770) [-534.687] (-530.178) (-528.872) -- 0:00:45
193500 -- [-528.892] (-530.178) (-528.655) (-527.761) * (-528.764) [-533.640] (-528.119) (-530.385) -- 0:00:45
194000 -- (-527.696) (-531.320) (-530.565) [-528.339] * [-532.061] (-531.492) (-529.271) (-528.305) -- 0:00:45
194500 -- (-530.415) (-530.312) [-528.907] (-528.805) * [-532.189] (-530.414) (-532.481) (-528.058) -- 0:00:45
195000 -- (-529.064) (-528.380) [-528.643] (-529.245) * (-528.883) (-529.922) (-532.628) [-528.039] -- 0:00:45
Average standard deviation of split frequencies: 0.018439
195500 -- (-528.058) (-528.446) [-528.451] (-529.495) * [-529.952] (-530.216) (-529.166) (-527.647) -- 0:00:45
196000 -- (-528.938) (-529.633) [-530.975] (-528.230) * (-530.266) (-527.464) [-530.140] (-532.110) -- 0:00:45
196500 -- (-531.401) (-529.813) [-533.503] (-527.801) * [-529.056] (-531.909) (-532.697) (-527.573) -- 0:00:44
197000 -- (-528.944) (-528.929) [-529.146] (-529.211) * (-530.022) (-532.707) [-528.630] (-527.079) -- 0:00:44
197500 -- (-527.564) (-529.044) [-528.468] (-529.679) * (-528.642) (-529.354) (-529.089) [-528.077] -- 0:00:44
198000 -- [-529.120] (-529.534) (-529.684) (-533.143) * (-527.798) (-532.188) (-528.282) [-528.612] -- 0:00:44
198500 -- (-529.268) [-529.945] (-528.296) (-529.490) * [-531.052] (-528.018) (-529.753) (-530.250) -- 0:00:44
199000 -- (-529.983) (-527.641) (-529.760) [-528.240] * [-527.112] (-529.751) (-527.727) (-527.348) -- 0:00:44
199500 -- [-531.002] (-531.257) (-530.301) (-530.980) * (-528.319) (-528.080) [-528.350] (-530.388) -- 0:00:48
200000 -- (-530.562) (-527.928) [-527.971] (-527.710) * (-526.996) (-529.411) (-529.499) [-527.498] -- 0:00:48
Average standard deviation of split frequencies: 0.017826
200500 -- (-528.414) (-527.796) [-527.426] (-527.932) * (-531.751) [-530.107] (-529.984) (-531.691) -- 0:00:47
201000 -- (-533.150) (-528.702) [-531.651] (-526.848) * (-531.281) (-530.127) [-530.520] (-529.289) -- 0:00:47
201500 -- [-528.635] (-531.364) (-529.112) (-528.587) * (-526.833) (-529.691) (-528.353) [-527.923] -- 0:00:47
202000 -- (-527.938) [-528.211] (-530.003) (-532.792) * (-528.479) (-530.167) [-532.210] (-528.360) -- 0:00:47
202500 -- (-529.187) [-528.601] (-528.655) (-529.438) * (-530.559) [-527.765] (-528.778) (-528.195) -- 0:00:47
203000 -- (-533.212) [-530.618] (-529.566) (-528.876) * [-528.029] (-533.470) (-528.273) (-527.309) -- 0:00:47
203500 -- (-528.426) (-528.490) [-528.414] (-532.232) * (-527.592) (-532.914) (-529.025) [-528.185] -- 0:00:46
204000 -- (-527.798) (-528.034) (-531.377) [-535.852] * (-527.980) [-526.988] (-529.617) (-528.902) -- 0:00:46
204500 -- (-534.758) [-528.742] (-528.012) (-531.674) * (-528.708) [-529.656] (-529.261) (-527.515) -- 0:00:46
205000 -- (-529.590) (-527.463) (-529.115) [-527.938] * (-529.010) (-531.047) [-529.099] (-527.183) -- 0:00:46
Average standard deviation of split frequencies: 0.014874
205500 -- (-528.086) (-533.662) [-529.696] (-531.840) * (-528.848) (-528.117) [-528.909] (-529.691) -- 0:00:46
206000 -- (-530.534) [-532.726] (-528.540) (-531.551) * [-527.596] (-528.137) (-530.380) (-533.605) -- 0:00:46
206500 -- (-530.419) (-527.912) (-527.557) [-530.354] * (-527.243) [-528.316] (-528.591) (-532.106) -- 0:00:46
207000 -- [-528.375] (-528.145) (-527.814) (-528.535) * (-529.849) (-529.153) [-530.347] (-530.667) -- 0:00:45
207500 -- (-531.004) (-527.531) [-527.163] (-530.758) * (-534.301) (-531.533) (-527.218) [-529.333] -- 0:00:45
208000 -- (-528.291) (-527.111) [-528.499] (-528.180) * (-531.918) (-528.658) (-527.832) [-531.324] -- 0:00:45
208500 -- [-529.407] (-528.467) (-528.721) (-529.009) * [-527.684] (-527.298) (-529.334) (-529.197) -- 0:00:45
209000 -- [-529.854] (-528.357) (-527.548) (-528.011) * [-527.551] (-527.399) (-527.726) (-529.000) -- 0:00:45
209500 -- (-529.777) [-529.296] (-531.890) (-527.644) * (-530.866) [-529.459] (-529.282) (-530.471) -- 0:00:45
210000 -- (-528.431) (-530.236) [-529.364] (-530.020) * (-531.286) (-527.642) [-529.408] (-531.792) -- 0:00:45
Average standard deviation of split frequencies: 0.013689
210500 -- (-528.626) [-530.087] (-531.029) (-531.635) * (-528.381) [-528.966] (-528.482) (-530.159) -- 0:00:45
211000 -- [-528.157] (-527.578) (-528.995) (-528.609) * (-529.140) (-532.243) (-529.867) [-527.475] -- 0:00:44
211500 -- (-530.617) (-528.485) (-527.400) [-530.374] * (-529.335) (-533.035) [-528.771] (-533.565) -- 0:00:44
212000 -- (-536.619) [-530.414] (-527.240) (-531.484) * [-530.951] (-528.937) (-529.227) (-531.897) -- 0:00:44
212500 -- [-535.803] (-528.323) (-530.200) (-529.862) * (-528.604) (-529.664) [-529.654] (-527.920) -- 0:00:44
213000 -- (-531.807) (-529.119) [-527.559] (-527.435) * (-530.727) (-530.353) [-528.044] (-527.523) -- 0:00:44
213500 -- [-527.123] (-530.094) (-528.349) (-530.311) * (-529.824) [-530.642] (-528.625) (-530.737) -- 0:00:44
214000 -- (-531.923) (-530.870) (-527.866) [-527.511] * [-527.633] (-530.196) (-527.564) (-527.909) -- 0:00:44
214500 -- [-531.040] (-533.794) (-528.251) (-532.135) * (-529.079) (-528.954) (-530.079) [-528.101] -- 0:00:43
215000 -- (-528.486) (-531.976) (-536.952) [-527.678] * (-533.030) [-527.974] (-531.172) (-529.100) -- 0:00:43
Average standard deviation of split frequencies: 0.016150
215500 -- (-527.906) (-531.972) [-529.964] (-528.149) * [-529.862] (-527.845) (-529.485) (-528.264) -- 0:00:43
216000 -- [-531.174] (-529.867) (-527.573) (-527.489) * (-530.739) [-529.278] (-531.747) (-527.618) -- 0:00:43
216500 -- (-529.080) (-531.546) [-527.904] (-529.250) * (-528.111) (-528.808) (-529.792) [-530.565] -- 0:00:47
217000 -- [-528.124] (-529.682) (-527.133) (-527.483) * (-531.479) (-530.131) (-531.996) [-531.065] -- 0:00:46
217500 -- (-531.607) (-528.141) (-529.152) [-527.835] * [-528.199] (-533.362) (-529.176) (-528.223) -- 0:00:46
218000 -- [-530.028] (-527.591) (-529.257) (-530.542) * (-528.119) (-531.858) [-529.301] (-529.019) -- 0:00:46
218500 -- (-532.789) (-531.144) [-529.389] (-531.515) * (-529.210) (-533.040) [-531.813] (-529.430) -- 0:00:46
219000 -- [-527.151] (-533.229) (-531.118) (-527.699) * [-531.334] (-529.185) (-529.612) (-529.254) -- 0:00:46
219500 -- (-529.706) [-529.162] (-529.703) (-527.742) * [-532.009] (-530.722) (-528.161) (-530.494) -- 0:00:46
220000 -- (-530.419) (-528.718) (-529.562) [-530.904] * [-528.116] (-528.428) (-527.795) (-530.438) -- 0:00:46
Average standard deviation of split frequencies: 0.014820
220500 -- (-531.521) (-528.118) (-530.131) [-530.722] * [-529.077] (-528.608) (-530.069) (-529.941) -- 0:00:45
221000 -- (-529.352) (-527.453) (-528.106) [-533.033] * (-530.636) (-530.141) (-530.843) [-530.389] -- 0:00:45
221500 -- (-528.929) [-528.204] (-526.973) (-533.499) * (-528.021) [-528.286] (-533.343) (-527.075) -- 0:00:45
222000 -- (-528.877) [-528.388] (-527.647) (-530.257) * (-527.739) (-528.629) [-528.306] (-528.583) -- 0:00:45
222500 -- (-530.633) [-528.974] (-528.417) (-527.978) * (-528.979) (-529.850) (-530.181) [-530.917] -- 0:00:45
223000 -- (-528.526) (-530.919) [-529.737] (-529.503) * [-527.624] (-530.371) (-529.086) (-528.653) -- 0:00:45
223500 -- (-534.851) (-527.222) (-528.952) [-529.765] * (-527.613) (-531.585) [-527.687] (-530.993) -- 0:00:45
224000 -- (-530.939) (-527.640) [-529.524] (-528.217) * (-528.900) [-528.629] (-528.283) (-534.417) -- 0:00:45
224500 -- (-530.930) [-529.398] (-528.271) (-527.569) * [-527.877] (-527.823) (-527.315) (-528.300) -- 0:00:44
225000 -- (-531.097) (-528.789) [-529.343] (-527.166) * (-529.131) [-528.570] (-528.971) (-529.493) -- 0:00:44
Average standard deviation of split frequencies: 0.013619
225500 -- [-528.126] (-528.059) (-531.183) (-530.097) * [-528.791] (-527.824) (-527.300) (-532.837) -- 0:00:44
226000 -- (-529.518) (-532.456) [-532.406] (-531.399) * (-528.153) (-528.646) [-529.598] (-529.112) -- 0:00:44
226500 -- (-529.242) [-530.432] (-529.006) (-528.102) * [-534.381] (-528.785) (-529.445) (-528.107) -- 0:00:44
227000 -- (-528.670) (-530.541) (-530.351) [-527.147] * (-531.564) (-528.568) (-527.991) [-528.683] -- 0:00:44
227500 -- [-528.358] (-529.352) (-528.283) (-530.424) * [-528.059] (-529.390) (-529.647) (-528.520) -- 0:00:44
228000 -- (-528.562) (-528.112) [-528.992] (-527.431) * [-528.671] (-532.454) (-528.681) (-528.668) -- 0:00:44
228500 -- (-527.409) (-529.330) (-528.730) [-527.943] * (-528.224) [-529.515] (-530.693) (-532.128) -- 0:00:43
229000 -- (-527.591) (-529.940) [-528.583] (-529.366) * (-530.113) (-529.670) (-531.077) [-534.735] -- 0:00:43
229500 -- (-529.978) (-529.750) [-527.420] (-527.183) * [-527.921] (-531.379) (-532.190) (-527.219) -- 0:00:43
230000 -- (-529.824) (-528.380) [-529.117] (-528.292) * [-528.496] (-529.282) (-527.936) (-527.084) -- 0:00:43
Average standard deviation of split frequencies: 0.015027
230500 -- (-529.622) [-528.620] (-529.664) (-529.180) * (-529.670) (-532.838) [-529.539] (-531.334) -- 0:00:43
231000 -- (-528.778) [-531.327] (-534.832) (-531.992) * (-529.540) [-528.839] (-529.254) (-531.745) -- 0:00:43
231500 -- (-528.277) [-529.896] (-527.662) (-533.020) * (-528.433) (-530.991) [-527.517] (-528.929) -- 0:00:43
232000 -- (-528.674) (-528.041) (-528.093) [-531.150] * (-527.335) (-536.622) (-527.517) [-527.702] -- 0:00:43
232500 -- (-529.111) (-528.652) (-527.703) [-529.428] * (-528.385) (-533.312) (-528.230) [-529.815] -- 0:00:42
233000 -- (-527.808) (-528.169) [-530.460] (-532.737) * [-527.433] (-531.170) (-527.620) (-530.920) -- 0:00:42
233500 -- [-527.847] (-533.181) (-528.085) (-528.716) * (-529.998) [-532.282] (-529.183) (-528.598) -- 0:00:45
234000 -- (-528.102) [-530.832] (-531.766) (-528.646) * (-530.205) (-534.480) [-529.581] (-528.036) -- 0:00:45
234500 -- (-528.305) [-531.368] (-534.469) (-527.270) * (-527.616) (-532.597) (-528.836) [-529.686] -- 0:00:45
235000 -- [-527.702] (-528.214) (-535.944) (-529.590) * (-528.849) (-526.986) [-528.218] (-529.759) -- 0:00:45
Average standard deviation of split frequencies: 0.016646
235500 -- (-526.747) (-530.166) [-537.570] (-529.761) * (-530.285) (-530.655) [-529.899] (-529.487) -- 0:00:45
236000 -- (-528.674) (-528.192) [-527.313] (-528.514) * [-528.411] (-527.408) (-531.237) (-528.871) -- 0:00:45
236500 -- (-528.330) (-528.346) [-527.067] (-528.228) * [-529.013] (-527.593) (-529.039) (-532.625) -- 0:00:45
237000 -- (-528.375) [-531.069] (-530.590) (-529.842) * (-528.382) (-528.315) (-534.042) [-529.313] -- 0:00:45
237500 -- (-528.692) (-528.644) (-528.809) [-527.724] * (-527.890) (-527.187) [-531.211] (-527.414) -- 0:00:44
238000 -- (-529.358) (-533.288) [-529.560] (-529.453) * (-529.147) (-531.709) (-532.463) [-527.261] -- 0:00:44
238500 -- [-527.234] (-528.791) (-530.117) (-532.941) * [-529.832] (-529.310) (-527.751) (-528.190) -- 0:00:44
239000 -- (-527.328) (-537.740) (-533.058) [-529.748] * (-535.557) [-530.952] (-530.429) (-529.510) -- 0:00:44
239500 -- [-529.505] (-533.705) (-527.683) (-527.292) * [-528.501] (-531.735) (-532.577) (-528.988) -- 0:00:44
240000 -- (-531.286) (-531.944) [-526.985] (-528.573) * [-529.234] (-529.218) (-528.158) (-529.048) -- 0:00:44
Average standard deviation of split frequencies: 0.013956
240500 -- [-529.526] (-529.348) (-529.950) (-530.033) * (-531.130) (-529.154) [-530.836] (-528.336) -- 0:00:44
241000 -- [-529.376] (-527.909) (-530.470) (-530.545) * (-530.012) (-531.290) [-528.128] (-529.856) -- 0:00:44
241500 -- (-527.503) (-528.120) [-527.312] (-530.851) * (-532.075) [-529.735] (-531.543) (-531.463) -- 0:00:43
242000 -- (-528.289) (-531.460) (-530.560) [-529.892] * [-529.187] (-528.041) (-534.499) (-531.641) -- 0:00:43
242500 -- (-530.159) (-538.003) (-529.103) [-531.562] * (-529.791) [-527.128] (-529.633) (-530.658) -- 0:00:43
243000 -- (-528.231) [-534.734] (-529.439) (-532.334) * (-528.102) (-529.696) [-529.535] (-528.759) -- 0:00:43
243500 -- (-527.560) [-530.691] (-530.269) (-528.763) * (-530.087) (-529.529) (-528.150) [-531.763] -- 0:00:43
244000 -- (-529.816) (-529.318) [-532.060] (-529.522) * (-529.302) (-527.601) (-530.152) [-529.849] -- 0:00:43
244500 -- (-528.405) (-528.006) (-533.080) [-527.724] * [-528.874] (-528.293) (-529.895) (-531.784) -- 0:00:43
245000 -- (-531.679) [-529.168] (-535.288) (-527.021) * (-528.590) [-527.651] (-531.228) (-528.788) -- 0:00:43
Average standard deviation of split frequencies: 0.013978
245500 -- (-535.506) (-528.859) [-529.628] (-527.082) * (-533.917) (-528.265) [-528.617] (-529.466) -- 0:00:43
246000 -- (-528.323) (-528.614) [-532.556] (-528.146) * (-528.069) (-531.021) (-530.908) [-528.315] -- 0:00:42
246500 -- [-528.269] (-528.263) (-532.734) (-528.014) * (-531.796) [-528.686] (-529.111) (-530.495) -- 0:00:42
247000 -- (-527.074) (-529.395) (-535.180) [-528.383] * [-528.825] (-529.124) (-528.785) (-529.390) -- 0:00:42
247500 -- (-531.532) [-528.037] (-529.811) (-529.836) * (-530.595) (-526.958) (-529.353) [-527.990] -- 0:00:42
248000 -- (-528.972) (-528.624) (-527.048) [-528.861] * (-527.171) [-527.352] (-528.037) (-528.651) -- 0:00:42
248500 -- [-535.609] (-528.162) (-528.569) (-530.890) * (-529.316) (-529.729) (-532.732) [-529.766] -- 0:00:42
249000 -- (-530.794) [-528.411] (-528.105) (-528.400) * (-529.512) [-528.164] (-528.754) (-529.449) -- 0:00:42
249500 -- [-527.362] (-528.784) (-532.269) (-528.359) * (-528.372) [-527.482] (-532.155) (-528.954) -- 0:00:42
250000 -- (-528.933) (-527.253) [-531.984] (-527.417) * (-529.321) (-527.744) (-529.441) [-527.887] -- 0:00:42
Average standard deviation of split frequencies: 0.012943
250500 -- [-529.574] (-529.560) (-530.291) (-528.297) * (-527.731) (-534.156) [-529.674] (-530.887) -- 0:00:44
251000 -- (-528.987) (-527.552) (-528.558) [-530.270] * (-530.427) (-528.518) (-527.846) [-529.874] -- 0:00:44
251500 -- (-529.206) (-527.539) (-530.462) [-530.054] * [-528.820] (-528.139) (-530.441) (-528.192) -- 0:00:44
252000 -- (-533.455) [-529.451] (-531.485) (-534.487) * [-528.784] (-530.187) (-531.359) (-527.724) -- 0:00:44
252500 -- (-529.630) [-530.326] (-527.321) (-530.036) * (-527.920) (-530.475) [-529.264] (-527.968) -- 0:00:44
253000 -- (-527.723) (-530.585) (-535.026) [-527.830] * (-528.132) (-531.219) [-528.382] (-528.427) -- 0:00:44
253500 -- (-530.876) (-528.892) (-531.227) [-528.827] * (-528.646) (-527.730) [-531.490] (-530.321) -- 0:00:44
254000 -- (-527.857) (-530.978) (-532.883) [-527.629] * [-527.497] (-527.991) (-529.003) (-535.452) -- 0:00:44
254500 -- [-530.218] (-532.710) (-529.873) (-529.783) * (-528.335) [-530.673] (-531.132) (-529.342) -- 0:00:43
255000 -- [-532.631] (-530.976) (-529.248) (-531.314) * (-527.359) (-527.243) (-527.887) [-529.209] -- 0:00:43
Average standard deviation of split frequencies: 0.013504
255500 -- [-529.905] (-535.883) (-537.013) (-527.576) * (-528.474) (-528.744) (-530.937) [-528.935] -- 0:00:43
256000 -- (-528.714) (-530.407) [-530.821] (-527.898) * (-529.389) (-529.459) (-528.702) [-527.991] -- 0:00:43
256500 -- (-529.420) [-531.064] (-530.505) (-529.399) * (-527.964) [-531.057] (-526.829) (-530.156) -- 0:00:43
257000 -- (-527.300) (-527.702) [-529.278] (-533.765) * (-527.870) [-528.569] (-528.456) (-528.336) -- 0:00:43
257500 -- (-528.368) (-528.968) [-527.730] (-532.228) * (-527.755) (-532.113) (-528.735) [-528.350] -- 0:00:43
258000 -- (-529.081) (-527.585) [-529.945] (-530.754) * [-529.974] (-528.498) (-529.140) (-528.084) -- 0:00:43
258500 -- (-530.207) (-531.980) [-530.378] (-530.382) * (-528.316) (-529.647) [-527.923] (-532.900) -- 0:00:43
259000 -- (-528.219) (-529.520) (-534.852) [-527.419] * [-528.504] (-527.948) (-529.469) (-528.056) -- 0:00:42
259500 -- [-530.459] (-532.165) (-534.614) (-529.224) * (-529.617) (-530.696) [-527.622] (-527.140) -- 0:00:42
260000 -- (-529.353) [-530.058] (-527.535) (-528.744) * (-529.142) (-527.483) (-529.503) [-528.017] -- 0:00:42
Average standard deviation of split frequencies: 0.012553
260500 -- (-530.497) [-528.710] (-528.346) (-527.615) * (-528.618) [-531.319] (-529.429) (-529.039) -- 0:00:42
261000 -- (-526.897) [-527.618] (-531.090) (-528.704) * (-528.195) [-527.368] (-529.566) (-529.943) -- 0:00:42
261500 -- (-528.138) [-529.529] (-529.364) (-528.423) * [-528.506] (-529.030) (-531.433) (-528.006) -- 0:00:42
262000 -- (-528.270) (-528.567) [-527.226] (-528.610) * (-527.927) (-531.116) [-528.678] (-532.064) -- 0:00:42
262500 -- (-532.819) [-527.478] (-527.302) (-537.124) * (-532.164) (-531.351) [-528.748] (-532.131) -- 0:00:42
263000 -- (-531.522) [-528.582] (-527.674) (-529.758) * (-528.030) [-532.431] (-528.911) (-532.954) -- 0:00:42
263500 -- (-532.060) (-529.628) [-526.938] (-528.860) * (-528.017) (-531.603) (-528.606) [-527.847] -- 0:00:41
264000 -- [-528.003] (-532.379) (-528.514) (-530.129) * (-532.708) (-528.097) (-530.468) [-528.384] -- 0:00:41
264500 -- (-528.690) (-528.354) [-529.448] (-528.726) * (-537.310) (-527.996) [-529.504] (-530.681) -- 0:00:41
265000 -- (-528.256) (-528.817) [-528.739] (-527.509) * (-530.792) (-528.790) (-531.852) [-528.867] -- 0:00:41
Average standard deviation of split frequencies: 0.013488
265500 -- (-528.844) (-527.560) [-528.873] (-529.450) * (-527.371) (-530.496) [-528.666] (-527.549) -- 0:00:41
266000 -- [-528.934] (-530.211) (-527.296) (-532.725) * (-528.252) (-529.931) (-527.511) [-535.248] -- 0:00:41
266500 -- (-531.097) (-527.355) [-527.281] (-529.834) * (-528.781) (-534.873) [-530.861] (-528.486) -- 0:00:41
267000 -- (-529.085) [-527.210] (-528.747) (-531.253) * [-527.911] (-537.051) (-528.203) (-531.917) -- 0:00:41
267500 -- [-529.592] (-529.162) (-528.267) (-530.342) * (-527.152) [-528.166] (-530.340) (-529.176) -- 0:00:41
268000 -- (-529.461) [-527.177] (-527.706) (-529.768) * (-528.865) (-527.216) [-528.802] (-534.116) -- 0:00:43
268500 -- (-532.936) (-528.859) [-527.974] (-529.343) * (-528.878) [-528.274] (-527.224) (-530.240) -- 0:00:43
269000 -- (-528.859) [-528.159] (-527.479) (-527.809) * (-527.752) [-530.713] (-528.428) (-530.086) -- 0:00:43
269500 -- [-531.672] (-527.059) (-528.628) (-534.159) * (-528.666) [-528.033] (-529.197) (-530.035) -- 0:00:43
270000 -- (-527.398) (-529.076) [-529.603] (-527.605) * (-529.928) [-527.368] (-529.859) (-527.833) -- 0:00:43
Average standard deviation of split frequencies: 0.013108
270500 -- [-530.412] (-537.279) (-528.729) (-527.971) * (-531.124) [-529.797] (-531.906) (-528.222) -- 0:00:43
271000 -- (-529.028) (-539.456) [-527.848] (-531.521) * [-531.125] (-532.453) (-528.313) (-530.349) -- 0:00:43
271500 -- (-529.604) [-527.915] (-530.062) (-529.665) * (-529.895) [-527.780] (-528.268) (-528.298) -- 0:00:42
272000 -- [-532.622] (-528.625) (-530.170) (-530.765) * [-528.650] (-531.193) (-530.130) (-529.589) -- 0:00:42
272500 -- (-530.333) (-531.707) (-528.547) [-527.927] * (-528.645) (-531.406) (-530.952) [-528.276] -- 0:00:42
273000 -- (-529.510) [-528.350] (-527.640) (-528.648) * (-527.294) (-530.144) [-528.708] (-532.139) -- 0:00:42
273500 -- (-532.205) [-528.994] (-527.485) (-537.134) * (-528.378) [-529.492] (-530.165) (-533.215) -- 0:00:42
274000 -- (-531.878) (-530.106) [-529.999] (-528.619) * (-528.720) [-529.049] (-529.731) (-529.420) -- 0:00:42
274500 -- (-527.253) (-527.928) (-527.706) [-531.114] * (-528.769) [-530.043] (-528.848) (-528.460) -- 0:00:42
275000 -- (-528.635) [-530.038] (-529.641) (-531.381) * (-531.792) [-529.439] (-535.995) (-529.525) -- 0:00:42
Average standard deviation of split frequencies: 0.012659
275500 -- (-528.410) (-527.923) (-529.448) [-528.141] * [-530.164] (-528.764) (-529.089) (-528.740) -- 0:00:42
276000 -- (-528.337) (-527.653) (-531.569) [-529.800] * (-528.665) [-529.132] (-528.455) (-529.024) -- 0:00:41
276500 -- (-528.119) (-528.660) (-533.603) [-531.394] * [-527.221] (-532.851) (-531.626) (-530.850) -- 0:00:41
277000 -- [-529.142] (-528.932) (-531.199) (-529.685) * (-530.447) (-527.621) [-529.275] (-529.803) -- 0:00:41
277500 -- (-528.628) (-530.616) [-530.370] (-528.005) * (-528.383) (-527.313) [-530.491] (-529.383) -- 0:00:41
278000 -- (-528.602) (-530.566) (-532.741) [-530.045] * (-528.733) [-533.088] (-531.715) (-529.618) -- 0:00:41
278500 -- (-528.463) [-526.975] (-534.625) (-527.546) * (-528.761) [-528.470] (-527.456) (-529.521) -- 0:00:41
279000 -- (-530.250) [-527.539] (-526.778) (-530.927) * (-530.788) [-527.777] (-528.342) (-528.570) -- 0:00:41
279500 -- (-528.635) (-533.914) [-528.891] (-530.638) * (-530.392) (-531.207) [-528.822] (-527.947) -- 0:00:41
280000 -- (-530.747) [-528.737] (-529.097) (-527.606) * (-532.475) [-528.493] (-530.863) (-526.847) -- 0:00:41
Average standard deviation of split frequencies: 0.013997
280500 -- (-529.129) (-530.006) [-532.160] (-531.181) * (-530.178) (-528.899) (-532.314) [-527.611] -- 0:00:41
281000 -- (-528.657) [-529.407] (-532.294) (-529.436) * (-529.400) (-529.351) (-528.066) [-527.454] -- 0:00:40
281500 -- [-530.462] (-527.613) (-529.287) (-527.948) * (-531.859) (-528.888) (-529.653) [-529.091] -- 0:00:40
282000 -- (-530.971) [-528.317] (-529.491) (-529.705) * (-532.244) (-529.086) (-527.987) [-526.913] -- 0:00:40
282500 -- [-527.888] (-529.330) (-528.298) (-527.131) * (-528.384) [-527.283] (-533.393) (-527.415) -- 0:00:40
283000 -- (-533.718) (-530.262) [-535.971] (-529.468) * [-529.482] (-527.713) (-531.204) (-527.294) -- 0:00:40
283500 -- (-528.426) [-530.347] (-547.469) (-531.142) * (-529.582) [-528.813] (-531.575) (-527.097) -- 0:00:40
284000 -- (-533.035) (-527.047) (-530.473) [-527.245] * (-535.819) (-529.189) (-532.028) [-530.055] -- 0:00:40
284500 -- (-529.306) [-527.379] (-528.032) (-528.929) * [-528.316] (-528.916) (-527.858) (-528.344) -- 0:00:40
285000 -- (-529.277) (-528.987) (-528.089) [-528.786] * (-529.269) [-528.889] (-527.281) (-528.740) -- 0:00:42
Average standard deviation of split frequencies: 0.013095
285500 -- (-531.712) [-528.871] (-529.447) (-528.536) * [-532.829] (-528.718) (-528.480) (-528.253) -- 0:00:42
286000 -- (-529.229) (-527.720) [-530.095] (-531.050) * (-532.281) [-530.593] (-530.726) (-530.285) -- 0:00:42
286500 -- (-529.383) [-527.624] (-532.723) (-528.864) * (-530.325) [-528.800] (-531.641) (-528.947) -- 0:00:42
287000 -- (-529.949) (-531.000) [-526.960] (-528.708) * [-529.775] (-527.447) (-530.202) (-530.237) -- 0:00:42
287500 -- (-528.040) [-529.375] (-529.705) (-530.089) * (-529.826) [-530.481] (-528.983) (-528.732) -- 0:00:42
288000 -- [-527.672] (-530.515) (-532.602) (-530.827) * (-529.826) [-528.643] (-529.614) (-528.416) -- 0:00:42
288500 -- (-533.341) [-528.557] (-528.456) (-529.513) * (-530.400) (-528.381) (-532.621) [-528.200] -- 0:00:41
289000 -- (-528.806) [-530.348] (-531.900) (-528.598) * (-528.869) [-528.694] (-528.579) (-528.701) -- 0:00:41
289500 -- (-529.135) [-529.738] (-529.226) (-528.312) * (-529.645) [-527.672] (-528.681) (-528.967) -- 0:00:41
290000 -- (-529.364) (-528.671) (-530.732) [-527.253] * (-527.403) (-527.736) [-527.330] (-529.664) -- 0:00:41
Average standard deviation of split frequencies: 0.012974
290500 -- (-527.544) (-531.815) (-529.289) [-533.411] * (-529.485) (-528.299) (-529.765) [-528.592] -- 0:00:41
291000 -- (-529.544) (-528.795) [-528.544] (-530.903) * [-527.732] (-529.178) (-531.986) (-532.196) -- 0:00:41
291500 -- (-530.058) (-527.493) [-528.034] (-532.089) * (-531.826) (-531.469) [-528.896] (-527.871) -- 0:00:41
292000 -- (-530.735) (-529.314) [-527.622] (-530.050) * (-527.774) [-535.557] (-532.156) (-527.501) -- 0:00:41
292500 -- (-528.223) (-527.486) [-528.964] (-531.653) * (-532.267) [-530.054] (-530.065) (-530.331) -- 0:00:41
293000 -- (-528.372) (-527.037) (-529.959) [-529.635] * [-528.375] (-529.010) (-527.802) (-528.537) -- 0:00:41
293500 -- (-527.458) (-528.457) [-529.898] (-529.635) * [-527.558] (-528.691) (-527.344) (-531.789) -- 0:00:40
294000 -- [-526.926] (-531.408) (-528.899) (-530.279) * [-529.885] (-529.107) (-528.065) (-529.433) -- 0:00:40
294500 -- (-532.371) (-531.488) (-527.549) [-528.117] * (-527.818) (-528.860) (-528.666) [-531.303] -- 0:00:40
295000 -- [-527.395] (-527.206) (-529.486) (-534.805) * (-528.637) [-532.009] (-527.498) (-531.499) -- 0:00:40
Average standard deviation of split frequencies: 0.014052
295500 -- [-529.544] (-531.642) (-528.599) (-531.452) * [-527.621] (-530.372) (-528.315) (-530.416) -- 0:00:40
296000 -- [-528.779] (-533.168) (-532.953) (-528.538) * (-527.623) (-529.475) (-528.139) [-531.799] -- 0:00:40
296500 -- (-527.464) (-528.411) (-527.778) [-527.581] * (-532.435) (-527.445) [-529.043] (-531.909) -- 0:00:40
297000 -- (-528.329) (-533.042) [-527.528] (-527.963) * (-536.415) [-534.401] (-528.801) (-527.767) -- 0:00:40
297500 -- [-529.037] (-527.338) (-529.211) (-530.590) * (-529.794) (-530.340) [-528.671] (-528.986) -- 0:00:40
298000 -- [-526.913] (-527.807) (-527.998) (-527.244) * (-534.379) (-531.642) (-528.661) [-529.164] -- 0:00:40
298500 -- (-527.748) [-528.043] (-528.920) (-529.967) * (-528.842) [-533.277] (-533.715) (-527.163) -- 0:00:39
299000 -- (-532.073) [-527.044] (-530.960) (-533.430) * (-528.193) (-533.510) (-528.128) [-527.758] -- 0:00:39
299500 -- [-527.210] (-527.318) (-529.680) (-529.658) * (-530.111) (-530.284) [-533.044] (-528.805) -- 0:00:39
300000 -- (-530.146) (-531.251) [-530.548] (-530.414) * [-527.444] (-529.630) (-530.015) (-530.444) -- 0:00:39
Average standard deviation of split frequencies: 0.012630
300500 -- (-528.854) [-528.106] (-528.031) (-530.585) * (-531.207) (-528.532) [-529.050] (-529.561) -- 0:00:39
301000 -- [-528.500] (-529.241) (-531.490) (-529.470) * [-528.946] (-530.256) (-529.427) (-528.611) -- 0:00:39
301500 -- (-527.316) (-528.520) [-529.112] (-528.521) * (-527.866) (-528.482) [-527.149] (-528.878) -- 0:00:39
302000 -- (-529.536) (-528.412) [-527.540] (-528.854) * (-528.822) [-532.203] (-529.011) (-530.343) -- 0:00:41
302500 -- (-529.931) (-533.665) [-527.922] (-527.731) * (-527.146) [-529.766] (-529.600) (-529.374) -- 0:00:41
303000 -- (-530.516) [-528.037] (-527.972) (-528.249) * (-527.617) (-530.284) [-528.589] (-527.886) -- 0:00:41
303500 -- [-527.529] (-527.892) (-531.270) (-528.252) * (-527.232) [-528.963] (-532.478) (-527.927) -- 0:00:41
304000 -- (-527.939) [-528.586] (-527.072) (-531.555) * (-529.095) [-530.185] (-530.052) (-530.838) -- 0:00:41
304500 -- (-530.843) [-527.947] (-528.248) (-530.322) * [-527.476] (-528.205) (-529.342) (-530.270) -- 0:00:41
305000 -- (-528.123) (-527.293) [-528.610] (-531.747) * (-527.881) [-527.024] (-528.009) (-527.545) -- 0:00:41
Average standard deviation of split frequencies: 0.013608
305500 -- (-529.778) [-528.665] (-530.169) (-528.054) * (-530.202) [-527.904] (-528.650) (-530.528) -- 0:00:40
306000 -- [-528.563] (-530.466) (-528.015) (-530.130) * [-531.245] (-529.057) (-530.595) (-527.539) -- 0:00:40
306500 -- [-529.769] (-529.590) (-531.645) (-530.356) * (-527.636) [-528.118] (-529.128) (-528.889) -- 0:00:40
307000 -- [-531.463] (-530.746) (-528.176) (-529.308) * [-529.066] (-527.741) (-529.011) (-528.750) -- 0:00:40
307500 -- (-530.058) (-530.264) [-527.314] (-528.611) * (-527.472) (-527.669) (-530.103) [-529.196] -- 0:00:40
308000 -- (-531.392) (-528.832) [-529.403] (-534.084) * (-530.612) (-528.953) (-528.763) [-528.867] -- 0:00:40
308500 -- (-529.121) [-527.387] (-528.288) (-530.780) * (-528.241) [-527.904] (-531.822) (-532.515) -- 0:00:40
309000 -- (-528.440) (-530.708) (-528.515) [-529.080] * (-528.769) (-528.553) (-528.003) [-531.173] -- 0:00:40
309500 -- (-527.904) (-528.954) (-527.838) [-528.441] * (-528.666) (-527.395) (-531.478) [-529.745] -- 0:00:40
310000 -- (-529.212) (-528.782) [-529.434] (-526.914) * [-526.993] (-527.359) (-529.278) (-529.789) -- 0:00:40
Average standard deviation of split frequencies: 0.013741
310500 -- [-532.141] (-528.477) (-532.126) (-527.758) * (-527.687) [-527.459] (-530.857) (-531.067) -- 0:00:39
311000 -- (-529.886) (-527.799) [-529.161] (-528.458) * (-528.131) [-529.628] (-532.572) (-530.344) -- 0:00:39
311500 -- (-528.696) [-528.529] (-528.854) (-528.041) * (-528.094) (-527.842) (-530.434) [-528.437] -- 0:00:39
312000 -- (-530.553) [-527.656] (-531.483) (-530.381) * (-531.810) (-531.942) [-527.872] (-529.851) -- 0:00:39
312500 -- (-531.076) [-527.595] (-531.669) (-534.230) * (-528.821) [-528.600] (-527.000) (-528.998) -- 0:00:39
313000 -- (-535.302) [-528.857] (-529.195) (-529.506) * (-528.122) (-528.080) (-528.212) [-527.947] -- 0:00:39
313500 -- (-529.800) (-529.190) (-529.965) [-529.675] * (-530.557) (-531.863) (-527.309) [-527.266] -- 0:00:39
314000 -- (-527.164) (-530.784) (-528.757) [-529.086] * (-531.006) (-529.486) [-527.657] (-531.730) -- 0:00:39
314500 -- (-528.732) (-531.023) [-531.919] (-528.706) * (-527.448) (-530.197) (-531.737) [-531.873] -- 0:00:39
315000 -- [-528.848] (-528.662) (-528.888) (-529.184) * (-527.202) (-530.192) [-528.666] (-529.578) -- 0:00:39
Average standard deviation of split frequencies: 0.013592
315500 -- (-536.911) (-529.976) [-527.284] (-529.624) * (-526.732) (-528.054) (-527.803) [-529.205] -- 0:00:39
316000 -- (-530.033) (-530.051) (-528.826) [-527.163] * (-528.022) (-528.117) [-527.896] (-528.566) -- 0:00:38
316500 -- (-534.271) [-528.603] (-528.588) (-530.060) * (-529.659) [-528.715] (-527.536) (-529.525) -- 0:00:38
317000 -- (-536.369) [-529.091] (-533.076) (-531.605) * (-531.237) [-527.297] (-528.729) (-529.894) -- 0:00:38
317500 -- [-531.614] (-528.949) (-529.205) (-531.421) * (-529.441) (-528.117) [-528.106] (-528.891) -- 0:00:38
318000 -- [-527.732] (-530.778) (-532.397) (-527.533) * (-527.666) (-529.561) (-527.722) [-527.875] -- 0:00:38
318500 -- [-530.937] (-529.416) (-532.064) (-528.637) * [-528.453] (-528.700) (-531.591) (-528.620) -- 0:00:38
319000 -- (-529.877) [-528.237] (-529.611) (-532.467) * [-528.133] (-529.348) (-528.126) (-530.709) -- 0:00:40
319500 -- (-529.195) (-529.593) [-528.001] (-533.671) * [-529.074] (-528.605) (-528.695) (-528.616) -- 0:00:40
320000 -- (-530.959) [-529.148] (-531.237) (-530.767) * (-527.715) (-533.108) (-528.587) [-530.985] -- 0:00:40
Average standard deviation of split frequencies: 0.014058
320500 -- (-528.319) [-527.506] (-532.972) (-531.179) * (-527.667) (-530.411) (-527.127) [-530.293] -- 0:00:40
321000 -- [-528.324] (-527.976) (-533.712) (-535.056) * (-530.432) [-527.559] (-528.096) (-529.648) -- 0:00:40
321500 -- (-528.805) (-529.043) [-530.287] (-530.091) * (-528.730) (-529.336) [-527.335] (-530.980) -- 0:00:40
322000 -- (-529.439) [-529.532] (-530.494) (-533.248) * (-530.457) [-530.916] (-529.026) (-527.737) -- 0:00:40
322500 -- (-531.929) (-528.196) [-533.135] (-530.896) * (-528.875) [-527.634] (-531.393) (-530.826) -- 0:00:39
323000 -- (-530.395) (-527.657) [-530.100] (-531.998) * (-529.254) [-527.302] (-528.308) (-527.935) -- 0:00:39
323500 -- (-527.446) (-529.303) [-531.301] (-530.782) * (-529.678) (-528.515) (-528.902) [-529.564] -- 0:00:39
324000 -- (-529.108) (-532.193) (-530.391) [-529.434] * [-530.333] (-528.798) (-528.417) (-530.651) -- 0:00:39
324500 -- (-531.357) (-528.286) [-528.125] (-528.866) * [-527.674] (-527.861) (-529.889) (-530.611) -- 0:00:39
325000 -- [-529.868] (-530.694) (-528.106) (-529.041) * (-527.617) (-527.170) [-529.335] (-527.063) -- 0:00:39
Average standard deviation of split frequencies: 0.013354
325500 -- (-533.205) (-530.199) [-528.331] (-532.426) * (-530.273) (-527.769) [-530.362] (-528.289) -- 0:00:39
326000 -- (-530.929) [-527.783] (-528.115) (-527.488) * (-527.890) [-527.274] (-528.523) (-528.989) -- 0:00:39
326500 -- (-527.793) [-529.192] (-526.938) (-528.164) * (-527.870) [-527.955] (-527.758) (-527.788) -- 0:00:39
327000 -- (-528.142) (-530.271) (-527.438) [-528.674] * (-529.161) [-531.317] (-527.676) (-529.318) -- 0:00:39
327500 -- (-530.056) (-530.059) [-528.400] (-531.097) * (-529.615) (-528.031) [-529.296] (-528.560) -- 0:00:39
328000 -- [-528.891] (-530.099) (-528.897) (-532.500) * (-531.953) (-528.836) [-528.701] (-527.230) -- 0:00:38
328500 -- [-528.517] (-533.540) (-528.041) (-527.167) * (-535.085) (-528.596) [-528.474] (-528.981) -- 0:00:38
329000 -- [-531.377] (-531.103) (-533.089) (-527.647) * (-532.060) (-528.077) (-529.324) [-528.153] -- 0:00:38
329500 -- [-530.359] (-527.039) (-528.771) (-529.825) * [-527.711] (-529.411) (-533.513) (-527.658) -- 0:00:38
330000 -- [-527.095] (-527.930) (-532.016) (-529.040) * (-527.985) (-527.827) (-528.250) [-528.707] -- 0:00:38
Average standard deviation of split frequencies: 0.012207
330500 -- [-530.285] (-530.405) (-529.348) (-529.397) * (-531.690) (-528.081) (-528.406) [-527.383] -- 0:00:38
331000 -- (-526.999) (-529.912) [-530.038] (-531.694) * [-531.656] (-527.256) (-529.973) (-528.765) -- 0:00:38
331500 -- [-531.312] (-529.471) (-530.708) (-531.485) * (-529.488) (-531.528) [-528.641] (-534.467) -- 0:00:38
332000 -- (-530.283) (-534.190) (-527.352) [-528.995] * (-528.652) (-528.636) (-527.830) [-529.035] -- 0:00:38
332500 -- (-529.962) (-530.414) (-527.154) [-534.159] * [-528.802] (-532.106) (-527.729) (-527.605) -- 0:00:38
333000 -- (-528.999) (-530.948) (-527.890) [-531.391] * [-529.249] (-527.726) (-527.639) (-530.637) -- 0:00:38
333500 -- [-528.230] (-528.624) (-532.918) (-531.449) * (-530.160) (-529.761) (-527.562) [-528.398] -- 0:00:37
334000 -- (-527.345) (-529.922) (-530.203) [-529.424] * (-531.372) (-535.130) (-529.109) [-528.874] -- 0:00:37
334500 -- [-527.461] (-534.234) (-529.235) (-529.314) * [-526.881] (-528.208) (-527.469) (-526.795) -- 0:00:37
335000 -- (-528.334) [-530.161] (-531.708) (-527.226) * (-528.959) (-527.984) [-528.533] (-530.004) -- 0:00:37
Average standard deviation of split frequencies: 0.011224
335500 -- (-531.838) (-532.653) [-530.644] (-529.601) * (-529.678) [-527.257] (-531.653) (-527.151) -- 0:00:37
336000 -- (-527.994) (-533.514) [-532.123] (-533.973) * (-531.041) [-528.706] (-530.898) (-527.726) -- 0:00:39
336500 -- (-528.965) (-527.683) (-529.999) [-529.332] * (-533.136) (-528.750) [-529.550] (-528.464) -- 0:00:39
337000 -- (-532.179) [-526.869] (-528.095) (-527.227) * [-529.146] (-527.229) (-530.933) (-531.657) -- 0:00:39
337500 -- (-529.061) [-529.950] (-528.716) (-526.932) * (-529.899) (-527.131) [-528.940] (-530.889) -- 0:00:39
338000 -- [-527.279] (-527.796) (-528.307) (-528.914) * (-528.137) (-527.965) (-528.540) [-529.950] -- 0:00:39
338500 -- (-529.395) [-529.758] (-530.628) (-533.250) * (-529.572) (-527.867) [-532.593] (-531.958) -- 0:00:39
339000 -- (-530.085) [-528.316] (-531.205) (-527.666) * (-529.287) (-528.377) (-528.115) [-528.801] -- 0:00:38
339500 -- (-531.982) (-527.790) (-530.773) [-534.016] * [-529.326] (-528.722) (-529.329) (-530.135) -- 0:00:38
340000 -- [-528.929] (-529.773) (-528.843) (-532.665) * (-528.983) (-531.638) [-528.354] (-528.772) -- 0:00:38
Average standard deviation of split frequencies: 0.011243
340500 -- (-529.279) (-531.018) [-528.049] (-529.273) * (-532.622) [-529.781] (-526.941) (-527.210) -- 0:00:38
341000 -- [-528.172] (-529.285) (-527.783) (-530.829) * (-533.337) [-530.798] (-527.311) (-528.591) -- 0:00:38
341500 -- (-530.776) (-528.217) (-528.936) [-527.657] * [-531.167] (-529.035) (-528.905) (-530.422) -- 0:00:38
342000 -- [-529.762] (-531.439) (-537.536) (-527.063) * (-530.399) (-530.636) (-528.291) [-530.986] -- 0:00:38
342500 -- [-529.862] (-535.862) (-529.824) (-529.876) * (-534.251) (-527.784) [-527.689] (-533.558) -- 0:00:38
343000 -- (-529.007) (-528.148) [-529.964] (-529.698) * (-532.057) [-529.663] (-529.649) (-528.212) -- 0:00:38
343500 -- (-531.808) (-530.829) [-529.512] (-529.682) * (-527.497) [-528.820] (-528.445) (-531.726) -- 0:00:38
344000 -- (-532.005) (-531.617) [-529.942] (-529.011) * (-528.355) (-528.646) (-532.910) [-527.145] -- 0:00:38
344500 -- [-528.725] (-530.935) (-532.572) (-528.419) * (-529.943) (-531.393) (-530.690) [-530.611] -- 0:00:38
345000 -- (-528.664) [-528.774] (-536.453) (-529.066) * (-530.025) (-530.696) (-529.047) [-531.117] -- 0:00:37
Average standard deviation of split frequencies: 0.010644
345500 -- (-527.258) (-530.764) (-528.472) [-528.915] * (-528.655) (-529.125) [-530.663] (-527.854) -- 0:00:37
346000 -- (-531.613) (-528.436) (-531.982) [-529.332] * (-528.942) [-528.325] (-528.052) (-528.016) -- 0:00:37
346500 -- (-528.851) (-530.398) (-532.289) [-527.109] * [-527.837] (-527.590) (-527.436) (-529.001) -- 0:00:37
347000 -- (-530.122) (-530.533) [-529.182] (-527.687) * (-527.650) (-527.855) (-527.581) [-532.489] -- 0:00:37
347500 -- (-535.999) (-530.304) [-528.433] (-529.109) * [-529.892] (-527.379) (-529.928) (-528.309) -- 0:00:37
348000 -- [-529.779] (-535.289) (-528.787) (-527.893) * [-528.442] (-527.471) (-531.390) (-530.251) -- 0:00:37
348500 -- (-529.481) (-528.717) (-527.822) [-527.538] * (-531.331) (-531.566) (-532.037) [-532.483] -- 0:00:37
349000 -- (-529.434) (-528.984) [-528.046] (-527.184) * (-529.711) (-529.996) [-532.675] (-531.224) -- 0:00:37
349500 -- (-529.417) (-527.120) (-528.477) [-527.999] * (-527.521) [-528.320] (-533.028) (-529.968) -- 0:00:37
350000 -- [-528.953] (-531.437) (-528.950) (-529.646) * (-528.059) (-529.774) (-528.599) [-529.196] -- 0:00:37
Average standard deviation of split frequencies: 0.011679
350500 -- (-529.768) (-528.917) [-533.473] (-532.091) * (-527.565) (-534.935) (-529.090) [-528.170] -- 0:00:37
351000 -- [-528.639] (-528.323) (-529.129) (-533.302) * (-530.402) (-533.113) (-533.146) [-527.258] -- 0:00:36
351500 -- [-528.243] (-528.492) (-530.374) (-528.945) * [-531.570] (-533.291) (-532.305) (-531.279) -- 0:00:36
352000 -- (-538.105) (-528.406) (-529.747) [-528.920] * (-531.505) [-527.318] (-531.150) (-529.867) -- 0:00:36
352500 -- (-533.440) (-529.007) (-527.927) [-528.531] * (-528.859) (-527.321) [-532.855] (-534.196) -- 0:00:36
353000 -- (-526.852) (-528.788) [-531.980] (-528.174) * (-530.015) [-526.974] (-532.854) (-528.447) -- 0:00:38
353500 -- (-527.666) (-537.125) (-531.003) [-528.692] * (-536.191) (-528.365) (-528.259) [-527.462] -- 0:00:38
354000 -- (-529.903) (-530.238) [-528.256] (-529.473) * (-530.142) (-529.182) [-527.109] (-528.354) -- 0:00:38
354500 -- [-530.005] (-536.053) (-528.926) (-528.447) * (-529.306) (-531.176) [-527.782] (-529.330) -- 0:00:38
355000 -- (-528.341) [-528.216] (-530.786) (-527.712) * [-529.094] (-527.162) (-528.354) (-531.175) -- 0:00:38
Average standard deviation of split frequencies: 0.011338
355500 -- [-530.250] (-529.085) (-528.238) (-528.588) * (-528.064) (-529.298) [-530.571] (-529.765) -- 0:00:38
356000 -- [-530.987] (-528.205) (-531.626) (-531.366) * [-530.470] (-531.629) (-534.845) (-528.251) -- 0:00:37
356500 -- (-534.837) (-528.382) [-528.085] (-528.157) * [-531.939] (-528.529) (-529.616) (-529.764) -- 0:00:37
357000 -- (-530.818) [-528.834] (-539.199) (-529.758) * [-531.657] (-528.181) (-531.330) (-528.766) -- 0:00:37
357500 -- (-529.539) (-529.810) [-530.049] (-528.712) * (-531.442) [-528.016] (-529.762) (-530.594) -- 0:00:37
358000 -- (-528.326) (-530.309) (-531.028) [-530.713] * [-530.586] (-528.527) (-530.831) (-539.701) -- 0:00:37
358500 -- [-530.496] (-529.914) (-528.264) (-532.182) * (-530.657) [-528.973] (-529.804) (-530.579) -- 0:00:37
359000 -- [-529.660] (-528.337) (-538.641) (-530.950) * (-529.006) (-532.073) (-529.069) [-528.191] -- 0:00:37
359500 -- (-530.387) [-528.503] (-530.210) (-531.572) * [-529.084] (-529.914) (-530.510) (-527.613) -- 0:00:37
360000 -- (-533.841) [-528.792] (-537.023) (-528.071) * [-527.867] (-531.737) (-527.148) (-529.475) -- 0:00:37
Average standard deviation of split frequencies: 0.010456
360500 -- (-527.884) [-529.727] (-532.444) (-529.057) * [-531.794] (-533.536) (-527.718) (-527.479) -- 0:00:37
361000 -- (-529.300) [-532.854] (-528.304) (-530.628) * (-531.287) (-532.275) [-527.804] (-528.829) -- 0:00:37
361500 -- [-530.044] (-528.928) (-532.951) (-528.922) * [-530.251] (-530.209) (-531.065) (-535.834) -- 0:00:37
362000 -- (-527.896) [-527.494] (-535.971) (-527.312) * [-529.280] (-527.535) (-534.703) (-528.867) -- 0:00:37
362500 -- (-528.695) (-529.045) (-530.582) [-529.262] * [-530.233] (-527.773) (-527.832) (-528.950) -- 0:00:36
363000 -- [-528.375] (-528.206) (-527.301) (-535.408) * (-531.002) (-527.442) (-531.127) [-530.137] -- 0:00:36
363500 -- [-529.815] (-529.554) (-528.543) (-529.627) * (-528.814) (-531.832) (-530.737) [-531.880] -- 0:00:36
364000 -- (-528.899) [-530.760] (-529.089) (-529.294) * (-527.474) (-531.855) (-530.998) [-531.185] -- 0:00:36
364500 -- (-528.742) (-530.382) (-530.743) [-529.898] * (-527.620) (-528.413) [-530.176] (-531.256) -- 0:00:36
365000 -- (-530.880) (-527.023) (-528.024) [-529.145] * [-527.833] (-529.794) (-531.853) (-531.264) -- 0:00:36
Average standard deviation of split frequencies: 0.010132
365500 -- (-529.110) [-527.435] (-529.888) (-528.893) * [-527.488] (-528.846) (-530.224) (-532.361) -- 0:00:36
366000 -- (-528.140) [-528.596] (-531.563) (-529.205) * [-528.374] (-529.738) (-527.942) (-528.340) -- 0:00:36
366500 -- (-528.049) (-529.648) (-531.170) [-527.219] * (-528.672) (-531.679) [-528.993] (-528.614) -- 0:00:36
367000 -- (-530.124) (-527.391) [-529.097] (-527.757) * (-530.407) (-532.256) (-530.691) [-530.280] -- 0:00:36
367500 -- (-533.122) (-527.494) (-529.322) [-527.172] * (-529.573) (-527.981) [-529.991] (-530.227) -- 0:00:36
368000 -- [-529.289] (-528.700) (-529.179) (-528.447) * (-527.507) (-528.778) [-529.932] (-528.693) -- 0:00:36
368500 -- (-531.270) (-531.656) [-528.565] (-528.909) * (-529.926) (-530.837) [-528.997] (-531.673) -- 0:00:35
369000 -- (-528.211) (-533.430) (-529.299) [-527.928] * (-536.397) [-528.635] (-529.346) (-528.349) -- 0:00:35
369500 -- [-529.203] (-531.372) (-529.421) (-530.456) * (-532.779) (-528.544) (-528.823) [-527.455] -- 0:00:35
370000 -- [-528.182] (-528.348) (-529.636) (-531.285) * (-528.321) [-530.479] (-531.289) (-528.677) -- 0:00:37
Average standard deviation of split frequencies: 0.009538
370500 -- (-529.318) (-531.054) [-534.122] (-528.812) * [-528.626] (-528.120) (-530.977) (-533.521) -- 0:00:37
371000 -- [-530.142] (-530.781) (-533.571) (-528.836) * (-528.892) [-527.601] (-527.637) (-529.495) -- 0:00:37
371500 -- [-527.825] (-528.436) (-536.911) (-529.061) * (-532.074) [-528.920] (-528.127) (-533.702) -- 0:00:37
372000 -- [-529.966] (-528.744) (-534.661) (-531.426) * (-527.306) (-527.726) [-529.465] (-530.674) -- 0:00:37
372500 -- (-528.110) (-528.642) [-527.742] (-529.897) * (-528.796) [-527.270] (-529.748) (-530.627) -- 0:00:37
373000 -- (-527.739) [-532.601] (-529.997) (-528.830) * (-530.421) [-528.027] (-527.801) (-529.513) -- 0:00:36
373500 -- (-527.419) (-529.678) [-528.376] (-530.645) * (-529.083) (-532.979) [-528.509] (-530.249) -- 0:00:36
374000 -- (-530.669) (-529.932) (-530.124) [-529.542] * [-529.290] (-535.408) (-528.080) (-528.930) -- 0:00:36
374500 -- [-527.716] (-527.765) (-528.869) (-532.512) * (-528.546) (-529.312) [-533.670] (-528.290) -- 0:00:36
375000 -- (-527.797) [-528.475] (-533.200) (-528.218) * (-530.234) [-528.166] (-529.930) (-529.823) -- 0:00:36
Average standard deviation of split frequencies: 0.008698
375500 -- (-532.567) (-528.063) [-527.676] (-526.954) * [-529.137] (-527.177) (-531.778) (-528.028) -- 0:00:36
376000 -- (-530.443) [-527.864] (-529.926) (-530.228) * (-530.900) (-528.913) [-531.379] (-529.052) -- 0:00:36
376500 -- (-532.164) (-529.428) (-530.189) [-527.820] * (-530.179) (-528.854) (-528.823) [-527.423] -- 0:00:36
377000 -- (-535.729) (-527.818) (-527.971) [-530.585] * (-528.917) (-532.574) (-529.932) [-527.334] -- 0:00:36
377500 -- (-530.995) [-527.691] (-528.258) (-528.535) * (-529.228) [-529.386] (-528.816) (-529.190) -- 0:00:36
378000 -- (-529.492) (-531.872) (-528.757) [-529.179] * (-528.667) (-533.195) [-528.323] (-528.756) -- 0:00:36
378500 -- (-530.671) (-533.316) (-528.119) [-529.366] * (-532.357) (-529.334) (-529.050) [-528.394] -- 0:00:36
379000 -- (-528.853) (-528.467) [-527.753] (-527.805) * (-530.011) [-528.703] (-531.554) (-527.381) -- 0:00:36
379500 -- [-529.215] (-533.224) (-529.439) (-529.305) * (-528.075) (-528.660) (-529.178) [-527.329] -- 0:00:35
380000 -- (-529.244) (-528.880) (-529.402) [-527.502] * (-528.723) [-527.026] (-529.081) (-530.573) -- 0:00:35
Average standard deviation of split frequencies: 0.008503
380500 -- (-529.274) (-528.036) [-532.117] (-528.510) * (-528.835) (-527.191) (-530.041) [-531.241] -- 0:00:35
381000 -- (-529.221) (-527.588) (-528.740) [-528.761] * [-529.868] (-527.612) (-531.746) (-532.289) -- 0:00:35
381500 -- (-528.285) (-527.870) [-528.010] (-529.802) * (-528.729) [-528.662] (-531.838) (-535.355) -- 0:00:35
382000 -- (-532.963) (-528.477) (-528.118) [-529.994] * (-529.651) [-529.439] (-529.493) (-530.063) -- 0:00:35
382500 -- (-529.255) (-529.477) [-529.497] (-530.789) * (-531.176) (-528.457) [-529.207] (-528.823) -- 0:00:35
383000 -- (-529.354) (-528.316) (-530.151) [-529.789] * (-530.891) (-527.390) (-534.281) [-531.828] -- 0:00:35
383500 -- (-528.407) (-527.438) (-528.869) [-527.915] * (-529.958) [-531.895] (-533.355) (-530.444) -- 0:00:35
384000 -- (-531.163) (-529.416) (-529.973) [-529.440] * (-529.942) (-530.082) (-527.633) [-527.732] -- 0:00:35
384500 -- (-532.368) (-528.379) [-528.587] (-527.791) * [-529.346] (-529.430) (-528.174) (-527.986) -- 0:00:35
385000 -- (-530.915) (-530.417) (-529.975) [-527.481] * (-528.792) (-534.593) (-529.718) [-527.888] -- 0:00:35
Average standard deviation of split frequencies: 0.008793
385500 -- [-529.574] (-528.806) (-528.702) (-529.230) * [-527.693] (-533.194) (-529.639) (-531.894) -- 0:00:35
386000 -- [-530.021] (-528.930) (-529.109) (-529.149) * (-532.322) [-528.522] (-528.188) (-529.214) -- 0:00:34
386500 -- (-529.609) (-531.264) [-530.731] (-527.492) * [-529.265] (-531.075) (-528.520) (-528.636) -- 0:00:34
387000 -- (-527.982) (-530.526) [-529.645] (-528.622) * (-528.837) (-530.250) (-528.820) [-528.313] -- 0:00:36
387500 -- (-528.799) (-529.031) [-531.117] (-527.314) * (-527.875) [-529.124] (-531.747) (-528.584) -- 0:00:36
388000 -- (-528.971) (-529.561) (-530.136) [-531.377] * (-528.281) (-531.631) (-532.416) [-527.446] -- 0:00:36
388500 -- (-532.656) [-531.526] (-528.410) (-527.971) * [-528.862] (-533.901) (-527.344) (-531.983) -- 0:00:36
389000 -- (-529.555) (-527.204) [-528.617] (-529.943) * (-528.580) (-532.379) [-527.884] (-533.825) -- 0:00:36
389500 -- (-530.085) [-530.918] (-528.782) (-527.715) * (-527.703) [-530.126] (-529.113) (-529.965) -- 0:00:36
390000 -- (-528.962) (-532.236) (-530.860) [-529.679] * [-528.212] (-528.717) (-533.800) (-531.112) -- 0:00:35
Average standard deviation of split frequencies: 0.008220
390500 -- (-529.381) (-528.993) [-528.525] (-535.076) * [-532.009] (-528.826) (-533.275) (-527.055) -- 0:00:35
391000 -- (-530.739) [-529.863] (-530.391) (-530.355) * (-529.568) (-528.673) [-530.332] (-528.865) -- 0:00:35
391500 -- (-532.511) (-528.959) [-527.176] (-528.308) * [-530.074] (-529.675) (-529.527) (-528.955) -- 0:00:35
392000 -- (-527.398) [-528.750] (-528.495) (-529.017) * (-528.879) (-530.609) (-529.530) [-528.006] -- 0:00:35
392500 -- (-530.825) (-528.042) (-527.840) [-530.928] * (-526.960) [-529.144] (-528.829) (-528.305) -- 0:00:35
393000 -- (-529.464) [-529.047] (-528.446) (-528.885) * (-528.392) [-529.491] (-529.085) (-528.779) -- 0:00:35
393500 -- (-530.481) [-530.035] (-532.385) (-528.232) * (-530.883) (-534.971) [-530.540] (-527.690) -- 0:00:35
394000 -- (-528.577) (-527.210) [-527.134] (-532.134) * (-532.581) [-529.556] (-528.093) (-531.599) -- 0:00:35
394500 -- (-531.949) [-529.413] (-531.576) (-533.181) * (-528.702) (-530.010) (-529.537) [-529.262] -- 0:00:35
395000 -- [-531.850] (-528.388) (-528.230) (-528.692) * [-528.634] (-532.106) (-527.584) (-532.973) -- 0:00:35
Average standard deviation of split frequencies: 0.007857
395500 -- (-531.318) [-529.956] (-527.309) (-528.012) * (-529.913) (-529.433) [-529.896] (-532.654) -- 0:00:35
396000 -- [-530.122] (-528.444) (-528.682) (-529.635) * (-528.929) (-528.557) [-528.473] (-528.183) -- 0:00:35
396500 -- [-529.002] (-531.071) (-528.292) (-529.288) * (-530.587) [-527.440] (-527.531) (-528.397) -- 0:00:35
397000 -- [-528.649] (-528.953) (-528.930) (-528.240) * (-533.341) (-528.698) (-528.976) [-528.588] -- 0:00:34
397500 -- [-528.474] (-528.757) (-528.885) (-527.812) * (-530.358) (-527.946) (-533.233) [-528.455] -- 0:00:34
398000 -- (-530.141) (-529.435) [-531.310] (-529.055) * [-527.849] (-529.325) (-533.851) (-528.534) -- 0:00:34
398500 -- (-528.168) (-529.879) [-531.423] (-527.886) * (-532.120) (-534.931) [-531.439] (-528.999) -- 0:00:34
399000 -- [-533.092] (-527.726) (-532.961) (-528.452) * (-529.863) (-528.582) [-527.350] (-530.346) -- 0:00:34
399500 -- (-532.739) [-532.471] (-529.974) (-528.613) * (-534.493) [-529.969] (-527.083) (-527.329) -- 0:00:34
400000 -- (-529.526) (-529.171) [-528.396] (-528.905) * (-529.052) (-526.979) (-529.150) [-528.397] -- 0:00:34
Average standard deviation of split frequencies: 0.008628
400500 -- [-529.062] (-532.976) (-529.976) (-527.863) * (-531.703) [-527.381] (-528.317) (-528.776) -- 0:00:34
401000 -- [-528.728] (-530.020) (-527.098) (-531.439) * (-527.893) (-529.472) (-528.706) [-528.394] -- 0:00:34
401500 -- [-528.046] (-529.934) (-531.376) (-530.653) * [-527.061] (-529.306) (-533.259) (-529.293) -- 0:00:34
402000 -- (-529.462) (-532.223) [-529.513] (-528.312) * (-527.076) (-530.657) [-527.745] (-527.315) -- 0:00:34
402500 -- (-528.069) (-529.348) [-527.948] (-534.267) * (-527.550) (-536.520) [-528.120] (-531.709) -- 0:00:34
403000 -- (-531.879) (-529.263) [-530.607] (-528.938) * [-527.721] (-529.596) (-530.012) (-529.434) -- 0:00:34
403500 -- [-528.982] (-530.287) (-529.643) (-527.873) * (-528.713) (-529.975) [-530.493] (-528.904) -- 0:00:34
404000 -- (-534.173) (-529.410) (-530.755) [-528.504] * (-527.874) (-529.601) [-527.362] (-529.274) -- 0:00:35
404500 -- (-533.151) [-528.713] (-534.643) (-528.619) * (-530.430) [-534.546] (-527.570) (-528.985) -- 0:00:35
405000 -- [-532.764] (-531.456) (-531.907) (-528.092) * (-529.764) [-530.313] (-530.023) (-534.737) -- 0:00:35
Average standard deviation of split frequencies: 0.008592
405500 -- (-528.227) [-532.013] (-534.368) (-529.763) * (-530.212) [-529.605] (-528.721) (-532.394) -- 0:00:35
406000 -- (-530.234) (-528.857) (-535.945) [-530.131] * (-529.752) (-530.283) (-528.549) [-532.813] -- 0:00:35
406500 -- [-530.531] (-528.903) (-533.703) (-527.808) * (-527.672) (-531.560) [-530.389] (-530.222) -- 0:00:35
407000 -- (-529.861) (-529.202) (-529.744) [-529.058] * (-532.141) [-529.797] (-529.148) (-531.492) -- 0:00:34
407500 -- (-529.040) (-529.343) (-528.644) [-528.777] * (-530.446) [-529.138] (-527.568) (-527.372) -- 0:00:34
408000 -- (-528.201) [-528.677] (-529.789) (-529.785) * (-534.008) (-527.705) (-527.568) [-530.132] -- 0:00:34
408500 -- (-528.449) [-532.298] (-529.079) (-533.037) * [-528.229] (-528.459) (-527.568) (-528.813) -- 0:00:34
409000 -- [-530.118] (-528.848) (-529.789) (-533.552) * (-531.709) (-531.912) [-527.923] (-529.984) -- 0:00:34
409500 -- [-530.372] (-529.866) (-532.281) (-534.821) * (-529.550) [-527.854] (-529.777) (-530.541) -- 0:00:34
410000 -- (-527.598) [-528.044] (-533.397) (-531.649) * (-528.405) (-532.393) [-528.930] (-528.641) -- 0:00:34
Average standard deviation of split frequencies: 0.009107
410500 -- (-530.123) (-534.273) (-527.731) [-531.222] * (-528.095) [-529.495] (-528.245) (-529.212) -- 0:00:34
411000 -- (-527.842) (-531.066) (-529.171) [-529.552] * (-527.733) (-527.249) (-531.378) [-526.962] -- 0:00:34
411500 -- (-529.482) [-529.059] (-532.923) (-529.374) * (-529.451) (-527.588) [-528.898] (-532.060) -- 0:00:34
412000 -- (-530.806) (-533.335) (-531.600) [-528.542] * [-529.749] (-527.516) (-530.494) (-528.185) -- 0:00:34
412500 -- (-529.208) [-531.133] (-527.235) (-529.009) * [-527.825] (-527.199) (-532.787) (-533.375) -- 0:00:34
413000 -- (-528.058) (-529.891) [-528.780] (-528.304) * [-529.040] (-530.703) (-530.116) (-528.203) -- 0:00:34
413500 -- [-527.997] (-529.289) (-527.811) (-532.337) * (-530.086) [-530.589] (-527.198) (-528.850) -- 0:00:34
414000 -- (-530.231) (-528.352) [-527.010] (-528.435) * (-529.450) (-527.635) (-530.454) [-527.759] -- 0:00:33
414500 -- (-530.795) (-529.545) (-527.230) [-531.404] * (-529.975) [-528.118] (-531.009) (-528.783) -- 0:00:33
415000 -- [-527.277] (-530.166) (-527.031) (-528.451) * (-529.766) (-528.318) [-531.489] (-528.208) -- 0:00:33
Average standard deviation of split frequencies: 0.008145
415500 -- (-528.495) (-531.037) (-531.694) [-528.267] * (-529.949) (-531.856) [-534.413] (-533.043) -- 0:00:33
416000 -- (-528.645) (-527.424) (-529.678) [-531.971] * [-529.516] (-529.751) (-529.787) (-529.485) -- 0:00:33
416500 -- (-533.306) (-528.665) [-530.940] (-527.846) * (-530.192) (-528.962) (-528.374) [-528.593] -- 0:00:33
417000 -- (-527.431) [-528.750] (-531.935) (-528.117) * (-531.420) (-527.824) (-532.381) [-527.688] -- 0:00:33
417500 -- (-527.832) (-528.062) [-531.771] (-529.573) * (-529.880) (-528.509) (-530.139) [-530.632] -- 0:00:33
418000 -- (-527.613) [-527.246] (-529.043) (-528.343) * (-528.906) (-527.148) (-529.066) [-530.416] -- 0:00:33
418500 -- (-529.034) (-527.873) (-528.501) [-527.860] * (-530.747) [-530.315] (-528.728) (-527.501) -- 0:00:33
419000 -- (-530.650) (-530.164) (-527.250) [-527.853] * (-528.236) (-530.933) (-534.433) [-529.306] -- 0:00:33
419500 -- (-531.823) (-529.260) (-528.421) [-527.576] * (-528.220) [-528.844] (-531.808) (-536.582) -- 0:00:33
420000 -- (-527.579) (-530.430) (-527.962) [-529.960] * (-528.142) [-527.703] (-529.032) (-532.985) -- 0:00:33
Average standard deviation of split frequencies: 0.008517
420500 -- (-527.927) [-527.562] (-530.068) (-528.634) * (-528.441) [-527.775] (-529.548) (-529.935) -- 0:00:33
421000 -- (-529.595) (-532.405) [-531.403] (-528.343) * (-529.424) (-528.370) [-527.663] (-533.146) -- 0:00:33
421500 -- (-528.068) (-527.936) [-531.439] (-527.710) * (-531.499) [-528.907] (-528.253) (-528.996) -- 0:00:34
422000 -- [-532.144] (-530.317) (-529.314) (-528.546) * [-527.534] (-531.238) (-529.982) (-529.663) -- 0:00:34
422500 -- (-528.776) (-530.214) [-531.785] (-527.814) * (-529.271) (-533.585) [-530.864] (-527.661) -- 0:00:34
423000 -- [-533.671] (-527.579) (-533.994) (-530.264) * [-530.867] (-531.014) (-528.006) (-528.672) -- 0:00:34
423500 -- (-531.976) (-529.413) (-529.345) [-527.208] * [-527.740] (-530.499) (-528.056) (-527.349) -- 0:00:34
424000 -- (-531.192) (-528.929) [-533.389] (-534.257) * (-529.338) [-532.412] (-532.212) (-529.624) -- 0:00:33
424500 -- (-529.616) (-528.634) (-528.583) [-535.458] * (-527.495) (-531.160) [-528.891] (-534.263) -- 0:00:33
425000 -- (-529.388) [-528.712] (-529.464) (-527.535) * (-531.826) [-531.818] (-528.467) (-532.395) -- 0:00:33
Average standard deviation of split frequencies: 0.008991
425500 -- (-528.498) [-527.577] (-529.682) (-528.112) * (-536.364) [-528.713] (-529.666) (-530.102) -- 0:00:33
426000 -- [-529.176] (-529.738) (-530.090) (-529.988) * (-531.583) (-534.456) [-528.844] (-529.209) -- 0:00:33
426500 -- (-532.031) [-527.473] (-527.762) (-529.288) * (-532.612) [-529.474] (-531.461) (-529.658) -- 0:00:33
427000 -- [-527.610] (-530.996) (-532.503) (-528.279) * (-529.323) (-533.902) (-531.043) [-527.886] -- 0:00:33
427500 -- (-528.321) (-529.581) [-528.277] (-529.369) * (-528.218) [-526.831] (-530.709) (-529.215) -- 0:00:33
428000 -- [-532.431] (-530.475) (-530.098) (-528.697) * [-527.751] (-528.486) (-532.405) (-530.376) -- 0:00:33
428500 -- [-530.951] (-530.104) (-531.716) (-527.904) * (-527.406) (-527.244) [-530.184] (-528.867) -- 0:00:33
429000 -- [-529.327] (-530.925) (-528.572) (-529.387) * (-529.458) (-531.280) (-527.853) [-528.560] -- 0:00:33
429500 -- [-526.842] (-529.307) (-528.979) (-529.558) * [-528.759] (-530.939) (-527.711) (-529.252) -- 0:00:33
430000 -- (-528.974) (-527.287) [-529.823] (-529.508) * (-529.056) (-530.325) [-529.986] (-527.136) -- 0:00:33
Average standard deviation of split frequencies: 0.008894
430500 -- (-529.224) (-528.252) [-528.348] (-528.703) * (-530.148) (-532.891) (-529.682) [-529.259] -- 0:00:33
431000 -- (-530.556) [-528.577] (-530.267) (-531.722) * (-527.764) (-529.777) [-530.195] (-529.627) -- 0:00:33
431500 -- (-531.196) (-529.468) [-528.586] (-530.154) * [-529.110] (-528.853) (-528.614) (-529.755) -- 0:00:32
432000 -- (-529.377) [-527.441] (-528.128) (-531.484) * [-528.837] (-528.813) (-532.726) (-528.288) -- 0:00:32
432500 -- [-527.755] (-529.682) (-528.917) (-527.690) * [-529.071] (-528.199) (-531.329) (-529.997) -- 0:00:32
433000 -- [-528.679] (-528.898) (-535.913) (-528.330) * (-528.397) (-529.909) (-531.003) [-528.414] -- 0:00:32
433500 -- (-529.381) (-529.443) [-527.686] (-529.192) * [-526.957] (-531.047) (-529.434) (-531.221) -- 0:00:32
434000 -- (-529.476) (-530.583) [-529.178] (-530.679) * [-531.289] (-527.923) (-528.479) (-528.333) -- 0:00:32
434500 -- (-530.308) (-530.086) (-533.079) [-528.435] * [-529.981] (-527.948) (-529.146) (-529.255) -- 0:00:32
435000 -- (-532.202) [-529.566] (-529.037) (-528.916) * (-527.552) [-528.571] (-530.120) (-537.051) -- 0:00:32
Average standard deviation of split frequencies: 0.007929
435500 -- (-527.588) [-527.745] (-528.315) (-528.261) * (-527.433) (-529.439) (-528.647) [-530.400] -- 0:00:32
436000 -- (-533.221) (-527.850) (-533.454) [-527.925] * (-528.181) (-529.845) (-527.822) [-529.321] -- 0:00:32
436500 -- (-531.356) (-528.835) [-528.906] (-527.169) * [-528.041] (-529.085) (-529.526) (-528.793) -- 0:00:32
437000 -- (-532.247) (-528.340) (-532.926) [-526.929] * (-531.242) (-529.514) (-527.389) [-527.848] -- 0:00:32
437500 -- (-531.670) (-527.718) [-526.881] (-527.225) * (-529.765) [-527.823] (-530.530) (-531.441) -- 0:00:32
438000 -- (-528.780) (-527.640) (-530.874) [-528.329] * (-527.265) (-533.987) [-527.379] (-527.846) -- 0:00:32
438500 -- (-528.296) (-529.323) (-529.607) [-527.551] * [-527.017] (-531.786) (-529.865) (-528.717) -- 0:00:33
439000 -- (-529.251) [-530.506] (-529.922) (-529.799) * [-527.504] (-531.933) (-530.060) (-527.711) -- 0:00:33
439500 -- (-528.142) (-531.482) (-528.487) [-530.160] * [-530.560] (-527.690) (-528.696) (-528.420) -- 0:00:33
440000 -- (-529.068) [-531.984] (-531.491) (-534.532) * (-528.029) (-528.106) (-529.433) [-529.859] -- 0:00:33
Average standard deviation of split frequencies: 0.008344
440500 -- [-528.698] (-528.035) (-529.788) (-531.308) * (-530.424) (-529.905) (-529.415) [-529.913] -- 0:00:33
441000 -- [-527.212] (-527.998) (-533.312) (-533.495) * (-529.780) [-529.844] (-531.479) (-528.806) -- 0:00:32
441500 -- (-527.637) [-529.120] (-527.745) (-527.779) * (-527.561) (-530.932) [-528.363] (-529.049) -- 0:00:32
442000 -- (-530.545) (-529.845) [-529.732] (-527.872) * (-530.034) [-530.337] (-528.437) (-528.600) -- 0:00:32
442500 -- (-529.437) (-533.802) [-527.750] (-529.509) * [-528.373] (-530.202) (-527.772) (-531.081) -- 0:00:32
443000 -- (-531.939) [-537.808] (-529.616) (-530.369) * [-529.067] (-529.626) (-527.365) (-531.401) -- 0:00:32
443500 -- (-527.779) [-530.055] (-530.222) (-528.189) * [-528.412] (-534.635) (-530.076) (-531.779) -- 0:00:32
444000 -- [-529.751] (-530.417) (-527.119) (-529.673) * [-527.578] (-530.413) (-531.125) (-530.825) -- 0:00:32
444500 -- (-528.946) (-530.693) (-531.163) [-529.805] * [-530.819] (-529.590) (-530.587) (-528.247) -- 0:00:32
445000 -- (-531.043) (-531.424) [-531.020] (-529.479) * (-528.933) (-528.415) (-529.479) [-528.323] -- 0:00:32
Average standard deviation of split frequencies: 0.009231
445500 -- (-529.105) [-528.089] (-527.895) (-531.655) * [-528.957] (-528.304) (-528.978) (-527.120) -- 0:00:32
446000 -- (-527.846) (-527.704) [-531.160] (-529.651) * (-529.113) (-529.650) [-529.296] (-527.749) -- 0:00:32
446500 -- (-529.792) (-531.062) [-528.261] (-528.639) * (-529.025) (-533.385) [-529.076] (-528.319) -- 0:00:32
447000 -- (-528.188) [-530.792] (-528.965) (-527.653) * (-531.070) (-530.529) (-528.337) [-528.718] -- 0:00:32
447500 -- (-527.949) (-528.640) (-527.687) [-528.667] * (-529.048) (-533.746) (-527.050) [-530.316] -- 0:00:32
448000 -- [-527.392] (-530.706) (-530.396) (-527.567) * [-527.210] (-529.347) (-528.771) (-534.222) -- 0:00:32
448500 -- (-530.929) (-532.961) [-529.722] (-528.807) * (-528.594) (-527.005) (-527.798) [-529.334] -- 0:00:31
449000 -- (-527.036) [-528.057] (-530.098) (-527.996) * (-530.417) [-528.970] (-527.885) (-531.548) -- 0:00:31
449500 -- [-527.444] (-529.837) (-529.573) (-528.948) * (-528.972) (-529.052) [-527.785] (-527.479) -- 0:00:31
450000 -- (-527.335) [-529.316] (-531.446) (-530.407) * (-533.127) (-529.439) [-528.209] (-528.146) -- 0:00:31
Average standard deviation of split frequencies: 0.008368
450500 -- [-528.212] (-527.595) (-531.107) (-527.176) * (-529.979) (-530.928) [-527.913] (-526.727) -- 0:00:31
451000 -- (-531.371) [-526.850] (-530.047) (-528.679) * (-531.847) (-531.607) (-532.462) [-531.784] -- 0:00:31
451500 -- (-530.694) [-528.755] (-530.619) (-530.333) * [-528.180] (-528.224) (-533.004) (-531.620) -- 0:00:31
452000 -- (-530.582) (-529.096) [-529.502] (-531.468) * [-528.276] (-529.090) (-529.022) (-528.998) -- 0:00:31
452500 -- (-531.629) (-530.904) [-528.160] (-529.686) * (-529.439) [-530.495] (-528.554) (-530.921) -- 0:00:31
453000 -- [-531.286] (-533.557) (-528.984) (-527.308) * (-528.021) (-529.044) [-530.157] (-528.804) -- 0:00:31
453500 -- [-528.128] (-527.393) (-530.982) (-527.549) * (-531.374) (-527.718) (-530.683) [-530.406] -- 0:00:31
454000 -- (-530.270) [-527.134] (-529.857) (-529.914) * (-530.904) (-529.971) (-528.825) [-527.563] -- 0:00:31
454500 -- (-528.984) [-527.835] (-528.978) (-529.052) * [-527.108] (-528.143) (-527.992) (-529.101) -- 0:00:31
455000 -- (-527.978) (-527.741) [-528.462] (-530.783) * (-528.624) (-529.404) (-527.200) [-527.959] -- 0:00:31
Average standard deviation of split frequencies: 0.008723
455500 -- (-527.604) [-527.399] (-531.467) (-530.748) * (-528.099) [-529.505] (-528.210) (-528.032) -- 0:00:32
456000 -- [-527.487] (-533.245) (-531.081) (-532.106) * [-527.517] (-528.518) (-532.786) (-531.003) -- 0:00:32
456500 -- (-529.423) (-530.333) [-529.066] (-531.520) * (-527.762) [-529.414] (-529.910) (-531.080) -- 0:00:32
457000 -- (-527.588) (-531.014) (-530.922) [-528.691] * (-529.452) [-528.198] (-528.531) (-528.930) -- 0:00:32
457500 -- (-528.134) (-529.667) (-527.630) [-528.352] * (-532.955) (-528.742) (-528.925) [-529.614] -- 0:00:32
458000 -- [-528.250] (-529.419) (-527.863) (-530.126) * (-531.333) [-530.880] (-528.057) (-528.123) -- 0:00:31
458500 -- (-529.373) (-529.178) [-528.780] (-532.360) * [-529.670] (-528.821) (-527.993) (-528.770) -- 0:00:31
459000 -- (-529.625) [-530.071] (-531.134) (-531.405) * (-528.361) [-528.744] (-528.092) (-528.835) -- 0:00:31
459500 -- (-533.479) (-529.497) [-528.191] (-527.394) * (-528.906) [-529.529] (-531.677) (-528.895) -- 0:00:31
460000 -- (-529.479) (-527.434) [-527.954] (-528.387) * (-527.573) [-527.340] (-529.518) (-527.372) -- 0:00:31
Average standard deviation of split frequencies: 0.008323
460500 -- (-531.117) (-530.419) [-527.535] (-529.501) * [-529.502] (-528.085) (-533.770) (-527.921) -- 0:00:31
461000 -- (-530.200) (-532.008) [-527.934] (-527.204) * (-530.363) [-528.169] (-530.918) (-527.678) -- 0:00:31
461500 -- (-530.468) (-533.840) [-528.370] (-527.695) * (-529.884) (-528.719) (-529.407) [-528.718] -- 0:00:31
462000 -- (-530.824) (-529.743) (-531.044) [-527.210] * [-531.416] (-527.947) (-528.830) (-528.404) -- 0:00:31
462500 -- (-529.458) (-527.350) (-535.570) [-528.885] * (-531.153) (-530.259) [-527.809] (-528.434) -- 0:00:31
463000 -- [-529.313] (-528.658) (-529.835) (-529.333) * (-528.149) (-531.809) (-528.636) [-529.681] -- 0:00:31
463500 -- (-527.751) [-527.380] (-530.036) (-527.870) * (-528.180) [-528.972] (-530.191) (-531.597) -- 0:00:31
464000 -- (-529.421) (-530.855) [-527.487] (-530.365) * (-528.642) (-528.999) [-530.397] (-536.585) -- 0:00:31
464500 -- (-529.617) (-528.249) (-527.544) [-528.022] * (-528.701) (-528.133) [-528.313] (-529.026) -- 0:00:31
465000 -- (-528.720) (-531.398) (-529.249) [-529.223] * (-528.030) [-527.569] (-531.156) (-531.850) -- 0:00:31
Average standard deviation of split frequencies: 0.008662
465500 -- [-527.724] (-529.339) (-527.792) (-530.707) * (-528.330) (-529.991) [-529.412] (-530.540) -- 0:00:31
466000 -- (-528.547) (-531.476) [-528.127] (-527.923) * (-527.297) (-529.628) (-527.425) [-534.264] -- 0:00:30
466500 -- (-527.790) (-531.641) (-531.484) [-528.892] * (-527.669) (-528.718) [-535.885] (-532.201) -- 0:00:30
467000 -- (-530.434) (-529.520) [-527.377] (-531.348) * [-527.344] (-528.971) (-529.783) (-528.303) -- 0:00:30
467500 -- (-527.500) [-531.140] (-528.281) (-530.693) * (-528.985) (-529.009) [-528.105] (-529.441) -- 0:00:30
468000 -- (-528.467) (-528.894) (-529.031) [-527.114] * (-529.537) [-527.258] (-530.146) (-533.649) -- 0:00:30
468500 -- (-531.373) (-528.129) (-532.196) [-529.003] * (-529.251) [-527.940] (-530.198) (-531.624) -- 0:00:30
469000 -- (-530.233) [-528.575] (-529.414) (-527.587) * [-528.693] (-530.685) (-529.192) (-531.069) -- 0:00:30
469500 -- (-529.584) (-528.267) (-527.782) [-530.076] * (-527.562) (-530.887) (-529.801) [-530.786] -- 0:00:30
470000 -- [-531.382] (-528.693) (-529.684) (-528.099) * (-528.018) (-528.703) (-529.370) [-529.975] -- 0:00:30
Average standard deviation of split frequencies: 0.009265
470500 -- [-529.023] (-529.482) (-528.411) (-531.465) * (-530.065) [-527.544] (-528.556) (-528.006) -- 0:00:30
471000 -- [-527.646] (-531.036) (-528.738) (-532.969) * (-531.005) [-527.538] (-529.321) (-529.871) -- 0:00:30
471500 -- (-527.958) (-532.240) [-528.734] (-532.244) * (-529.610) (-529.031) (-527.828) [-530.761] -- 0:00:30
472000 -- [-528.082] (-532.674) (-530.735) (-530.641) * (-529.434) (-529.861) [-531.587] (-527.898) -- 0:00:31
472500 -- (-529.827) (-531.282) [-528.906] (-533.107) * (-532.283) (-527.775) (-529.047) [-527.447] -- 0:00:31
473000 -- [-533.084] (-532.918) (-530.014) (-528.473) * (-529.712) [-531.352] (-529.076) (-528.866) -- 0:00:31
473500 -- (-531.265) (-531.677) [-530.322] (-535.931) * (-528.544) [-528.326] (-530.129) (-529.335) -- 0:00:31
474000 -- (-528.332) (-529.763) [-529.978] (-529.611) * (-528.187) (-531.487) (-530.009) [-529.812] -- 0:00:31
474500 -- (-528.383) (-530.479) [-529.146] (-527.371) * (-530.676) (-529.891) [-529.157] (-528.966) -- 0:00:31
475000 -- (-527.596) (-532.959) [-527.333] (-533.794) * [-529.317] (-529.608) (-528.878) (-531.972) -- 0:00:30
Average standard deviation of split frequencies: 0.010089
475500 -- (-527.656) [-529.182] (-527.679) (-528.287) * [-529.665] (-530.285) (-529.246) (-536.233) -- 0:00:30
476000 -- [-528.025] (-530.681) (-528.797) (-527.807) * (-529.698) (-527.014) [-528.978] (-527.054) -- 0:00:30
476500 -- (-528.674) [-528.427] (-529.719) (-529.975) * [-528.767] (-527.265) (-532.727) (-527.020) -- 0:00:30
477000 -- (-529.186) (-528.619) [-527.845] (-528.150) * (-529.982) (-532.091) (-530.560) [-528.640] -- 0:00:30
477500 -- [-528.283] (-526.921) (-530.305) (-528.804) * (-528.133) (-529.991) [-528.753] (-527.667) -- 0:00:30
478000 -- (-528.126) [-528.269] (-528.672) (-528.829) * (-530.302) (-528.138) (-529.219) [-528.189] -- 0:00:30
478500 -- (-531.043) (-529.837) [-528.690] (-532.170) * [-528.655] (-528.118) (-533.670) (-530.599) -- 0:00:30
479000 -- (-529.790) (-529.407) (-527.874) [-529.471] * [-528.386] (-527.294) (-529.049) (-530.868) -- 0:00:30
479500 -- (-528.319) (-527.152) (-528.975) [-530.279] * (-527.746) [-528.113] (-530.901) (-531.759) -- 0:00:30
480000 -- (-530.983) [-527.194] (-532.584) (-530.601) * (-528.906) (-527.476) (-528.300) [-527.668] -- 0:00:30
Average standard deviation of split frequencies: 0.010134
480500 -- (-530.218) (-532.259) (-530.099) [-528.585] * (-528.130) [-527.559] (-528.663) (-527.710) -- 0:00:30
481000 -- [-531.661] (-532.413) (-533.007) (-529.005) * [-527.623] (-529.923) (-529.696) (-527.951) -- 0:00:30
481500 -- (-534.174) [-527.881] (-528.115) (-531.360) * (-527.973) (-529.817) (-529.634) [-529.309] -- 0:00:30
482000 -- (-529.800) (-528.646) (-529.447) [-529.527] * [-528.871] (-530.791) (-530.622) (-526.966) -- 0:00:30
482500 -- (-533.430) (-531.792) (-531.790) [-528.588] * (-527.876) (-529.961) (-532.541) [-526.966] -- 0:00:30
483000 -- (-529.512) (-529.241) (-530.648) [-529.630] * [-528.309] (-527.773) (-529.040) (-530.198) -- 0:00:29
483500 -- [-526.839] (-527.814) (-528.895) (-528.351) * [-528.208] (-529.847) (-527.448) (-530.179) -- 0:00:29
484000 -- (-530.542) (-530.014) [-530.989] (-529.653) * [-529.650] (-530.814) (-529.784) (-526.966) -- 0:00:29
484500 -- (-530.014) [-530.968] (-531.231) (-529.749) * (-528.860) (-528.947) [-528.515] (-526.957) -- 0:00:29
485000 -- [-532.902] (-528.623) (-527.408) (-529.268) * [-528.430] (-532.084) (-531.601) (-527.997) -- 0:00:29
Average standard deviation of split frequencies: 0.010799
485500 -- (-529.606) [-529.875] (-528.431) (-530.623) * (-532.361) (-532.921) [-528.509] (-528.777) -- 0:00:29
486000 -- (-535.233) (-534.952) (-531.713) [-527.827] * (-538.189) (-531.508) (-530.874) [-528.310] -- 0:00:29
486500 -- [-531.352] (-528.069) (-530.302) (-527.594) * (-533.952) [-529.601] (-528.289) (-528.844) -- 0:00:29
487000 -- (-528.435) [-528.448] (-530.095) (-529.636) * (-529.399) (-529.654) [-528.961] (-529.216) -- 0:00:29
487500 -- (-528.370) (-532.229) [-532.390] (-529.481) * [-531.753] (-529.889) (-529.804) (-531.124) -- 0:00:29
488000 -- (-528.774) (-529.251) [-531.496] (-529.500) * [-529.999] (-533.618) (-529.633) (-530.145) -- 0:00:29
488500 -- (-528.703) (-529.727) (-528.283) [-527.332] * (-535.148) [-530.639] (-529.324) (-532.708) -- 0:00:29
489000 -- [-528.802] (-533.405) (-528.696) (-529.125) * (-526.949) [-528.680] (-528.605) (-529.459) -- 0:00:29
489500 -- (-528.450) (-530.270) (-528.326) [-527.904] * (-527.791) [-527.989] (-526.962) (-528.981) -- 0:00:30
490000 -- (-528.475) [-530.355] (-530.661) (-529.413) * (-529.875) (-528.443) (-532.126) [-530.716] -- 0:00:30
Average standard deviation of split frequencies: 0.011209
490500 -- (-528.931) (-530.513) (-528.785) [-532.481] * (-532.668) (-530.125) (-531.192) [-531.991] -- 0:00:30
491000 -- (-529.607) (-529.225) [-528.011] (-530.030) * (-529.704) [-528.891] (-532.072) (-528.058) -- 0:00:30
491500 -- [-527.115] (-530.710) (-529.730) (-527.328) * (-529.481) (-530.238) [-528.020] (-529.877) -- 0:00:30
492000 -- (-530.328) (-529.117) [-527.867] (-528.425) * (-533.582) [-529.460] (-529.210) (-527.710) -- 0:00:29
492500 -- [-527.424] (-528.297) (-527.476) (-529.221) * (-529.556) (-528.672) (-532.297) [-530.752] -- 0:00:29
493000 -- (-527.154) (-528.023) [-529.742] (-534.467) * [-529.891] (-528.129) (-529.571) (-535.325) -- 0:00:29
493500 -- (-528.275) (-527.951) [-528.466] (-534.185) * (-529.423) [-527.944] (-529.553) (-532.109) -- 0:00:29
494000 -- (-529.250) [-527.917] (-528.471) (-530.853) * (-527.296) [-528.668] (-527.500) (-528.568) -- 0:00:29
494500 -- (-528.754) (-528.385) [-528.125] (-529.939) * (-530.932) (-527.747) (-532.596) [-527.183] -- 0:00:29
495000 -- [-529.501] (-529.812) (-528.555) (-529.522) * [-529.650] (-530.273) (-530.296) (-529.633) -- 0:00:29
Average standard deviation of split frequencies: 0.011025
495500 -- (-530.235) (-527.166) (-528.745) [-527.587] * [-527.162] (-529.699) (-529.716) (-529.133) -- 0:00:29
496000 -- (-534.625) [-527.028] (-528.647) (-531.434) * (-527.835) (-529.880) [-529.062] (-527.904) -- 0:00:29
496500 -- (-539.061) (-529.626) [-527.733] (-535.385) * [-528.442] (-531.529) (-531.978) (-527.591) -- 0:00:29
497000 -- (-529.883) [-528.673] (-529.765) (-530.732) * (-528.730) (-532.278) (-530.767) [-527.006] -- 0:00:29
497500 -- (-528.618) (-532.250) [-528.959] (-534.576) * (-532.691) [-528.855] (-531.654) (-530.446) -- 0:00:29
498000 -- (-531.349) (-532.118) [-529.063] (-527.300) * (-532.425) [-527.647] (-533.674) (-531.379) -- 0:00:29
498500 -- (-530.694) (-527.156) (-529.855) [-532.219] * (-530.220) (-531.986) (-528.800) [-532.088] -- 0:00:29
499000 -- (-528.420) (-531.003) (-529.330) [-531.101] * [-527.489] (-529.386) (-528.096) (-530.138) -- 0:00:29
499500 -- [-529.275] (-529.393) (-532.081) (-530.627) * [-531.694] (-528.637) (-531.092) (-530.540) -- 0:00:29
500000 -- (-527.472) [-527.744] (-532.683) (-529.083) * (-536.200) (-529.507) (-529.090) [-528.502] -- 0:00:29
Average standard deviation of split frequencies: 0.011361
500500 -- (-529.332) (-531.062) (-533.736) [-528.017] * (-529.063) (-534.403) [-528.334] (-530.110) -- 0:00:28
501000 -- (-533.068) (-529.106) [-530.167] (-526.918) * (-531.420) [-529.453] (-527.318) (-529.591) -- 0:00:28
501500 -- (-532.633) (-530.107) (-530.897) [-527.026] * (-532.056) (-528.293) (-528.935) [-529.243] -- 0:00:28
502000 -- (-527.848) (-531.121) (-529.327) [-528.873] * (-530.058) [-529.027] (-527.854) (-528.045) -- 0:00:28
502500 -- (-527.944) (-529.695) (-530.884) [-528.137] * (-528.554) (-530.408) (-528.487) [-527.342] -- 0:00:28
503000 -- [-529.338] (-527.503) (-527.285) (-527.257) * (-528.315) (-527.154) (-528.124) [-530.267] -- 0:00:28
503500 -- (-533.539) (-528.864) [-532.513] (-529.004) * (-528.315) (-529.537) (-533.194) [-530.499] -- 0:00:28
504000 -- (-528.773) (-527.602) (-532.070) [-530.299] * (-528.161) (-531.333) (-528.825) [-527.951] -- 0:00:28
504500 -- (-527.963) (-529.667) [-527.031] (-528.918) * (-529.329) (-531.983) (-529.865) [-528.708] -- 0:00:28
505000 -- (-528.968) (-530.221) [-528.522] (-528.093) * (-529.384) [-531.575] (-527.179) (-528.971) -- 0:00:28
Average standard deviation of split frequencies: 0.011704
505500 -- (-527.282) (-528.134) (-528.282) [-528.238] * (-533.985) [-529.553] (-527.307) (-528.510) -- 0:00:28
506000 -- [-528.456] (-530.528) (-530.721) (-532.267) * (-528.078) (-529.014) (-527.417) [-530.090] -- 0:00:28
506500 -- (-527.419) (-529.986) (-527.197) [-529.597] * (-530.398) (-530.917) (-527.935) [-529.485] -- 0:00:29
507000 -- (-527.039) [-530.520] (-529.666) (-529.551) * (-528.530) [-528.955] (-528.986) (-528.193) -- 0:00:29
507500 -- (-528.395) [-531.658] (-532.541) (-531.125) * [-529.215] (-526.878) (-528.647) (-533.075) -- 0:00:29
508000 -- (-529.801) (-528.874) [-530.674] (-532.069) * [-528.290] (-526.945) (-530.765) (-529.654) -- 0:00:29
508500 -- (-529.638) (-530.340) [-529.266] (-528.149) * (-528.685) (-530.474) [-529.817] (-528.046) -- 0:00:28
509000 -- (-529.097) (-527.265) [-530.058] (-532.444) * (-531.704) (-527.482) (-527.594) [-530.149] -- 0:00:28
509500 -- (-528.306) (-531.104) (-531.417) [-528.727] * (-528.911) (-528.387) (-529.010) [-529.407] -- 0:00:28
510000 -- (-526.765) (-528.664) [-529.174] (-527.368) * (-529.408) (-528.123) [-528.879] (-533.765) -- 0:00:28
Average standard deviation of split frequencies: 0.011250
510500 -- (-527.391) [-527.697] (-530.991) (-528.791) * (-529.402) (-529.260) (-529.366) [-529.666] -- 0:00:28
511000 -- (-528.335) (-527.776) (-531.535) [-530.088] * [-530.923] (-531.492) (-528.254) (-530.322) -- 0:00:28
511500 -- [-527.496] (-527.359) (-532.342) (-528.842) * (-530.212) [-529.891] (-531.026) (-529.174) -- 0:00:28
512000 -- [-530.359] (-529.608) (-527.118) (-529.081) * (-530.234) [-532.338] (-533.018) (-527.818) -- 0:00:28
512500 -- (-529.014) (-528.403) (-533.272) [-527.932] * (-530.528) (-530.201) (-528.251) [-528.873] -- 0:00:28
513000 -- [-529.472] (-527.380) (-527.741) (-530.759) * (-530.827) (-528.077) (-531.042) [-527.546] -- 0:00:28
513500 -- [-527.229] (-529.319) (-527.284) (-529.501) * [-531.506] (-532.772) (-528.955) (-528.573) -- 0:00:28
514000 -- (-528.501) (-530.531) (-528.015) [-529.717] * (-528.812) [-529.005] (-532.898) (-528.057) -- 0:00:28
514500 -- (-528.960) (-530.993) [-531.527] (-530.637) * [-531.536] (-530.337) (-532.902) (-527.731) -- 0:00:28
515000 -- (-528.695) [-527.854] (-530.763) (-533.367) * (-529.665) (-529.411) [-528.110] (-528.902) -- 0:00:28
Average standard deviation of split frequencies: 0.011191
515500 -- (-530.086) (-531.028) (-534.594) [-530.696] * (-528.267) (-528.305) (-527.589) [-530.794] -- 0:00:28
516000 -- (-531.661) (-531.463) [-530.989] (-535.515) * (-528.361) (-529.867) [-527.220] (-532.152) -- 0:00:28
516500 -- [-529.177] (-527.703) (-531.005) (-528.501) * [-528.133] (-528.105) (-532.946) (-529.778) -- 0:00:28
517000 -- [-528.789] (-528.821) (-528.635) (-529.208) * (-528.412) [-529.193] (-531.930) (-529.754) -- 0:00:28
517500 -- [-528.154] (-528.957) (-530.368) (-529.003) * [-528.353] (-532.683) (-530.852) (-526.804) -- 0:00:27
518000 -- [-531.839] (-529.829) (-529.639) (-536.211) * (-528.065) (-530.729) [-527.672] (-533.696) -- 0:00:27
518500 -- (-528.662) [-529.855] (-528.539) (-528.383) * [-530.351] (-532.275) (-527.371) (-532.159) -- 0:00:27
519000 -- [-529.436] (-531.424) (-533.925) (-528.748) * (-528.339) (-530.113) [-528.522] (-533.649) -- 0:00:27
519500 -- (-527.174) (-527.678) (-530.646) [-530.376] * (-530.913) (-528.533) [-527.587] (-529.558) -- 0:00:27
520000 -- (-530.263) (-529.312) (-532.976) [-527.822] * (-530.922) [-528.474] (-528.561) (-530.527) -- 0:00:27
Average standard deviation of split frequencies: 0.011091
520500 -- (-531.999) [-527.669] (-528.782) (-530.316) * (-527.530) (-531.968) [-527.661] (-529.157) -- 0:00:27
521000 -- [-528.506] (-529.186) (-530.182) (-533.075) * (-527.695) [-529.918] (-531.455) (-528.453) -- 0:00:27
521500 -- (-528.048) [-530.256] (-528.919) (-529.943) * [-528.278] (-529.146) (-528.473) (-533.781) -- 0:00:27
522000 -- [-533.219] (-527.969) (-530.358) (-528.993) * (-528.326) [-527.238] (-527.488) (-529.564) -- 0:00:27
522500 -- (-534.593) (-529.768) (-527.720) [-529.707] * (-528.913) [-527.464] (-528.372) (-528.516) -- 0:00:27
523000 -- [-531.976] (-529.069) (-527.695) (-528.150) * (-527.781) [-526.999] (-530.098) (-530.812) -- 0:00:27
523500 -- (-529.011) (-531.515) (-529.142) [-528.678] * (-527.557) (-529.851) (-533.140) [-530.187] -- 0:00:28
524000 -- (-528.360) (-528.690) [-528.695] (-529.007) * (-528.795) [-527.195] (-529.835) (-538.570) -- 0:00:28
524500 -- (-528.018) [-527.480] (-530.485) (-529.201) * (-530.165) (-527.631) (-530.636) [-529.418] -- 0:00:28
525000 -- (-529.153) (-528.717) (-528.659) [-530.163] * [-527.397] (-529.989) (-528.877) (-527.320) -- 0:00:28
Average standard deviation of split frequencies: 0.010362
525500 -- [-529.658] (-528.213) (-528.791) (-528.319) * (-528.867) (-530.705) [-528.559] (-529.218) -- 0:00:27
526000 -- (-528.213) [-528.773] (-528.142) (-529.565) * (-528.017) (-532.098) (-530.888) [-529.947] -- 0:00:27
526500 -- [-528.807] (-534.066) (-526.768) (-529.756) * (-528.011) [-529.118] (-527.901) (-528.265) -- 0:00:27
527000 -- (-528.929) (-532.091) (-529.252) [-529.665] * [-527.897] (-528.136) (-528.995) (-529.745) -- 0:00:27
527500 -- (-535.129) [-531.013] (-528.208) (-528.453) * (-530.688) (-530.084) [-529.478] (-530.773) -- 0:00:27
528000 -- (-529.094) (-533.501) (-531.548) [-528.265] * [-527.073] (-531.659) (-527.483) (-531.011) -- 0:00:27
528500 -- [-532.025] (-533.252) (-534.427) (-527.921) * (-527.768) (-527.737) (-529.106) [-527.715] -- 0:00:27
529000 -- (-530.573) (-532.199) (-529.125) [-529.042] * (-527.845) [-530.251] (-530.130) (-531.029) -- 0:00:27
529500 -- (-531.304) (-528.989) [-528.326] (-529.450) * [-528.986] (-530.189) (-531.228) (-532.434) -- 0:00:27
530000 -- (-528.776) [-528.696] (-528.694) (-530.800) * [-527.654] (-528.628) (-529.796) (-527.073) -- 0:00:27
Average standard deviation of split frequencies: 0.010105
530500 -- (-530.084) (-529.394) (-529.054) [-530.814] * (-528.479) (-532.377) (-528.213) [-530.463] -- 0:00:27
531000 -- (-527.569) (-529.982) (-529.262) [-528.261] * (-528.613) (-530.532) [-528.477] (-529.531) -- 0:00:27
531500 -- (-531.309) (-531.072) [-532.032] (-530.341) * [-528.617] (-532.394) (-527.214) (-532.562) -- 0:00:27
532000 -- (-529.567) (-529.125) (-531.837) [-527.831] * (-528.494) (-531.569) (-527.835) [-527.165] -- 0:00:27
532500 -- (-530.214) [-531.495] (-529.522) (-528.175) * (-527.743) (-531.460) [-530.150] (-530.554) -- 0:00:27
533000 -- (-530.440) (-537.160) (-530.782) [-528.542] * (-530.991) [-528.050] (-531.131) (-528.717) -- 0:00:27
533500 -- (-528.453) [-529.016] (-530.285) (-527.915) * (-529.351) (-529.375) (-531.582) [-530.673] -- 0:00:27
534000 -- (-528.937) (-529.021) [-530.693] (-528.779) * (-531.190) (-530.591) [-528.459] (-529.417) -- 0:00:27
534500 -- (-530.896) (-530.247) (-529.901) [-530.639] * (-528.027) (-531.410) (-527.753) [-528.183] -- 0:00:26
535000 -- (-528.909) [-527.427] (-528.629) (-534.387) * (-529.123) [-527.089] (-530.541) (-531.323) -- 0:00:26
Average standard deviation of split frequencies: 0.009290
535500 -- (-529.269) [-529.380] (-528.898) (-528.482) * [-528.411] (-528.275) (-530.061) (-528.758) -- 0:00:26
536000 -- (-527.746) (-528.641) (-528.623) [-530.409] * (-528.607) (-531.989) [-531.243] (-529.447) -- 0:00:26
536500 -- (-527.745) (-531.882) [-527.908] (-529.195) * [-527.833] (-527.280) (-529.861) (-527.606) -- 0:00:26
537000 -- (-527.359) [-531.109] (-531.197) (-527.418) * [-528.597] (-532.185) (-533.828) (-529.178) -- 0:00:26
537500 -- [-528.208] (-532.444) (-528.434) (-527.291) * [-530.168] (-531.359) (-528.538) (-528.603) -- 0:00:26
538000 -- (-528.105) (-527.243) (-528.617) [-527.139] * (-529.697) [-529.076] (-528.507) (-528.469) -- 0:00:26
538500 -- (-529.269) [-529.020] (-530.289) (-528.805) * (-530.768) (-528.938) (-527.226) [-527.424] -- 0:00:26
539000 -- (-529.379) (-531.112) [-529.267] (-529.826) * (-527.683) [-530.525] (-528.397) (-528.393) -- 0:00:26
539500 -- [-531.274] (-528.666) (-528.414) (-528.560) * (-528.639) [-530.088] (-530.243) (-529.711) -- 0:00:26
540000 -- [-528.526] (-530.798) (-527.809) (-528.601) * (-529.365) (-533.496) [-529.742] (-530.797) -- 0:00:27
Average standard deviation of split frequencies: 0.009591
540500 -- (-530.374) (-527.271) [-528.131] (-532.003) * (-531.533) [-527.733] (-528.793) (-531.304) -- 0:00:27
541000 -- (-533.254) (-528.021) [-527.283] (-528.985) * (-526.686) (-528.194) (-529.647) [-531.562] -- 0:00:27
541500 -- (-532.537) (-535.314) [-527.331] (-533.943) * (-528.698) (-528.037) (-528.859) [-528.263] -- 0:00:27
542000 -- [-532.983] (-532.773) (-527.724) (-530.948) * [-527.989] (-529.668) (-529.324) (-529.227) -- 0:00:27
542500 -- (-529.934) [-528.160] (-528.428) (-531.606) * (-526.976) (-528.632) [-528.910] (-529.886) -- 0:00:26
543000 -- (-529.975) (-531.714) [-527.561] (-530.287) * (-528.932) (-529.485) [-529.174] (-531.186) -- 0:00:26
543500 -- (-530.046) [-528.763] (-529.050) (-528.236) * (-529.688) (-531.345) [-528.872] (-530.364) -- 0:00:26
544000 -- [-535.208] (-532.323) (-527.457) (-528.703) * (-528.719) (-527.295) [-530.460] (-528.354) -- 0:00:26
544500 -- (-535.262) (-529.969) [-527.580] (-528.441) * (-527.593) (-527.958) (-528.254) [-528.159] -- 0:00:26
545000 -- (-527.807) (-532.561) [-529.291] (-527.504) * (-529.398) [-531.761] (-527.166) (-531.166) -- 0:00:26
Average standard deviation of split frequencies: 0.009605
545500 -- (-532.542) (-530.168) [-532.120] (-531.321) * (-527.855) (-528.798) [-529.738] (-532.256) -- 0:00:26
546000 -- (-527.648) (-529.836) (-527.507) [-529.947] * (-529.576) (-531.369) [-530.453] (-530.724) -- 0:00:26
546500 -- (-533.744) [-529.940] (-530.148) (-530.237) * (-528.723) (-529.554) [-528.939] (-530.450) -- 0:00:26
547000 -- (-528.742) [-529.257] (-528.690) (-529.671) * (-529.191) (-527.739) (-530.665) [-528.224] -- 0:00:26
547500 -- (-529.913) (-531.380) [-531.656] (-528.783) * (-527.526) [-528.316] (-528.644) (-532.922) -- 0:00:26
548000 -- (-529.789) (-529.275) [-528.722] (-529.140) * (-529.794) [-528.296] (-528.391) (-528.754) -- 0:00:26
548500 -- (-530.129) (-527.764) (-528.344) [-527.553] * (-529.667) [-528.551] (-529.138) (-529.481) -- 0:00:26
549000 -- (-532.339) (-527.929) (-527.362) [-532.161] * (-529.540) (-527.927) [-527.725] (-528.538) -- 0:00:26
549500 -- [-530.376] (-528.270) (-527.594) (-528.447) * (-529.025) (-528.777) (-527.091) [-527.919] -- 0:00:26
550000 -- [-530.381] (-529.213) (-528.054) (-530.802) * (-532.155) [-528.866] (-529.342) (-530.028) -- 0:00:26
Average standard deviation of split frequencies: 0.009149
550500 -- [-529.728] (-528.336) (-528.458) (-528.413) * (-530.587) (-527.296) [-530.063] (-527.383) -- 0:00:26
551000 -- (-529.138) [-528.345] (-532.079) (-529.559) * (-531.005) (-530.102) [-532.635] (-527.113) -- 0:00:26
551500 -- (-529.779) (-530.503) (-530.334) [-531.379] * (-531.593) (-533.075) (-528.845) [-527.866] -- 0:00:26
552000 -- [-530.021] (-530.763) (-528.644) (-532.100) * (-530.063) (-527.006) [-528.223] (-527.761) -- 0:00:25
552500 -- [-530.168] (-531.429) (-528.221) (-531.348) * (-532.420) (-534.001) [-528.821] (-529.641) -- 0:00:25
553000 -- [-527.291] (-528.815) (-529.028) (-529.861) * (-529.950) [-531.582] (-528.631) (-535.493) -- 0:00:25
553500 -- (-527.914) [-533.707] (-531.063) (-529.199) * (-532.884) (-529.629) (-529.971) [-529.078] -- 0:00:25
554000 -- [-529.270] (-529.270) (-529.358) (-529.200) * (-527.940) (-527.772) (-530.167) [-528.173] -- 0:00:25
554500 -- (-527.223) (-529.379) (-530.483) [-527.778] * (-528.454) (-530.731) (-529.330) [-528.749] -- 0:00:25
555000 -- (-528.750) (-533.376) (-529.886) [-527.240] * (-529.379) [-532.566] (-527.681) (-529.990) -- 0:00:25
Average standard deviation of split frequencies: 0.008849
555500 -- (-529.787) (-527.883) [-530.091] (-527.388) * [-528.410] (-533.180) (-527.306) (-530.007) -- 0:00:25
556000 -- [-531.377] (-528.834) (-528.399) (-527.884) * (-529.162) (-528.122) [-528.821] (-529.154) -- 0:00:25
556500 -- (-529.535) (-528.693) [-527.783] (-528.735) * (-527.969) (-530.664) (-527.777) [-528.318] -- 0:00:25
557000 -- [-530.433] (-527.646) (-528.426) (-536.519) * (-527.248) (-530.908) (-526.882) [-530.739] -- 0:00:26
557500 -- (-529.008) [-527.245] (-528.897) (-530.964) * (-527.612) [-527.463] (-528.141) (-527.931) -- 0:00:26
558000 -- (-528.838) (-529.171) [-527.779] (-531.147) * (-529.097) [-528.053] (-530.156) (-532.240) -- 0:00:26
558500 -- (-528.704) (-530.058) (-529.569) [-527.403] * (-529.648) (-529.808) [-528.957] (-527.816) -- 0:00:26
559000 -- (-532.899) [-529.321] (-529.803) (-527.839) * (-529.356) (-530.621) [-528.621] (-529.376) -- 0:00:26
559500 -- [-532.829] (-529.405) (-531.238) (-529.797) * [-527.095] (-528.030) (-531.356) (-528.661) -- 0:00:25
560000 -- [-528.980] (-529.363) (-528.068) (-527.851) * (-531.100) [-533.841] (-527.911) (-529.183) -- 0:00:25
Average standard deviation of split frequencies: 0.009564
560500 -- [-528.656] (-531.106) (-533.806) (-533.794) * (-532.971) (-534.928) (-528.791) [-527.408] -- 0:00:25
561000 -- [-531.078] (-528.955) (-529.589) (-532.854) * (-530.552) [-529.816] (-530.538) (-528.784) -- 0:00:25
561500 -- (-527.196) [-527.880] (-528.434) (-533.782) * (-531.487) (-530.156) [-530.184] (-527.893) -- 0:00:25
562000 -- (-528.058) [-527.624] (-528.688) (-528.826) * (-529.103) (-528.441) (-528.602) [-530.480] -- 0:00:25
562500 -- (-530.179) [-529.410] (-530.871) (-529.263) * [-530.155] (-531.003) (-527.878) (-529.243) -- 0:00:25
563000 -- [-528.860] (-528.835) (-527.728) (-532.501) * (-528.298) (-527.914) (-528.101) [-528.875] -- 0:00:25
563500 -- [-527.508] (-532.371) (-528.478) (-529.584) * (-529.579) (-529.834) (-529.346) [-530.073] -- 0:00:25
564000 -- (-527.188) [-531.128] (-528.258) (-529.517) * (-529.450) (-527.385) [-528.129] (-530.740) -- 0:00:25
564500 -- (-529.461) (-529.653) (-530.999) [-532.737] * [-528.917] (-527.599) (-528.514) (-531.837) -- 0:00:25
565000 -- (-529.422) (-530.042) (-527.103) [-528.025] * [-530.140] (-528.878) (-530.401) (-532.785) -- 0:00:25
Average standard deviation of split frequencies: 0.010141
565500 -- (-527.762) (-528.081) (-531.729) [-528.924] * (-533.563) [-529.069] (-527.654) (-528.684) -- 0:00:25
566000 -- [-528.251] (-528.068) (-530.303) (-531.365) * (-528.476) (-526.960) [-527.718] (-530.248) -- 0:00:25
566500 -- (-527.986) [-529.084] (-531.718) (-528.429) * (-529.931) [-528.169] (-527.912) (-531.536) -- 0:00:25
567000 -- [-528.051] (-527.298) (-530.089) (-531.489) * (-531.057) (-528.669) (-528.242) [-528.775] -- 0:00:25
567500 -- (-528.652) (-527.056) [-528.286] (-531.916) * [-529.676] (-529.784) (-527.140) (-528.158) -- 0:00:25
568000 -- (-530.047) [-526.950] (-528.163) (-530.753) * (-528.195) (-528.286) [-528.457] (-528.630) -- 0:00:25
568500 -- (-529.639) [-529.143] (-528.564) (-530.885) * (-528.103) [-528.984] (-529.572) (-529.161) -- 0:00:25
569000 -- [-528.901] (-528.388) (-531.072) (-528.642) * (-526.999) (-527.947) (-530.778) [-528.828] -- 0:00:24
569500 -- [-529.616] (-532.874) (-528.625) (-536.066) * (-529.254) (-528.205) (-530.740) [-529.432] -- 0:00:24
570000 -- (-529.120) [-527.965] (-531.496) (-531.407) * (-528.257) (-530.192) [-528.654] (-528.784) -- 0:00:24
Average standard deviation of split frequencies: 0.008829
570500 -- [-527.708] (-530.967) (-529.582) (-530.081) * (-530.035) [-528.246] (-532.016) (-528.567) -- 0:00:24
571000 -- [-528.402] (-529.719) (-528.781) (-527.736) * (-531.787) (-532.278) [-533.344] (-528.190) -- 0:00:24
571500 -- [-531.923] (-529.667) (-533.438) (-528.702) * (-527.404) [-527.099] (-533.359) (-529.434) -- 0:00:24
572000 -- (-528.169) (-528.750) (-528.632) [-528.639] * (-528.006) (-530.860) [-528.192] (-528.726) -- 0:00:24
572500 -- (-528.377) (-528.398) (-526.848) [-527.442] * [-528.111] (-528.485) (-536.030) (-529.650) -- 0:00:24
573000 -- (-528.548) (-529.664) (-527.753) [-528.132] * (-528.063) (-528.484) [-527.941] (-527.439) -- 0:00:24
573500 -- (-529.903) (-529.903) (-530.009) [-529.303] * (-529.504) (-527.853) [-528.028] (-528.026) -- 0:00:24
574000 -- [-529.426] (-528.456) (-528.801) (-528.872) * (-529.562) (-529.017) (-529.378) [-527.899] -- 0:00:25
574500 -- (-532.478) (-530.188) [-529.360] (-531.380) * [-528.024] (-529.317) (-533.136) (-529.233) -- 0:00:25
575000 -- (-529.398) (-531.398) [-528.792] (-527.743) * (-529.425) (-528.401) [-528.060] (-528.592) -- 0:00:25
Average standard deviation of split frequencies: 0.008714
575500 -- (-528.111) [-531.000] (-531.311) (-528.677) * (-529.311) (-532.118) (-529.650) [-527.269] -- 0:00:25
576000 -- (-529.779) [-528.757] (-528.921) (-527.574) * (-527.654) (-528.913) (-532.043) [-529.013] -- 0:00:25
576500 -- (-530.904) [-528.217] (-527.811) (-528.221) * (-530.781) (-529.820) [-531.662] (-527.256) -- 0:00:24
577000 -- (-535.921) (-531.000) [-527.562] (-530.944) * (-531.461) [-529.102] (-531.620) (-528.029) -- 0:00:24
577500 -- [-528.999] (-528.848) (-528.881) (-528.409) * (-529.393) (-528.060) [-528.068] (-528.643) -- 0:00:24
578000 -- (-527.704) [-528.478] (-528.724) (-528.256) * (-530.252) [-530.232] (-527.747) (-527.847) -- 0:00:24
578500 -- [-528.675] (-534.643) (-530.740) (-526.904) * (-531.936) (-530.769) (-528.663) [-528.417] -- 0:00:24
579000 -- (-529.381) (-529.670) [-529.583] (-527.426) * (-528.128) [-527.652] (-531.466) (-527.807) -- 0:00:24
579500 -- [-527.874] (-528.705) (-529.399) (-528.515) * (-530.196) [-528.417] (-531.442) (-528.365) -- 0:00:24
580000 -- (-528.765) [-528.315] (-529.499) (-528.303) * (-528.155) (-529.177) (-529.727) [-527.293] -- 0:00:24
Average standard deviation of split frequencies: 0.008357
580500 -- (-527.713) [-528.819] (-531.346) (-528.398) * (-529.488) (-531.807) [-532.831] (-530.624) -- 0:00:24
581000 -- (-529.546) (-529.033) [-528.258] (-528.533) * (-529.324) [-530.982] (-529.418) (-531.365) -- 0:00:24
581500 -- (-528.249) (-532.437) (-529.542) [-529.121] * (-528.383) (-530.766) (-527.828) [-528.571] -- 0:00:24
582000 -- (-532.359) (-529.060) (-529.654) [-528.648] * (-532.144) (-527.982) (-531.511) [-528.308] -- 0:00:24
582500 -- (-530.685) (-529.893) (-535.104) [-527.455] * [-529.896] (-527.654) (-533.491) (-529.791) -- 0:00:24
583000 -- (-531.625) (-529.050) (-527.897) [-528.347] * [-530.446] (-527.351) (-529.410) (-527.821) -- 0:00:24
583500 -- (-529.905) (-527.584) [-528.918] (-527.513) * [-528.231] (-531.670) (-528.075) (-535.187) -- 0:00:24
584000 -- [-527.630] (-529.529) (-528.196) (-528.813) * (-528.102) (-529.584) [-531.012] (-534.242) -- 0:00:24
584500 -- (-530.157) [-532.721] (-527.312) (-530.532) * [-528.837] (-527.758) (-530.166) (-528.510) -- 0:00:24
585000 -- (-531.920) (-531.093) (-527.544) [-529.041] * (-528.444) (-527.559) (-529.879) [-528.509] -- 0:00:24
Average standard deviation of split frequencies: 0.008092
585500 -- (-527.687) [-528.266] (-529.100) (-529.942) * [-527.278] (-530.930) (-529.039) (-527.499) -- 0:00:24
586000 -- (-533.259) [-528.656] (-529.949) (-528.885) * [-527.598] (-527.211) (-528.205) (-527.554) -- 0:00:24
586500 -- (-534.166) (-527.178) (-530.636) [-529.571] * (-529.750) (-527.415) (-528.047) [-530.364] -- 0:00:23
587000 -- [-529.054] (-527.712) (-532.118) (-529.162) * [-530.416] (-528.383) (-527.406) (-529.547) -- 0:00:23
587500 -- (-532.678) (-528.953) (-529.359) [-532.078] * (-530.449) [-530.188] (-528.591) (-532.836) -- 0:00:23
588000 -- (-526.928) [-528.957] (-528.144) (-529.966) * (-530.893) [-528.957] (-527.737) (-528.120) -- 0:00:23
588500 -- (-529.144) (-527.862) [-533.102] (-527.895) * [-527.849] (-531.203) (-529.494) (-532.056) -- 0:00:23
589000 -- [-529.986] (-530.851) (-533.665) (-529.143) * (-528.261) [-529.343] (-529.642) (-530.371) -- 0:00:23
589500 -- (-528.834) (-530.688) (-529.919) [-529.501] * [-532.251] (-527.851) (-535.184) (-528.333) -- 0:00:23
590000 -- (-528.617) (-527.540) [-530.174] (-531.348) * (-530.531) [-528.639] (-528.333) (-527.475) -- 0:00:23
Average standard deviation of split frequencies: 0.008380
590500 -- (-530.245) (-527.675) [-528.742] (-529.290) * (-528.930) (-533.665) [-529.019] (-527.594) -- 0:00:23
591000 -- [-530.187] (-529.235) (-528.004) (-527.922) * [-527.575] (-529.700) (-531.071) (-531.706) -- 0:00:24
591500 -- (-531.099) (-527.192) (-529.131) [-530.118] * (-530.761) (-531.042) (-530.672) [-528.455] -- 0:00:24
592000 -- (-530.875) (-529.875) (-539.198) [-528.905] * [-528.892] (-529.918) (-530.804) (-528.277) -- 0:00:24
592500 -- [-529.077] (-533.263) (-533.073) (-529.068) * (-530.797) (-532.385) (-529.464) [-530.707] -- 0:00:24
593000 -- [-527.131] (-528.576) (-528.009) (-530.780) * (-531.496) (-528.661) (-527.463) [-529.802] -- 0:00:24
593500 -- (-531.274) (-529.524) [-529.194] (-532.658) * (-528.174) (-527.887) [-527.383] (-530.295) -- 0:00:23
594000 -- [-529.436] (-528.012) (-531.836) (-529.394) * (-527.525) (-532.635) (-529.491) [-532.741] -- 0:00:23
594500 -- (-534.051) [-529.659] (-528.439) (-529.165) * (-528.919) (-529.342) (-528.200) [-530.610] -- 0:00:23
595000 -- (-531.756) (-529.056) (-527.746) [-529.776] * (-534.262) (-528.910) (-528.515) [-532.109] -- 0:00:23
Average standard deviation of split frequencies: 0.007723
595500 -- (-527.869) [-530.729] (-529.292) (-528.327) * [-528.143] (-527.933) (-528.875) (-527.687) -- 0:00:23
596000 -- [-527.973] (-531.765) (-528.021) (-528.807) * (-531.597) [-528.301] (-529.005) (-529.925) -- 0:00:23
596500 -- (-531.532) [-529.007] (-530.968) (-528.747) * [-528.863] (-532.183) (-531.077) (-530.244) -- 0:00:23
597000 -- [-528.536] (-530.027) (-532.436) (-528.583) * (-529.928) (-529.036) [-533.074] (-528.479) -- 0:00:23
597500 -- (-532.173) [-533.432] (-528.969) (-531.125) * (-527.860) [-531.401] (-531.768) (-528.711) -- 0:00:23
598000 -- [-527.884] (-529.897) (-529.734) (-529.184) * [-528.563] (-530.132) (-534.129) (-530.317) -- 0:00:23
598500 -- (-531.753) (-530.391) (-530.856) [-528.084] * (-528.653) [-529.174] (-528.534) (-530.170) -- 0:00:23
599000 -- [-530.276] (-531.693) (-530.672) (-530.678) * (-534.142) (-530.521) [-529.672] (-527.464) -- 0:00:23
599500 -- (-529.628) (-531.159) (-537.736) [-530.427] * (-533.039) (-531.067) (-533.048) [-529.181] -- 0:00:23
600000 -- (-530.176) (-530.129) [-529.156] (-529.612) * (-528.409) (-527.614) [-530.269] (-538.067) -- 0:00:23
Average standard deviation of split frequencies: 0.007701
600500 -- (-530.464) (-533.093) (-528.309) [-527.459] * [-529.726] (-536.309) (-530.513) (-529.917) -- 0:00:23
601000 -- (-527.334) (-527.917) (-528.979) [-527.208] * (-529.342) (-536.784) [-527.990] (-535.193) -- 0:00:23
601500 -- [-527.091] (-529.492) (-529.425) (-529.227) * (-529.311) (-531.086) [-527.151] (-527.708) -- 0:00:23
602000 -- [-528.833] (-534.116) (-527.789) (-528.908) * (-529.487) (-528.463) [-527.750] (-528.392) -- 0:00:23
602500 -- (-528.573) (-531.025) [-527.338] (-527.905) * (-527.493) (-527.582) [-528.779] (-533.233) -- 0:00:23
603000 -- (-531.103) [-527.941] (-527.330) (-529.620) * (-529.137) (-527.287) (-528.394) [-533.100] -- 0:00:23
603500 -- (-530.202) (-529.977) (-528.498) [-530.186] * (-532.520) (-532.566) (-529.031) [-533.357] -- 0:00:22
604000 -- (-527.864) [-527.783] (-529.434) (-528.782) * (-529.749) (-529.615) (-526.861) [-532.421] -- 0:00:22
604500 -- (-532.180) (-529.254) [-530.229] (-529.153) * (-531.014) (-528.749) (-527.635) [-527.537] -- 0:00:22
605000 -- (-531.717) (-530.354) (-528.760) [-528.291] * (-528.539) [-528.003] (-528.223) (-528.989) -- 0:00:22
Average standard deviation of split frequencies: 0.007487
605500 -- (-528.873) (-533.525) (-528.570) [-530.000] * (-527.754) [-531.250] (-528.404) (-527.472) -- 0:00:22
606000 -- (-530.245) (-528.179) (-528.267) [-529.278] * (-530.831) (-528.094) [-527.474] (-531.464) -- 0:00:22
606500 -- (-529.009) [-530.097] (-527.413) (-529.410) * (-530.352) (-530.027) [-531.306] (-528.761) -- 0:00:22
607000 -- [-530.857] (-530.548) (-532.728) (-530.412) * (-532.207) [-530.064] (-530.724) (-532.368) -- 0:00:22
607500 -- (-529.357) [-529.314] (-529.256) (-529.997) * (-529.990) (-527.850) (-527.664) [-532.576] -- 0:00:22
608000 -- [-528.456] (-530.064) (-529.211) (-529.318) * [-527.610] (-532.617) (-528.582) (-527.865) -- 0:00:23
608500 -- [-529.563] (-527.733) (-528.307) (-529.123) * (-531.139) (-527.808) (-528.377) [-529.453] -- 0:00:23
609000 -- (-529.603) (-528.578) [-528.441] (-529.142) * (-530.448) [-528.844] (-528.998) (-528.151) -- 0:00:23
609500 -- [-528.185] (-532.643) (-528.392) (-527.494) * (-531.845) [-528.651] (-535.758) (-530.578) -- 0:00:23
610000 -- (-529.205) (-528.937) [-528.724] (-529.434) * (-529.740) (-529.958) (-530.710) [-530.083] -- 0:00:23
Average standard deviation of split frequencies: 0.007720
610500 -- (-529.851) (-530.428) (-529.066) [-531.520] * [-533.878] (-528.391) (-530.468) (-528.156) -- 0:00:22
611000 -- (-531.106) (-532.647) [-527.482] (-530.002) * [-528.737] (-527.654) (-528.295) (-527.751) -- 0:00:22
611500 -- (-528.813) [-531.225] (-527.059) (-528.356) * (-530.563) (-527.714) (-530.575) [-528.387] -- 0:00:22
612000 -- (-528.349) (-529.952) [-526.884] (-529.955) * (-527.596) [-529.813] (-528.565) (-528.855) -- 0:00:22
612500 -- (-528.461) (-530.665) (-529.462) [-527.216] * (-528.829) (-529.769) (-529.168) [-532.116] -- 0:00:22
613000 -- (-528.611) (-529.733) (-527.655) [-527.856] * (-529.377) (-531.176) (-529.815) [-528.617] -- 0:00:22
613500 -- [-527.412] (-528.948) (-531.819) (-529.685) * [-533.715] (-527.024) (-529.137) (-529.344) -- 0:00:22
614000 -- (-527.989) (-528.543) [-529.763] (-527.290) * [-530.224] (-527.284) (-533.676) (-528.241) -- 0:00:22
614500 -- (-532.052) [-530.951] (-528.766) (-529.656) * (-530.676) (-529.238) [-528.830] (-527.977) -- 0:00:22
615000 -- [-528.182] (-531.116) (-529.497) (-529.511) * [-527.380] (-529.074) (-528.320) (-531.488) -- 0:00:22
Average standard deviation of split frequencies: 0.007987
615500 -- (-530.625) (-530.252) [-527.288] (-529.793) * [-528.872] (-533.423) (-527.882) (-530.487) -- 0:00:22
616000 -- [-528.705] (-528.144) (-527.850) (-530.458) * (-528.245) (-530.143) [-528.398] (-530.120) -- 0:00:22
616500 -- (-528.984) (-527.179) (-527.558) [-527.465] * [-529.546] (-529.712) (-528.729) (-531.591) -- 0:00:22
617000 -- [-529.524] (-530.444) (-529.258) (-529.008) * (-532.275) (-527.966) (-529.229) [-529.316] -- 0:00:22
617500 -- (-528.414) (-527.852) [-527.454] (-529.024) * [-531.440] (-527.759) (-529.383) (-528.165) -- 0:00:22
618000 -- (-530.057) [-527.688] (-528.338) (-528.180) * (-528.836) [-530.174] (-528.641) (-528.435) -- 0:00:22
618500 -- (-530.335) (-527.652) (-528.793) [-529.471] * (-530.245) (-530.659) (-528.987) [-528.329] -- 0:00:22
619000 -- (-537.703) (-528.793) (-528.029) [-526.958] * [-529.005] (-532.585) (-529.578) (-528.569) -- 0:00:22
619500 -- (-528.769) (-527.661) (-533.242) [-527.528] * (-527.817) [-530.426] (-527.949) (-528.622) -- 0:00:22
620000 -- (-529.506) (-527.426) [-528.863] (-528.287) * [-529.497] (-531.493) (-530.053) (-529.510) -- 0:00:22
Average standard deviation of split frequencies: 0.007215
620500 -- (-527.612) (-527.698) (-530.911) [-528.011] * (-530.517) (-529.379) (-528.502) [-527.685] -- 0:00:22
621000 -- (-529.487) (-528.510) (-531.117) [-528.094] * (-532.360) (-529.839) (-529.518) [-528.991] -- 0:00:21
621500 -- (-528.559) (-529.823) [-527.869] (-527.926) * (-532.795) (-529.197) [-527.011] (-533.722) -- 0:00:21
622000 -- (-531.118) [-530.214] (-528.759) (-530.316) * (-529.835) (-531.375) [-527.380] (-527.841) -- 0:00:21
622500 -- (-528.370) (-532.903) [-527.577] (-527.739) * (-529.855) [-528.520] (-527.950) (-528.872) -- 0:00:21
623000 -- (-529.520) (-529.851) (-529.222) [-529.304] * (-531.321) (-529.836) [-528.723] (-528.271) -- 0:00:21
623500 -- (-530.692) (-527.199) [-528.815] (-529.551) * [-528.935] (-528.945) (-527.679) (-528.770) -- 0:00:21
624000 -- [-531.271] (-528.195) (-529.769) (-530.679) * [-528.461] (-530.375) (-529.413) (-529.002) -- 0:00:21
624500 -- (-527.553) (-529.665) [-529.800] (-528.903) * [-528.308] (-527.803) (-530.485) (-527.382) -- 0:00:21
625000 -- (-529.126) (-528.504) [-527.690] (-531.409) * [-528.204] (-529.332) (-530.549) (-529.469) -- 0:00:22
Average standard deviation of split frequencies: 0.007663
625500 -- [-527.837] (-529.909) (-528.691) (-528.942) * [-528.996] (-531.633) (-532.795) (-529.517) -- 0:00:22
626000 -- (-527.963) (-527.899) [-528.351] (-528.349) * [-533.363] (-528.315) (-529.188) (-530.009) -- 0:00:22
626500 -- (-532.280) [-527.839] (-528.652) (-526.687) * (-527.503) (-532.132) (-528.842) [-529.078] -- 0:00:22
627000 -- (-528.850) (-527.234) [-528.806] (-528.787) * (-529.256) [-528.505] (-528.961) (-530.801) -- 0:00:22
627500 -- (-531.138) (-530.652) [-529.776] (-529.740) * (-529.372) [-528.635] (-530.016) (-527.492) -- 0:00:21
628000 -- (-529.552) (-533.211) [-532.529] (-528.245) * (-533.290) (-529.451) (-530.246) [-527.578] -- 0:00:21
628500 -- (-527.773) (-530.932) [-529.479] (-528.897) * (-531.527) (-528.392) (-529.980) [-529.513] -- 0:00:21
629000 -- (-528.526) [-527.719] (-529.489) (-529.402) * [-527.183] (-530.008) (-528.063) (-527.785) -- 0:00:21
629500 -- (-526.989) [-529.241] (-530.743) (-529.710) * (-528.483) (-529.785) [-529.331] (-528.978) -- 0:00:21
630000 -- [-528.700] (-528.429) (-527.784) (-531.312) * [-527.849] (-532.513) (-531.513) (-535.303) -- 0:00:21
Average standard deviation of split frequencies: 0.006867
630500 -- (-527.239) [-528.198] (-527.493) (-529.401) * [-528.525] (-529.849) (-532.865) (-543.316) -- 0:00:21
631000 -- [-527.385] (-528.528) (-528.842) (-529.400) * (-529.116) (-528.938) (-529.459) [-531.623] -- 0:00:21
631500 -- [-529.468] (-531.897) (-532.681) (-529.983) * [-528.885] (-532.181) (-530.689) (-527.926) -- 0:00:21
632000 -- (-528.783) (-527.751) [-529.556] (-531.833) * (-527.911) (-528.886) [-527.702] (-526.993) -- 0:00:21
632500 -- (-528.781) (-527.815) (-526.817) [-531.091] * (-531.230) (-528.016) [-529.877] (-528.071) -- 0:00:21
633000 -- (-532.415) (-534.678) (-528.390) [-527.845] * [-526.977] (-527.873) (-527.638) (-532.012) -- 0:00:21
633500 -- (-529.537) (-529.616) (-528.117) [-528.341] * (-529.599) (-535.293) [-527.661] (-526.734) -- 0:00:21
634000 -- (-528.959) (-528.104) (-527.197) [-528.097] * (-529.380) (-529.635) [-527.944] (-528.009) -- 0:00:21
634500 -- (-531.460) (-528.938) [-527.254] (-530.136) * (-528.630) [-528.459] (-534.867) (-527.830) -- 0:00:21
635000 -- (-530.781) (-529.688) (-528.762) [-526.751] * (-529.482) (-528.991) [-531.379] (-529.056) -- 0:00:21
Average standard deviation of split frequencies: 0.007088
635500 -- (-531.247) [-529.606] (-529.725) (-530.190) * [-528.691] (-532.166) (-527.956) (-530.848) -- 0:00:21
636000 -- (-529.982) (-528.407) [-528.654] (-527.805) * [-528.651] (-527.767) (-531.383) (-530.297) -- 0:00:21
636500 -- (-528.057) (-527.445) (-528.951) [-528.181] * (-528.530) [-527.656] (-532.625) (-533.081) -- 0:00:21
637000 -- [-527.682] (-528.886) (-533.071) (-528.342) * [-527.593] (-529.965) (-529.468) (-528.402) -- 0:00:21
637500 -- (-532.521) (-530.774) [-534.743] (-528.692) * [-529.538] (-529.269) (-533.785) (-527.629) -- 0:00:21
638000 -- [-528.498] (-527.686) (-527.967) (-529.712) * (-529.379) (-532.588) (-528.701) [-527.845] -- 0:00:20
638500 -- (-527.419) [-530.927] (-529.866) (-531.020) * (-529.467) [-528.266] (-529.387) (-533.186) -- 0:00:20
639000 -- [-530.495] (-529.658) (-528.482) (-535.837) * (-529.083) (-529.046) (-530.981) [-527.280] -- 0:00:20
639500 -- (-533.412) [-528.938] (-526.880) (-530.949) * (-530.729) (-528.993) (-530.282) [-528.973] -- 0:00:20
640000 -- [-527.397] (-533.142) (-529.571) (-531.504) * (-528.577) [-529.264] (-532.256) (-528.562) -- 0:00:20
Average standard deviation of split frequencies: 0.007834
640500 -- (-527.792) (-532.065) [-528.748] (-531.276) * (-530.625) (-528.823) (-529.843) [-528.707] -- 0:00:20
641000 -- [-527.314] (-527.196) (-530.604) (-530.072) * (-531.199) (-531.397) [-528.758] (-527.984) -- 0:00:20
641500 -- (-527.782) [-527.145] (-528.723) (-529.354) * (-528.373) (-527.973) (-531.598) [-528.651] -- 0:00:20
642000 -- (-530.845) (-528.678) [-528.122] (-528.061) * (-527.908) [-527.855] (-531.916) (-530.255) -- 0:00:21
642500 -- (-527.883) (-529.102) [-527.417] (-528.471) * (-528.326) (-527.404) (-531.550) [-528.330] -- 0:00:21
643000 -- [-527.119] (-528.731) (-528.302) (-527.885) * (-532.673) (-528.206) (-534.302) [-530.209] -- 0:00:21
643500 -- (-529.630) [-528.828] (-528.740) (-527.634) * (-527.644) [-527.598] (-530.355) (-527.633) -- 0:00:21
644000 -- [-532.045] (-534.749) (-530.975) (-529.860) * (-529.428) [-529.676] (-529.447) (-529.109) -- 0:00:21
644500 -- [-528.065] (-532.481) (-528.450) (-530.587) * (-527.523) (-527.105) (-528.427) [-527.407] -- 0:00:20
645000 -- (-527.267) [-529.641] (-528.391) (-528.277) * [-527.836] (-527.742) (-528.233) (-527.883) -- 0:00:20
Average standard deviation of split frequencies: 0.007383
645500 -- (-528.468) (-527.480) [-528.520] (-531.888) * (-529.082) [-530.568] (-528.538) (-528.685) -- 0:00:20
646000 -- (-532.806) (-529.414) (-530.103) [-527.637] * (-527.600) (-532.900) (-527.905) [-527.652] -- 0:00:20
646500 -- (-530.165) (-527.702) [-527.991] (-528.457) * [-533.519] (-530.034) (-529.297) (-527.517) -- 0:00:20
647000 -- (-529.220) (-527.026) [-527.475] (-527.107) * (-531.621) (-528.395) [-529.197] (-527.933) -- 0:00:20
647500 -- [-531.145] (-528.304) (-529.478) (-527.133) * (-528.302) (-530.530) (-528.642) [-529.698] -- 0:00:20
648000 -- (-532.171) (-527.675) [-529.035] (-528.644) * [-528.780] (-528.887) (-526.848) (-530.566) -- 0:00:20
648500 -- (-528.895) (-527.899) [-529.165] (-531.162) * (-531.403) (-531.064) [-527.534] (-529.018) -- 0:00:20
649000 -- (-527.739) (-529.284) (-534.516) [-528.626] * (-528.407) (-528.022) (-530.256) [-529.859] -- 0:00:20
649500 -- (-528.674) [-527.038] (-534.943) (-527.505) * (-527.504) (-529.693) (-529.234) [-529.414] -- 0:00:20
650000 -- (-529.537) [-528.652] (-527.374) (-531.922) * [-528.685] (-528.260) (-528.454) (-531.128) -- 0:00:20
Average standard deviation of split frequencies: 0.007458
650500 -- [-528.104] (-534.664) (-529.875) (-529.803) * (-528.866) (-534.131) [-528.846] (-528.926) -- 0:00:20
651000 -- (-530.268) [-528.654] (-527.403) (-529.095) * [-533.089] (-528.490) (-532.921) (-530.515) -- 0:00:20
651500 -- (-528.241) [-532.557] (-532.214) (-529.450) * [-530.678] (-529.751) (-527.305) (-530.712) -- 0:00:20
652000 -- [-528.320] (-527.712) (-527.016) (-529.803) * (-531.215) (-528.737) (-527.831) [-530.522] -- 0:00:20
652500 -- [-527.870] (-530.335) (-530.535) (-527.586) * (-528.170) [-530.051] (-529.715) (-530.056) -- 0:00:20
653000 -- (-530.014) (-528.420) (-531.442) [-528.483] * (-528.897) [-527.961] (-529.371) (-533.622) -- 0:00:20
653500 -- [-528.456] (-530.892) (-530.995) (-528.460) * (-530.848) [-530.273] (-531.266) (-532.434) -- 0:00:20
654000 -- (-528.516) [-529.410] (-528.398) (-529.366) * (-530.509) (-528.654) (-532.277) [-530.394] -- 0:00:20
654500 -- (-527.110) [-528.813] (-530.265) (-527.715) * (-530.269) [-531.070] (-531.986) (-527.172) -- 0:00:20
655000 -- (-527.700) (-530.797) [-527.142] (-529.132) * [-530.378] (-527.877) (-529.876) (-529.534) -- 0:00:20
Average standard deviation of split frequencies: 0.007736
655500 -- [-528.058] (-531.005) (-529.246) (-527.909) * (-529.583) [-527.495] (-529.710) (-530.430) -- 0:00:19
656000 -- (-529.112) (-534.180) (-528.834) [-527.999] * [-529.293] (-529.385) (-528.524) (-528.316) -- 0:00:19
656500 -- [-528.555] (-528.461) (-529.761) (-528.145) * (-527.960) [-530.014] (-529.545) (-527.874) -- 0:00:19
657000 -- (-528.357) [-532.167] (-528.469) (-528.101) * (-529.245) (-532.780) (-532.398) [-529.307] -- 0:00:19
657500 -- [-528.760] (-528.180) (-529.563) (-535.497) * (-532.562) (-528.192) [-528.149] (-528.139) -- 0:00:19
658000 -- [-532.573] (-528.282) (-529.924) (-534.119) * (-528.490) (-534.860) [-528.296] (-530.239) -- 0:00:19
658500 -- (-528.578) [-528.453] (-532.333) (-530.702) * (-528.867) [-528.285] (-529.398) (-529.590) -- 0:00:19
659000 -- (-528.171) (-530.871) (-529.896) [-530.385] * (-528.229) [-528.049] (-530.033) (-530.621) -- 0:00:20
659500 -- (-530.053) (-532.510) (-528.523) [-529.509] * (-528.939) [-528.652] (-527.170) (-539.025) -- 0:00:20
660000 -- (-529.239) (-530.740) (-527.924) [-529.531] * [-528.440] (-528.258) (-527.247) (-530.600) -- 0:00:20
Average standard deviation of split frequencies: 0.007765
660500 -- (-532.815) [-527.576] (-528.648) (-528.480) * (-529.047) [-531.102] (-528.260) (-531.959) -- 0:00:20
661000 -- (-531.870) [-529.088] (-527.175) (-527.530) * (-531.489) (-530.992) [-529.307] (-531.456) -- 0:00:20
661500 -- (-528.738) [-535.459] (-527.993) (-530.307) * (-529.487) [-530.237] (-531.636) (-529.800) -- 0:00:19
662000 -- [-527.036] (-530.656) (-530.352) (-530.830) * (-527.181) [-529.622] (-528.060) (-528.790) -- 0:00:19
662500 -- (-527.946) (-534.637) [-528.671] (-529.717) * (-528.936) [-531.590] (-527.439) (-530.773) -- 0:00:19
663000 -- (-528.008) [-533.558] (-529.794) (-533.787) * (-528.627) (-533.946) (-530.122) [-528.556] -- 0:00:19
663500 -- (-532.165) (-528.186) (-531.072) [-529.797] * [-533.177] (-528.003) (-529.306) (-528.539) -- 0:00:19
664000 -- [-529.101] (-528.556) (-528.701) (-527.299) * (-529.689) (-529.163) (-531.226) [-527.098] -- 0:00:19
664500 -- (-530.963) (-528.713) [-527.854] (-530.388) * [-531.864] (-529.294) (-528.504) (-528.296) -- 0:00:19
665000 -- (-528.151) (-529.271) [-527.154] (-529.860) * [-529.034] (-528.795) (-529.036) (-531.632) -- 0:00:19
Average standard deviation of split frequencies: 0.006990
665500 -- (-534.633) (-531.011) (-528.076) [-530.070] * [-532.728] (-529.138) (-530.131) (-527.929) -- 0:00:19
666000 -- (-534.535) (-529.624) [-527.635] (-533.625) * (-534.031) [-530.019] (-531.245) (-528.325) -- 0:00:19
666500 -- (-528.963) (-530.449) (-534.900) [-529.541] * (-535.666) (-527.034) (-531.879) [-528.205] -- 0:00:19
667000 -- (-531.911) (-530.705) (-534.283) [-527.224] * (-530.807) (-528.235) (-529.650) [-531.855] -- 0:00:19
667500 -- (-537.657) (-529.710) [-528.687] (-527.224) * [-530.283] (-528.253) (-527.757) (-533.822) -- 0:00:19
668000 -- (-538.843) [-531.003] (-528.699) (-528.139) * (-534.171) [-528.958] (-527.676) (-527.006) -- 0:00:19
668500 -- (-529.468) (-529.988) (-529.402) [-529.523] * [-531.160] (-530.017) (-528.936) (-528.259) -- 0:00:19
669000 -- (-527.519) [-528.355] (-531.470) (-530.006) * [-529.015] (-533.500) (-529.065) (-529.927) -- 0:00:19
669500 -- (-529.362) [-530.000] (-530.302) (-530.224) * [-528.042] (-533.147) (-527.638) (-529.322) -- 0:00:19
670000 -- (-527.789) (-529.935) [-532.622] (-530.627) * (-527.331) (-529.741) [-529.241] (-528.464) -- 0:00:19
Average standard deviation of split frequencies: 0.006502
670500 -- (-527.793) [-527.768] (-529.127) (-528.655) * (-527.619) (-530.153) (-529.297) [-528.242] -- 0:00:19
671000 -- (-528.212) [-528.008] (-530.807) (-528.639) * (-528.376) (-530.113) (-535.691) [-530.178] -- 0:00:19
671500 -- (-528.904) (-528.040) [-529.377] (-527.672) * (-530.966) [-528.108] (-529.466) (-528.929) -- 0:00:19
672000 -- [-529.152] (-528.620) (-529.928) (-530.856) * (-528.207) (-528.723) [-528.136] (-530.771) -- 0:00:19
672500 -- (-528.136) (-527.859) [-529.341] (-527.761) * (-527.910) (-528.035) [-528.125] (-530.820) -- 0:00:18
673000 -- (-533.624) (-528.528) [-529.189] (-528.375) * (-532.362) (-530.403) (-529.356) [-529.894] -- 0:00:18
673500 -- (-535.549) [-527.250] (-530.549) (-530.196) * (-529.956) (-529.052) [-528.511] (-528.139) -- 0:00:18
674000 -- (-542.655) (-529.400) [-534.263] (-527.791) * (-531.209) (-530.516) (-529.520) [-528.558] -- 0:00:18
674500 -- [-530.023] (-530.418) (-530.664) (-529.752) * (-529.760) (-527.999) [-528.861] (-531.679) -- 0:00:18
675000 -- (-527.754) (-537.519) [-528.163] (-529.481) * (-527.864) [-528.119] (-529.297) (-531.339) -- 0:00:18
Average standard deviation of split frequencies: 0.006756
675500 -- (-529.163) [-530.738] (-527.496) (-531.016) * (-531.726) [-527.486] (-529.350) (-531.505) -- 0:00:19
676000 -- (-529.646) (-531.326) (-527.449) [-528.632] * (-535.964) (-530.613) (-527.068) [-528.023] -- 0:00:19
676500 -- [-528.751] (-529.750) (-529.682) (-537.887) * (-527.542) [-527.818] (-532.320) (-529.561) -- 0:00:19
677000 -- (-527.158) (-529.582) (-529.718) [-528.373] * (-528.361) (-528.154) [-526.939] (-529.135) -- 0:00:19
677500 -- (-527.487) (-530.513) (-528.647) [-526.790] * [-529.555] (-530.713) (-528.067) (-527.311) -- 0:00:19
678000 -- (-528.860) (-529.100) [-530.116] (-530.995) * (-534.001) (-527.219) [-534.758] (-528.134) -- 0:00:18
678500 -- (-527.998) (-529.906) (-530.047) [-528.325] * (-526.952) [-527.778] (-530.919) (-527.447) -- 0:00:18
679000 -- (-529.595) (-528.849) (-528.659) [-528.606] * (-530.248) (-527.102) (-527.334) [-528.110] -- 0:00:18
679500 -- [-530.188] (-527.196) (-530.023) (-527.609) * (-530.337) [-528.847] (-528.863) (-528.442) -- 0:00:18
680000 -- (-529.905) [-527.606] (-528.685) (-528.946) * [-531.507] (-527.474) (-530.657) (-528.880) -- 0:00:18
Average standard deviation of split frequencies: 0.007249
680500 -- [-527.900] (-527.749) (-528.038) (-535.220) * (-530.191) (-527.790) (-529.529) [-532.065] -- 0:00:18
681000 -- (-529.649) (-528.534) (-532.958) [-529.278] * (-530.720) (-529.512) [-529.937] (-531.391) -- 0:00:18
681500 -- (-533.334) (-527.784) [-531.791] (-530.365) * (-531.606) [-528.456] (-532.920) (-531.129) -- 0:00:18
682000 -- (-535.346) (-528.533) (-530.107) [-529.475] * (-528.330) [-529.822] (-531.456) (-534.015) -- 0:00:18
682500 -- (-530.297) (-527.717) (-527.658) [-528.839] * (-527.984) (-528.431) (-528.414) [-527.780] -- 0:00:18
683000 -- (-529.953) [-527.803] (-528.308) (-528.213) * [-528.585] (-528.508) (-531.932) (-536.331) -- 0:00:18
683500 -- [-528.809] (-527.761) (-532.313) (-530.633) * [-529.252] (-529.051) (-534.555) (-535.921) -- 0:00:18
684000 -- (-528.929) (-527.964) (-530.304) [-528.844] * (-529.013) (-532.515) [-530.867] (-528.076) -- 0:00:18
684500 -- (-531.793) (-527.562) (-530.770) [-528.574] * (-527.141) [-528.292] (-529.871) (-528.256) -- 0:00:18
685000 -- (-529.056) [-528.519] (-529.787) (-528.479) * (-528.082) (-528.257) (-531.243) [-527.591] -- 0:00:18
Average standard deviation of split frequencies: 0.007842
685500 -- (-527.659) [-526.944] (-527.844) (-528.788) * (-529.053) (-534.055) [-528.053] (-530.612) -- 0:00:18
686000 -- (-528.824) (-528.674) [-529.537] (-527.240) * (-531.416) [-528.088] (-528.726) (-527.478) -- 0:00:18
686500 -- (-528.741) (-533.599) (-531.341) [-527.384] * (-534.887) (-527.030) [-527.449] (-527.029) -- 0:00:18
687000 -- [-529.659] (-528.544) (-530.370) (-527.547) * (-532.340) [-532.906] (-527.079) (-526.980) -- 0:00:18
687500 -- (-534.413) [-528.885] (-529.388) (-527.285) * (-532.636) (-530.756) [-527.078] (-527.911) -- 0:00:18
688000 -- (-528.251) (-527.995) [-529.248] (-530.862) * [-529.474] (-529.691) (-528.594) (-528.008) -- 0:00:18
688500 -- (-527.718) [-529.756] (-530.288) (-527.988) * (-542.238) [-527.600] (-528.607) (-529.592) -- 0:00:18
689000 -- [-530.602] (-536.123) (-537.003) (-531.851) * [-530.124] (-530.180) (-530.245) (-530.408) -- 0:00:18
689500 -- (-528.202) (-529.538) [-530.335] (-529.562) * [-529.399] (-531.098) (-529.255) (-529.224) -- 0:00:18
690000 -- (-528.698) [-530.219] (-531.347) (-530.641) * (-529.200) (-531.541) (-528.702) [-532.115] -- 0:00:17
Average standard deviation of split frequencies: 0.007644
690500 -- (-528.038) [-529.867] (-529.405) (-528.304) * (-530.775) (-528.946) (-528.137) [-530.352] -- 0:00:17
691000 -- (-531.447) [-530.453] (-530.444) (-527.355) * (-529.345) (-528.417) [-530.312] (-531.207) -- 0:00:17
691500 -- [-529.562] (-528.021) (-528.373) (-528.853) * (-528.076) [-531.919] (-529.422) (-530.456) -- 0:00:17
692000 -- (-535.538) (-531.517) (-528.567) [-529.650] * [-534.961] (-533.805) (-528.747) (-529.485) -- 0:00:17
692500 -- (-530.761) [-529.969] (-528.390) (-526.757) * [-528.995] (-532.472) (-527.307) (-531.569) -- 0:00:18
693000 -- (-526.961) (-531.215) (-527.534) [-528.183] * (-531.411) (-527.873) [-527.581] (-532.131) -- 0:00:18
693500 -- (-527.288) (-531.094) (-528.682) [-526.844] * [-528.143] (-528.557) (-528.994) (-528.828) -- 0:00:18
694000 -- (-527.803) [-527.380] (-529.457) (-527.309) * [-527.247] (-529.396) (-531.236) (-527.824) -- 0:00:18
694500 -- (-531.448) (-527.724) [-528.697] (-526.776) * (-528.382) (-529.796) [-528.273] (-528.959) -- 0:00:18
695000 -- (-531.695) (-529.499) [-529.081] (-527.917) * [-527.467] (-529.729) (-527.678) (-530.131) -- 0:00:17
Average standard deviation of split frequencies: 0.007721
695500 -- (-529.690) [-528.913] (-528.365) (-529.256) * (-527.754) (-530.631) [-529.677] (-532.328) -- 0:00:17
696000 -- [-529.449] (-529.592) (-527.546) (-529.728) * (-527.954) (-531.505) [-527.914] (-527.163) -- 0:00:17
696500 -- (-529.198) [-529.476] (-528.676) (-526.902) * (-528.396) (-533.192) (-528.833) [-527.418] -- 0:00:17
697000 -- (-531.620) (-538.514) [-528.776] (-530.753) * (-529.537) (-531.838) (-527.269) [-530.305] -- 0:00:17
697500 -- (-534.935) (-536.624) (-528.804) [-530.555] * [-529.560] (-528.794) (-528.576) (-529.990) -- 0:00:17
698000 -- (-531.762) (-534.742) [-527.608] (-529.388) * (-530.123) [-528.943] (-530.370) (-530.048) -- 0:00:17
698500 -- (-534.029) (-530.300) (-527.960) [-527.285] * (-528.368) (-528.197) (-528.689) [-528.923] -- 0:00:17
699000 -- (-532.227) (-531.485) [-527.367] (-533.782) * [-528.623] (-530.007) (-529.573) (-529.906) -- 0:00:17
699500 -- [-529.953] (-529.966) (-529.518) (-529.311) * (-528.060) (-531.314) [-528.108] (-532.699) -- 0:00:17
700000 -- (-531.149) (-529.631) (-528.585) [-527.923] * [-528.647] (-530.521) (-530.187) (-527.714) -- 0:00:17
Average standard deviation of split frequencies: 0.007580
700500 -- (-535.583) [-528.301] (-529.088) (-528.124) * (-527.998) [-529.241] (-533.686) (-527.931) -- 0:00:17
701000 -- (-529.099) (-527.762) (-528.356) [-533.311] * (-527.138) (-530.740) [-530.050] (-531.892) -- 0:00:17
701500 -- (-528.704) (-527.734) (-529.141) [-530.008] * [-529.239] (-528.655) (-530.453) (-530.501) -- 0:00:17
702000 -- [-527.940] (-527.276) (-531.014) (-530.266) * (-528.252) (-531.760) (-531.581) [-528.670] -- 0:00:17
702500 -- (-527.112) [-529.408] (-531.865) (-531.149) * (-529.485) (-527.819) [-527.370] (-527.662) -- 0:00:17
703000 -- (-529.244) [-527.504] (-530.026) (-531.219) * [-527.353] (-529.266) (-528.875) (-532.222) -- 0:00:17
703500 -- [-531.045] (-529.219) (-529.606) (-529.839) * (-529.187) [-527.500] (-529.743) (-528.148) -- 0:00:17
704000 -- (-529.651) [-527.030] (-532.043) (-530.790) * [-529.161] (-533.490) (-527.502) (-529.618) -- 0:00:17
704500 -- [-530.034] (-529.846) (-530.164) (-529.647) * (-531.697) (-530.183) (-530.874) [-531.813] -- 0:00:17
705000 -- (-528.462) (-528.248) (-529.507) [-532.462] * (-529.279) (-529.673) (-529.465) [-528.898] -- 0:00:17
Average standard deviation of split frequencies: 0.007512
705500 -- [-528.508] (-533.582) (-529.884) (-527.741) * (-530.029) [-528.354] (-529.877) (-530.166) -- 0:00:17
706000 -- (-529.477) (-530.698) (-527.096) [-529.195] * (-529.929) (-529.656) [-533.440] (-530.617) -- 0:00:17
706500 -- (-533.282) (-529.116) (-530.551) [-529.357] * (-528.891) [-529.298] (-530.654) (-530.535) -- 0:00:17
707000 -- (-528.488) (-527.720) [-528.373] (-529.238) * (-530.001) (-531.789) [-527.415] (-530.708) -- 0:00:16
707500 -- (-533.712) (-527.738) [-527.443] (-528.123) * [-528.190] (-530.132) (-528.181) (-528.880) -- 0:00:16
708000 -- (-532.655) [-530.920] (-528.505) (-530.783) * (-529.426) [-530.867] (-532.510) (-527.347) -- 0:00:16
708500 -- (-531.782) (-530.047) [-530.924] (-529.429) * (-528.316) [-533.504] (-529.667) (-529.841) -- 0:00:16
709000 -- (-529.424) (-536.836) [-526.793] (-528.730) * (-527.570) (-529.537) (-530.118) [-528.326] -- 0:00:16
709500 -- (-527.656) [-529.688] (-532.402) (-529.161) * (-528.038) (-527.667) (-530.217) [-528.575] -- 0:00:16
710000 -- (-528.849) (-528.880) [-536.029] (-529.508) * (-528.158) (-528.922) (-530.045) [-529.175] -- 0:00:17
Average standard deviation of split frequencies: 0.007031
710500 -- [-531.757] (-528.140) (-527.547) (-527.481) * (-528.856) (-527.400) [-527.133] (-528.345) -- 0:00:17
711000 -- [-531.403] (-531.299) (-530.418) (-527.203) * (-529.267) (-531.124) (-529.855) [-530.563] -- 0:00:17
711500 -- (-530.696) (-531.258) [-529.948] (-527.190) * (-530.793) (-533.167) [-530.141] (-529.837) -- 0:00:17
712000 -- (-530.398) (-530.742) [-527.367] (-529.051) * (-530.947) (-529.748) [-527.577] (-527.378) -- 0:00:16
712500 -- [-528.651] (-527.477) (-527.288) (-529.829) * (-531.423) (-528.105) (-531.399) [-528.670] -- 0:00:16
713000 -- (-528.994) (-530.589) (-529.452) [-531.873] * (-528.170) (-528.769) (-530.146) [-527.995] -- 0:00:16
713500 -- (-528.431) (-530.140) (-527.996) [-533.180] * (-527.552) [-527.264] (-529.189) (-530.102) -- 0:00:16
714000 -- (-528.586) [-530.314] (-528.324) (-527.258) * (-528.081) (-534.200) (-529.663) [-530.144] -- 0:00:16
714500 -- (-527.940) [-527.982] (-528.323) (-528.715) * [-527.162] (-528.306) (-529.665) (-530.683) -- 0:00:16
715000 -- (-527.830) [-527.952] (-528.237) (-529.594) * (-527.459) [-527.573] (-531.589) (-527.653) -- 0:00:16
Average standard deviation of split frequencies: 0.007330
715500 -- (-527.318) (-535.418) [-529.489] (-532.807) * (-527.289) (-528.979) (-528.505) [-528.737] -- 0:00:16
716000 -- (-526.922) [-527.315] (-528.689) (-528.989) * (-528.683) (-530.038) (-527.781) [-528.966] -- 0:00:16
716500 -- (-527.747) (-529.093) (-527.986) [-529.686] * (-528.494) (-528.029) (-528.939) [-529.507] -- 0:00:16
717000 -- (-527.917) [-528.789] (-533.076) (-528.030) * (-530.354) (-527.958) [-528.283] (-528.077) -- 0:00:16
717500 -- (-529.753) [-530.440] (-531.270) (-528.256) * (-528.291) (-529.566) (-530.038) [-531.061] -- 0:00:16
718000 -- (-531.995) (-528.706) (-529.586) [-528.068] * (-530.167) (-529.896) [-530.177] (-530.706) -- 0:00:16
718500 -- (-527.563) (-531.796) (-530.809) [-528.187] * (-529.153) (-527.979) [-526.781] (-533.227) -- 0:00:16
719000 -- [-530.160] (-529.742) (-529.509) (-532.986) * (-527.826) (-532.113) [-530.902] (-533.068) -- 0:00:16
719500 -- (-530.827) (-528.417) (-528.498) [-528.831] * (-532.207) (-526.881) (-529.743) [-527.638] -- 0:00:16
720000 -- [-528.040] (-530.190) (-529.501) (-527.779) * (-530.341) [-533.638] (-528.169) (-529.711) -- 0:00:16
Average standard deviation of split frequencies: 0.007239
720500 -- (-527.907) (-531.097) (-533.187) [-529.293] * [-528.637] (-535.231) (-528.599) (-531.823) -- 0:00:16
721000 -- (-527.605) (-528.184) [-532.509] (-529.762) * (-529.902) (-528.942) [-532.278] (-530.665) -- 0:00:16
721500 -- (-528.508) [-532.468] (-532.312) (-529.195) * (-534.861) [-528.028] (-532.607) (-530.901) -- 0:00:16
722000 -- (-531.528) [-529.650] (-531.534) (-530.320) * (-530.223) [-531.608] (-529.687) (-530.322) -- 0:00:16
722500 -- [-530.210] (-531.664) (-529.511) (-527.699) * (-528.817) [-530.187] (-529.551) (-529.203) -- 0:00:16
723000 -- (-527.932) (-529.378) (-527.445) [-527.190] * (-527.883) (-527.448) (-528.783) [-531.720] -- 0:00:16
723500 -- (-527.954) (-528.328) (-527.496) [-530.651] * [-530.665] (-529.041) (-528.315) (-531.033) -- 0:00:16
724000 -- [-529.631] (-527.257) (-529.188) (-528.522) * [-530.665] (-532.158) (-528.036) (-529.700) -- 0:00:16
724500 -- (-531.006) [-528.265] (-531.761) (-528.237) * (-528.136) [-530.258] (-527.523) (-530.359) -- 0:00:15
725000 -- [-527.245] (-531.998) (-534.520) (-528.562) * [-529.710] (-529.072) (-529.959) (-528.882) -- 0:00:15
Average standard deviation of split frequencies: 0.007402
725500 -- (-529.623) [-530.267] (-529.320) (-530.603) * [-530.158] (-531.617) (-527.149) (-530.175) -- 0:00:15
726000 -- (-529.898) (-527.559) [-528.603] (-531.264) * (-528.535) [-528.435] (-528.075) (-533.932) -- 0:00:15
726500 -- [-530.835] (-528.229) (-530.954) (-529.817) * (-528.771) (-528.019) [-530.831] (-539.138) -- 0:00:15
727000 -- [-529.144] (-527.938) (-527.858) (-530.405) * (-527.122) [-527.940] (-528.100) (-530.155) -- 0:00:15
727500 -- (-529.386) (-529.485) (-532.300) [-529.477] * (-527.173) (-528.665) (-530.884) [-530.706] -- 0:00:16
728000 -- (-528.771) [-528.674] (-531.883) (-528.389) * (-528.090) (-528.826) (-528.987) [-528.070] -- 0:00:16
728500 -- (-529.236) [-529.003] (-526.932) (-527.698) * [-529.917] (-529.189) (-528.447) (-528.071) -- 0:00:16
729000 -- (-530.621) [-529.662] (-530.203) (-527.839) * (-530.757) (-528.588) [-528.829] (-526.883) -- 0:00:15
729500 -- (-528.201) (-528.754) [-528.801] (-530.463) * (-528.573) (-530.287) (-528.276) [-527.081] -- 0:00:15
730000 -- [-528.460] (-528.977) (-528.235) (-528.230) * (-532.753) (-528.845) [-528.599] (-530.532) -- 0:00:15
Average standard deviation of split frequencies: 0.007355
730500 -- [-528.940] (-534.130) (-529.982) (-528.135) * (-530.057) (-531.088) [-529.740] (-530.990) -- 0:00:15
731000 -- (-533.571) (-527.830) [-531.620] (-529.803) * (-528.918) [-529.754] (-529.211) (-532.595) -- 0:00:15
731500 -- (-530.118) [-529.075] (-534.278) (-528.735) * (-528.860) (-529.358) (-532.722) [-528.228] -- 0:00:15
732000 -- [-529.422] (-528.846) (-530.809) (-529.955) * (-530.693) (-534.540) (-530.295) [-529.816] -- 0:00:15
732500 -- (-528.848) (-528.176) (-529.767) [-528.400] * [-528.804] (-533.356) (-527.009) (-528.313) -- 0:00:15
733000 -- (-531.846) [-529.209] (-530.441) (-531.267) * (-528.859) [-529.253] (-528.548) (-531.844) -- 0:00:15
733500 -- (-531.857) (-528.661) [-528.960] (-530.086) * (-529.887) (-528.312) (-531.423) [-527.252] -- 0:00:15
734000 -- (-529.735) [-528.894] (-530.630) (-531.607) * [-531.527] (-528.313) (-529.777) (-528.788) -- 0:00:15
734500 -- (-528.635) (-527.625) [-527.963] (-529.057) * (-530.977) (-528.104) [-531.409] (-531.259) -- 0:00:15
735000 -- [-528.432] (-528.361) (-528.486) (-529.188) * (-530.415) (-527.911) [-528.664] (-528.427) -- 0:00:15
Average standard deviation of split frequencies: 0.007259
735500 -- (-527.569) [-528.201] (-528.601) (-527.684) * (-531.070) (-529.111) (-527.624) [-527.236] -- 0:00:15
736000 -- (-527.304) (-529.801) (-529.143) [-530.284] * (-532.205) [-530.017] (-527.182) (-527.998) -- 0:00:15
736500 -- [-532.160] (-528.851) (-528.466) (-529.153) * (-531.030) [-529.861] (-528.333) (-529.184) -- 0:00:15
737000 -- [-527.181] (-529.079) (-528.002) (-528.406) * [-527.586] (-531.339) (-529.152) (-532.186) -- 0:00:15
737500 -- (-529.601) (-535.653) (-527.935) [-528.532] * [-528.376] (-533.584) (-531.796) (-528.833) -- 0:00:15
738000 -- (-532.274) [-533.619] (-529.570) (-527.598) * (-532.664) (-533.424) (-530.706) [-528.465] -- 0:00:15
738500 -- (-528.543) (-529.222) [-530.145] (-532.075) * (-531.643) (-530.413) (-533.157) [-529.923] -- 0:00:15
739000 -- [-531.867] (-529.395) (-531.105) (-530.164) * (-533.369) [-529.076] (-528.453) (-531.745) -- 0:00:15
739500 -- (-530.583) [-527.146] (-529.024) (-528.766) * (-530.680) (-528.528) (-530.672) [-528.757] -- 0:00:15
740000 -- (-530.673) (-529.561) [-529.119] (-527.801) * (-529.993) [-531.445] (-529.098) (-527.687) -- 0:00:15
Average standard deviation of split frequencies: 0.007171
740500 -- (-527.428) [-531.912] (-530.726) (-531.680) * (-530.145) (-534.137) (-529.852) [-527.973] -- 0:00:15
741000 -- (-528.960) (-527.486) [-529.944] (-528.887) * (-531.184) (-529.937) (-528.888) [-528.323] -- 0:00:15
741500 -- [-529.126] (-526.972) (-526.905) (-529.368) * (-530.238) (-527.798) (-531.215) [-527.084] -- 0:00:14
742000 -- [-530.309] (-533.684) (-526.905) (-530.664) * [-526.972] (-527.629) (-527.930) (-532.808) -- 0:00:14
742500 -- (-528.158) [-528.406] (-528.258) (-528.789) * (-529.184) [-529.588] (-529.792) (-532.380) -- 0:00:14
743000 -- [-528.976] (-529.099) (-529.134) (-528.408) * (-529.236) (-529.686) [-529.297] (-529.379) -- 0:00:14
743500 -- (-529.163) [-531.608] (-529.051) (-532.094) * (-530.264) (-530.017) [-530.866] (-527.739) -- 0:00:14
744000 -- [-528.672] (-529.721) (-528.102) (-531.022) * (-527.597) (-530.100) (-531.482) [-529.742] -- 0:00:15
744500 -- (-529.621) (-531.588) [-527.728] (-529.096) * [-527.372] (-527.554) (-529.766) (-529.390) -- 0:00:15
745000 -- (-530.566) [-528.912] (-527.491) (-532.984) * [-529.805] (-531.927) (-530.444) (-530.628) -- 0:00:15
Average standard deviation of split frequencies: 0.006825
745500 -- [-530.982] (-528.897) (-530.004) (-530.528) * [-527.471] (-529.833) (-528.713) (-532.359) -- 0:00:15
746000 -- (-529.958) (-528.475) [-528.200] (-528.007) * (-530.570) (-530.910) [-529.394] (-532.134) -- 0:00:14
746500 -- [-529.206] (-529.077) (-530.111) (-528.270) * (-532.896) [-527.467] (-530.806) (-533.145) -- 0:00:14
747000 -- (-530.124) (-527.987) (-530.051) [-528.261] * (-530.688) [-527.578] (-530.076) (-528.779) -- 0:00:14
747500 -- (-529.946) [-529.107] (-527.178) (-528.531) * (-532.489) (-529.091) (-528.939) [-529.625] -- 0:00:14
748000 -- (-529.955) [-528.155] (-528.123) (-530.135) * (-530.345) [-528.337] (-528.821) (-529.611) -- 0:00:14
748500 -- (-529.433) (-527.976) [-528.364] (-531.067) * [-528.000] (-528.053) (-528.457) (-530.010) -- 0:00:14
749000 -- [-529.644] (-529.139) (-527.761) (-528.038) * (-528.129) (-529.066) [-529.307] (-533.947) -- 0:00:14
749500 -- (-528.003) [-529.667] (-527.003) (-532.612) * [-529.782] (-527.619) (-530.315) (-530.266) -- 0:00:14
750000 -- (-528.811) [-529.966] (-527.478) (-532.085) * [-527.370] (-526.896) (-531.234) (-527.492) -- 0:00:14
Average standard deviation of split frequencies: 0.007243
750500 -- (-528.255) [-527.650] (-528.743) (-528.999) * (-528.928) (-528.912) (-530.153) [-530.669] -- 0:00:14
751000 -- (-529.880) [-528.126] (-528.992) (-527.870) * [-527.122] (-528.774) (-529.646) (-531.105) -- 0:00:14
751500 -- (-528.003) [-529.320] (-529.112) (-527.723) * (-529.207) (-530.321) [-528.832] (-528.149) -- 0:00:14
752000 -- (-530.152) (-534.794) (-541.650) [-528.101] * (-531.548) [-528.162] (-529.908) (-528.202) -- 0:00:14
752500 -- (-527.643) (-527.149) (-529.376) [-532.689] * [-530.100] (-529.450) (-530.777) (-528.517) -- 0:00:14
753000 -- (-528.930) (-531.978) [-528.527] (-529.835) * (-530.453) (-529.707) [-527.587] (-528.882) -- 0:00:14
753500 -- (-529.003) [-528.133] (-531.396) (-531.242) * (-527.935) (-527.995) [-527.995] (-529.550) -- 0:00:14
754000 -- (-533.621) (-526.892) [-527.425] (-530.870) * (-528.560) (-527.235) (-527.643) [-528.436] -- 0:00:14
754500 -- (-530.071) [-528.795] (-528.163) (-532.579) * (-528.503) (-529.761) [-528.808] (-528.830) -- 0:00:14
755000 -- (-529.933) [-527.194] (-532.563) (-527.237) * (-529.707) [-528.491] (-528.991) (-528.033) -- 0:00:14
Average standard deviation of split frequencies: 0.007524
755500 -- (-527.714) (-527.712) [-527.851] (-527.533) * (-527.724) [-527.922] (-531.038) (-527.778) -- 0:00:14
756000 -- (-527.097) (-531.587) [-528.250] (-530.684) * (-528.600) (-529.650) [-529.801] (-527.718) -- 0:00:14
756500 -- (-532.453) [-531.192] (-533.855) (-528.916) * [-527.606] (-530.380) (-529.701) (-528.871) -- 0:00:14
757000 -- [-527.971] (-530.129) (-529.615) (-529.280) * (-527.275) [-528.571] (-530.031) (-530.062) -- 0:00:14
757500 -- [-527.646] (-533.131) (-529.235) (-532.069) * (-529.469) (-528.591) (-532.070) [-529.885] -- 0:00:14
758000 -- [-529.508] (-527.783) (-529.142) (-529.808) * (-530.107) (-528.586) [-529.385] (-531.213) -- 0:00:14
758500 -- (-529.881) (-529.610) (-528.094) [-531.606] * (-529.427) (-527.548) [-527.172] (-529.432) -- 0:00:14
759000 -- (-528.106) (-534.469) (-532.723) [-528.245] * [-527.589] (-529.857) (-528.891) (-527.687) -- 0:00:13
759500 -- (-531.407) (-530.761) [-529.412] (-532.625) * (-528.731) (-527.056) (-527.845) [-526.978] -- 0:00:13
760000 -- (-531.788) (-528.735) (-528.620) [-528.317] * (-527.748) (-527.464) [-528.820] (-530.325) -- 0:00:13
Average standard deviation of split frequencies: 0.007891
760500 -- (-531.267) [-528.545] (-528.188) (-531.069) * [-530.481] (-527.714) (-529.090) (-527.687) -- 0:00:14
761000 -- (-532.090) [-530.036] (-529.914) (-532.081) * [-528.318] (-528.779) (-527.958) (-527.600) -- 0:00:14
761500 -- [-529.973] (-533.572) (-529.037) (-528.201) * [-527.363] (-530.180) (-528.687) (-529.323) -- 0:00:14
762000 -- (-527.684) (-532.526) (-530.403) [-528.934] * (-528.256) (-531.947) (-529.374) [-533.024] -- 0:00:14
762500 -- (-530.395) (-532.033) [-529.699] (-530.501) * [-527.947] (-531.607) (-530.751) (-530.093) -- 0:00:14
763000 -- (-528.532) (-530.171) [-527.574] (-531.450) * (-528.775) (-529.607) (-528.057) [-531.944] -- 0:00:13
763500 -- (-528.986) [-527.871] (-530.022) (-531.125) * [-527.880] (-529.831) (-529.158) (-531.041) -- 0:00:13
764000 -- (-528.173) [-532.352] (-529.491) (-529.249) * [-527.186] (-528.560) (-530.533) (-527.625) -- 0:00:13
764500 -- (-528.479) (-530.082) [-529.625] (-529.793) * (-529.012) [-535.047] (-527.225) (-528.857) -- 0:00:13
765000 -- [-527.097] (-528.228) (-531.517) (-529.325) * (-530.843) (-530.891) [-529.487] (-529.942) -- 0:00:13
Average standard deviation of split frequencies: 0.007877
765500 -- (-527.312) (-529.737) [-529.129] (-533.620) * (-532.870) [-527.302] (-532.034) (-528.767) -- 0:00:13
766000 -- [-529.773] (-527.588) (-527.225) (-527.952) * (-532.579) (-527.538) (-537.756) [-526.944] -- 0:00:13
766500 -- (-530.266) (-528.341) [-529.852] (-531.733) * [-530.460] (-529.043) (-528.394) (-528.299) -- 0:00:13
767000 -- [-529.791] (-528.841) (-531.289) (-528.711) * (-528.944) (-530.529) [-528.144] (-527.768) -- 0:00:13
767500 -- (-529.902) (-529.367) [-527.720] (-529.488) * (-530.662) [-533.822] (-527.639) (-527.899) -- 0:00:13
768000 -- (-528.128) [-530.215] (-530.605) (-529.105) * (-529.168) (-531.630) [-528.809] (-529.560) -- 0:00:13
768500 -- [-527.807] (-529.558) (-528.289) (-527.886) * (-528.930) (-532.400) [-530.121] (-527.781) -- 0:00:13
769000 -- (-528.135) (-530.724) (-527.466) [-526.955] * (-528.402) (-533.023) (-528.214) [-528.569] -- 0:00:13
769500 -- (-529.387) (-532.389) [-527.146] (-526.992) * [-530.423] (-528.233) (-528.042) (-528.051) -- 0:00:13
770000 -- [-530.457] (-529.431) (-528.724) (-529.316) * [-528.488] (-528.650) (-527.394) (-529.011) -- 0:00:13
Average standard deviation of split frequencies: 0.007952
770500 -- (-530.826) [-530.384] (-527.864) (-527.412) * [-527.349] (-528.662) (-528.988) (-528.334) -- 0:00:13
771000 -- (-530.667) (-532.877) (-528.037) [-529.098] * [-527.667] (-527.472) (-529.832) (-528.333) -- 0:00:13
771500 -- (-530.728) [-529.229] (-527.360) (-528.216) * [-529.288] (-527.574) (-529.974) (-529.494) -- 0:00:13
772000 -- (-529.617) (-529.636) (-528.305) [-527.698] * (-531.470) (-528.984) [-529.240] (-532.511) -- 0:00:13
772500 -- [-527.997] (-535.799) (-529.609) (-527.796) * (-530.577) (-528.221) [-529.496] (-530.204) -- 0:00:13
773000 -- (-529.297) (-527.692) [-526.975] (-530.538) * (-528.845) [-529.002] (-532.109) (-529.825) -- 0:00:13
773500 -- (-528.918) (-527.278) (-527.633) [-529.866] * (-528.431) (-529.738) [-527.798] (-527.930) -- 0:00:13
774000 -- (-529.539) [-533.828] (-529.757) (-528.550) * (-531.300) [-529.830] (-528.397) (-527.866) -- 0:00:13
774500 -- (-531.756) [-528.773] (-531.469) (-533.258) * (-529.759) (-528.882) (-528.520) [-528.606] -- 0:00:13
775000 -- (-527.940) (-529.080) (-529.360) [-528.404] * (-527.946) [-529.845] (-537.229) (-527.726) -- 0:00:13
Average standard deviation of split frequencies: 0.007533
775500 -- (-530.543) [-527.372] (-529.140) (-528.366) * [-527.360] (-529.273) (-528.593) (-528.073) -- 0:00:13
776000 -- (-530.076) (-529.160) [-527.142] (-529.816) * [-527.176] (-531.428) (-528.344) (-528.925) -- 0:00:12
776500 -- (-533.232) [-529.426] (-532.494) (-533.805) * (-528.984) [-531.789] (-531.670) (-529.382) -- 0:00:12
777000 -- (-528.629) [-528.511] (-530.655) (-528.700) * [-529.388] (-533.968) (-529.060) (-530.177) -- 0:00:12
777500 -- (-531.223) (-528.803) (-532.686) [-527.262] * [-530.191] (-529.045) (-529.113) (-527.542) -- 0:00:12
778000 -- [-530.986] (-530.430) (-533.390) (-531.001) * (-531.553) (-528.939) (-530.554) [-529.525] -- 0:00:13
778500 -- (-533.115) (-532.923) [-529.441] (-528.614) * (-529.165) (-528.450) (-529.969) [-529.200] -- 0:00:13
779000 -- (-530.432) [-529.751] (-529.605) (-533.466) * (-529.112) [-527.340] (-529.668) (-528.950) -- 0:00:13
779500 -- [-531.888] (-531.331) (-528.597) (-530.801) * (-527.902) (-529.645) (-531.129) [-529.261] -- 0:00:13
780000 -- (-537.574) (-527.178) [-527.194] (-533.525) * (-528.708) (-529.414) [-527.362] (-527.735) -- 0:00:12
Average standard deviation of split frequencies: 0.007085
780500 -- (-533.146) (-527.234) [-531.744] (-527.894) * (-534.104) (-531.269) [-526.846] (-530.365) -- 0:00:12
781000 -- [-528.440] (-528.231) (-530.224) (-527.496) * [-529.112] (-532.035) (-526.889) (-530.694) -- 0:00:12
781500 -- (-528.836) [-531.818] (-529.940) (-527.757) * (-529.456) (-529.166) [-528.110] (-529.583) -- 0:00:12
782000 -- (-528.504) [-532.706] (-530.599) (-531.790) * (-534.643) (-532.993) (-529.466) [-528.808] -- 0:00:12
782500 -- (-529.850) (-532.465) [-531.264] (-531.920) * (-529.471) [-532.983] (-528.454) (-532.096) -- 0:00:12
783000 -- (-529.143) (-533.709) (-528.080) [-530.181] * (-528.852) (-532.527) (-532.069) [-527.694] -- 0:00:12
783500 -- [-529.948] (-534.118) (-527.563) (-527.553) * [-528.254] (-530.823) (-528.518) (-530.335) -- 0:00:12
784000 -- (-542.069) (-527.798) [-527.371] (-532.078) * (-528.156) (-529.464) [-527.003] (-530.114) -- 0:00:12
784500 -- (-532.915) (-530.109) (-528.820) [-532.951] * [-530.500] (-528.314) (-530.545) (-529.951) -- 0:00:12
785000 -- (-529.491) (-528.966) [-527.854] (-531.325) * (-528.779) [-531.853] (-527.687) (-531.286) -- 0:00:12
Average standard deviation of split frequencies: 0.007357
785500 -- (-528.728) (-531.536) [-528.562] (-530.868) * (-528.613) (-530.612) (-527.914) [-529.998] -- 0:00:12
786000 -- [-534.163] (-527.354) (-529.675) (-528.704) * (-529.918) (-531.324) [-527.334] (-532.817) -- 0:00:12
786500 -- (-528.428) (-527.188) [-528.691] (-528.705) * [-526.943] (-529.947) (-531.393) (-527.978) -- 0:00:12
787000 -- (-530.909) [-527.318] (-527.923) (-531.918) * [-530.076] (-529.447) (-527.087) (-528.351) -- 0:00:12
787500 -- [-527.582] (-530.355) (-528.234) (-529.319) * (-528.399) (-528.283) [-527.406] (-529.155) -- 0:00:12
788000 -- [-529.829] (-527.921) (-529.270) (-529.823) * (-531.579) (-533.186) [-527.284] (-527.248) -- 0:00:12
788500 -- [-529.459] (-531.343) (-530.399) (-529.226) * (-534.367) (-527.375) (-532.966) [-532.043] -- 0:00:12
789000 -- (-528.424) [-528.264] (-531.749) (-532.235) * [-531.836] (-528.907) (-530.656) (-529.443) -- 0:00:12
789500 -- [-529.363] (-529.261) (-532.820) (-527.949) * (-527.286) (-528.370) (-532.837) [-528.389] -- 0:00:12
790000 -- (-529.905) (-529.780) [-528.898] (-528.493) * (-528.214) (-528.351) (-528.307) [-528.738] -- 0:00:12
Average standard deviation of split frequencies: 0.007115
790500 -- (-530.410) (-532.605) [-529.407] (-530.298) * (-528.197) (-529.840) (-528.304) [-528.416] -- 0:00:12
791000 -- [-528.744] (-528.011) (-527.424) (-530.450) * (-527.807) [-531.014] (-528.803) (-529.386) -- 0:00:12
791500 -- [-527.759] (-527.543) (-527.865) (-530.025) * [-528.305] (-527.426) (-528.771) (-528.811) -- 0:00:12
792000 -- (-531.110) (-530.906) [-528.652] (-529.588) * (-529.717) (-528.595) [-527.342] (-531.655) -- 0:00:12
792500 -- (-532.155) (-528.850) (-527.970) [-529.166] * (-529.060) (-529.866) (-529.298) [-530.761] -- 0:00:12
793000 -- (-533.137) (-528.296) [-527.804] (-527.886) * (-529.027) (-529.120) [-528.114] (-527.798) -- 0:00:12
793500 -- [-529.435] (-528.665) (-528.082) (-531.205) * (-537.409) (-530.281) [-530.270] (-527.466) -- 0:00:11
794000 -- (-528.969) (-527.499) (-528.917) [-529.304] * (-533.653) [-530.484] (-531.637) (-527.637) -- 0:00:11
794500 -- (-528.879) [-528.502] (-531.018) (-531.430) * (-528.799) (-529.785) [-528.185] (-528.081) -- 0:00:11
795000 -- (-530.769) (-529.348) (-528.999) [-530.039] * (-528.321) (-530.275) [-529.407] (-527.824) -- 0:00:12
Average standard deviation of split frequencies: 0.006909
795500 -- (-530.316) (-528.799) (-529.373) [-530.367] * (-531.299) [-529.392] (-528.792) (-531.228) -- 0:00:12
796000 -- (-529.215) [-529.158] (-529.326) (-529.420) * (-528.099) (-531.954) [-526.801] (-532.861) -- 0:00:12
796500 -- (-528.272) (-527.913) [-529.543] (-532.859) * (-532.224) (-529.478) (-527.537) [-529.379] -- 0:00:12
797000 -- (-529.922) (-528.724) [-531.147] (-530.194) * (-533.922) (-528.194) (-527.337) [-530.143] -- 0:00:11
797500 -- (-528.298) [-527.153] (-528.105) (-527.853) * [-529.312] (-530.127) (-527.272) (-539.710) -- 0:00:11
798000 -- (-529.884) (-527.910) (-533.196) [-529.545] * (-529.962) [-528.974] (-533.452) (-527.932) -- 0:00:11
798500 -- (-533.713) (-528.081) [-529.548] (-531.950) * [-529.722] (-530.876) (-531.051) (-527.911) -- 0:00:11
799000 -- (-528.205) (-530.334) (-531.739) [-528.839] * [-528.841] (-528.447) (-530.863) (-528.702) -- 0:00:11
799500 -- [-535.134] (-528.051) (-528.829) (-531.273) * (-527.225) [-528.447] (-530.007) (-527.617) -- 0:00:11
800000 -- (-529.657) (-529.504) (-528.962) [-527.563] * (-530.616) (-529.045) (-529.168) [-527.622] -- 0:00:11
Average standard deviation of split frequencies: 0.006869
800500 -- (-528.836) (-528.648) [-528.610] (-530.429) * (-535.398) (-529.687) [-533.237] (-529.548) -- 0:00:11
801000 -- (-528.185) (-531.300) [-530.507] (-528.085) * [-529.886] (-529.758) (-534.616) (-527.054) -- 0:00:11
801500 -- (-527.692) (-531.213) (-528.572) [-529.016] * (-529.354) (-529.804) [-530.595] (-529.780) -- 0:00:11
802000 -- (-526.880) (-530.235) (-530.686) [-527.573] * [-527.370] (-528.100) (-534.127) (-530.457) -- 0:00:11
802500 -- (-527.736) (-529.217) [-527.940] (-529.927) * [-528.547] (-535.761) (-533.988) (-527.947) -- 0:00:11
803000 -- (-534.431) [-529.335] (-527.331) (-532.437) * [-528.024] (-527.397) (-529.692) (-527.370) -- 0:00:11
803500 -- (-528.415) (-529.840) [-531.652] (-530.398) * (-528.078) (-528.847) [-530.985] (-531.622) -- 0:00:11
804000 -- (-528.866) (-528.354) (-530.732) [-528.832] * [-529.485] (-529.051) (-531.202) (-527.559) -- 0:00:11
804500 -- (-528.699) (-528.374) (-528.717) [-528.474] * [-527.786] (-528.845) (-530.363) (-528.241) -- 0:00:11
805000 -- (-528.255) (-526.843) (-527.899) [-528.115] * (-532.560) [-530.448] (-528.200) (-529.541) -- 0:00:11
Average standard deviation of split frequencies: 0.006784
805500 -- (-529.513) (-531.759) (-531.105) [-531.048] * (-530.796) [-527.297] (-530.421) (-528.324) -- 0:00:11
806000 -- (-528.965) [-526.731] (-528.345) (-528.287) * (-529.199) [-527.755] (-528.654) (-530.648) -- 0:00:11
806500 -- (-530.259) [-527.527] (-527.431) (-528.592) * [-529.125] (-528.642) (-527.777) (-529.116) -- 0:00:11
807000 -- (-529.768) [-527.294] (-527.941) (-531.126) * [-527.857] (-530.040) (-528.149) (-529.577) -- 0:00:11
807500 -- (-529.831) [-530.396] (-527.788) (-528.013) * (-530.363) (-529.564) (-528.290) [-532.203] -- 0:00:11
808000 -- (-529.799) (-531.209) [-529.061] (-532.125) * (-533.206) (-528.478) [-527.645] (-527.829) -- 0:00:11
808500 -- (-528.704) (-531.180) (-532.295) [-532.051] * (-528.343) [-531.003] (-527.186) (-528.259) -- 0:00:11
809000 -- (-531.555) (-530.668) [-527.746] (-528.577) * (-532.858) (-527.960) (-528.265) [-527.302] -- 0:00:11
809500 -- (-529.137) (-536.774) (-527.224) [-530.935] * (-527.767) (-532.177) [-528.662] (-528.901) -- 0:00:11
810000 -- [-528.614] (-532.874) (-529.182) (-528.205) * [-528.196] (-528.308) (-528.828) (-527.357) -- 0:00:11
Average standard deviation of split frequencies: 0.006397
810500 -- (-529.340) (-528.911) [-529.147] (-529.015) * (-528.950) (-538.332) [-528.903] (-529.840) -- 0:00:10
811000 -- [-528.846] (-528.601) (-527.765) (-528.495) * [-530.326] (-529.250) (-527.196) (-527.701) -- 0:00:10
811500 -- (-529.158) [-528.336] (-534.164) (-529.289) * (-529.315) (-530.129) [-527.096] (-534.891) -- 0:00:10
812000 -- (-531.283) [-529.791] (-535.133) (-529.306) * (-529.296) [-533.079] (-530.589) (-528.384) -- 0:00:11
812500 -- [-531.583] (-530.516) (-531.136) (-530.104) * (-528.518) [-527.489] (-529.792) (-529.840) -- 0:00:11
813000 -- (-527.004) (-529.190) [-530.675] (-529.738) * [-529.127] (-531.310) (-527.887) (-527.432) -- 0:00:11
813500 -- (-531.072) [-527.482] (-529.862) (-532.003) * [-530.357] (-532.709) (-528.154) (-528.952) -- 0:00:11
814000 -- [-528.959] (-528.189) (-529.742) (-529.599) * (-529.909) (-533.579) [-528.222] (-528.493) -- 0:00:10
814500 -- (-535.387) (-527.634) (-530.245) [-529.627] * (-529.643) (-527.323) (-530.056) [-529.462] -- 0:00:10
815000 -- (-531.716) (-527.915) [-528.574] (-527.933) * (-529.176) (-528.144) [-530.825] (-528.476) -- 0:00:10
Average standard deviation of split frequencies: 0.006680
815500 -- (-530.369) (-528.420) [-527.247] (-529.415) * (-528.785) (-526.914) [-531.240] (-529.398) -- 0:00:10
816000 -- (-529.047) (-529.345) (-531.091) [-528.033] * (-530.555) [-527.007] (-530.119) (-529.010) -- 0:00:10
816500 -- [-527.712] (-527.628) (-528.122) (-529.356) * (-532.984) (-528.459) [-529.576] (-528.574) -- 0:00:10
817000 -- (-527.711) (-529.167) (-528.440) [-530.712] * (-539.943) (-528.508) (-528.684) [-529.916] -- 0:00:10
817500 -- (-528.849) (-528.356) [-528.527] (-531.951) * (-536.536) (-529.615) [-531.167] (-528.962) -- 0:00:10
818000 -- (-532.024) [-528.119] (-528.695) (-529.188) * (-529.160) (-527.824) (-532.373) [-528.734] -- 0:00:10
818500 -- (-528.687) (-530.043) (-533.275) [-528.547] * (-528.896) [-528.507] (-530.180) (-530.538) -- 0:00:10
819000 -- (-529.316) (-528.121) (-526.992) [-530.469] * (-529.285) (-528.270) [-527.563] (-531.492) -- 0:00:10
819500 -- (-528.828) [-528.686] (-527.555) (-528.560) * [-532.008] (-531.257) (-528.737) (-529.404) -- 0:00:10
820000 -- (-530.940) [-530.220] (-528.577) (-528.787) * [-530.536] (-528.931) (-527.274) (-529.016) -- 0:00:10
Average standard deviation of split frequencies: 0.007001
820500 -- (-529.326) [-529.947] (-533.625) (-530.492) * (-527.908) [-528.775] (-527.080) (-534.087) -- 0:00:10
821000 -- (-532.050) (-528.509) [-533.921] (-531.454) * (-527.482) (-530.612) (-528.491) [-528.707] -- 0:00:10
821500 -- (-527.775) (-528.132) (-536.250) [-528.643] * (-528.068) (-531.325) (-530.269) [-529.133] -- 0:00:10
822000 -- (-528.927) (-528.251) [-527.804] (-527.433) * (-527.477) (-531.658) [-528.353] (-528.820) -- 0:00:10
822500 -- (-528.084) (-531.965) [-528.030] (-527.905) * (-529.204) (-529.372) [-528.132] (-528.649) -- 0:00:10
823000 -- (-528.984) (-529.480) (-529.629) [-527.767] * (-528.949) (-527.413) [-529.016] (-530.896) -- 0:00:10
823500 -- [-527.009] (-532.714) (-528.618) (-532.871) * (-528.066) (-528.891) [-530.394] (-528.495) -- 0:00:10
824000 -- (-527.840) (-532.426) (-528.659) [-527.784] * (-528.302) (-528.058) (-530.062) [-527.872] -- 0:00:10
824500 -- (-529.167) (-529.142) [-528.026] (-527.669) * (-527.387) (-528.833) (-529.765) [-529.476] -- 0:00:10
825000 -- (-528.759) (-528.958) (-527.529) [-527.706] * [-528.689] (-530.409) (-528.872) (-528.772) -- 0:00:10
Average standard deviation of split frequencies: 0.006848
825500 -- (-528.009) (-528.777) (-529.802) [-527.579] * (-529.017) (-527.420) [-529.812] (-532.324) -- 0:00:10
826000 -- [-529.752] (-531.130) (-527.994) (-529.672) * (-529.679) (-529.361) (-527.334) [-532.308] -- 0:00:10
826500 -- (-528.693) (-539.461) (-527.725) [-527.783] * [-528.803] (-526.991) (-528.888) (-532.114) -- 0:00:10
827000 -- [-528.065] (-531.606) (-527.615) (-531.280) * (-530.385) (-527.280) (-527.577) [-533.557] -- 0:00:10
827500 -- (-529.327) (-531.516) [-529.219] (-528.771) * (-528.032) (-528.931) [-527.532] (-536.563) -- 0:00:10
828000 -- (-529.141) (-530.364) (-531.463) [-531.025] * (-527.212) [-528.733] (-528.042) (-532.826) -- 0:00:09
828500 -- (-529.803) (-531.890) (-528.235) [-532.205] * (-526.753) (-528.707) [-531.688] (-529.458) -- 0:00:09
829000 -- (-528.184) [-533.013] (-528.163) (-531.536) * (-530.594) (-530.300) (-527.419) [-528.310] -- 0:00:10
829500 -- (-528.164) (-534.368) (-529.946) [-527.731] * (-529.475) [-529.320] (-528.099) (-530.212) -- 0:00:10
830000 -- [-530.575] (-527.520) (-528.235) (-529.022) * (-528.272) (-528.789) (-530.676) [-528.932] -- 0:00:10
Average standard deviation of split frequencies: 0.007129
830500 -- (-528.703) (-529.258) (-528.793) [-528.068] * [-528.124] (-528.628) (-529.514) (-529.209) -- 0:00:10
831000 -- (-531.547) (-528.392) (-530.706) [-527.563] * (-532.943) [-529.131] (-529.587) (-528.385) -- 0:00:09
831500 -- (-529.820) (-527.771) [-527.445] (-527.472) * (-529.218) [-529.769] (-531.228) (-529.627) -- 0:00:09
832000 -- (-527.396) (-526.807) (-528.994) [-529.539] * (-533.309) (-531.691) [-528.268] (-528.643) -- 0:00:09
832500 -- (-527.085) (-527.876) [-527.606] (-529.798) * [-529.343] (-528.800) (-529.714) (-528.247) -- 0:00:09
833000 -- (-526.693) (-529.775) (-528.114) [-527.784] * (-531.533) (-528.658) (-528.240) [-528.626] -- 0:00:09
833500 -- [-527.677] (-532.358) (-528.888) (-531.085) * (-530.017) [-531.919] (-529.028) (-528.299) -- 0:00:09
834000 -- (-529.020) (-531.383) (-528.612) [-528.923] * [-528.128] (-530.521) (-527.370) (-532.223) -- 0:00:09
834500 -- [-528.082] (-527.717) (-529.843) (-530.651) * (-533.103) (-531.351) (-527.124) [-531.582] -- 0:00:09
835000 -- (-529.582) (-529.224) (-528.510) [-529.954] * (-529.686) (-529.059) [-526.864] (-528.892) -- 0:00:09
Average standard deviation of split frequencies: 0.006802
835500 -- (-534.623) (-530.590) (-528.185) [-529.216] * [-530.327] (-530.695) (-529.913) (-527.881) -- 0:00:09
836000 -- (-529.998) (-527.433) (-528.053) [-529.081] * [-528.449] (-529.589) (-531.575) (-527.366) -- 0:00:09
836500 -- [-528.323] (-529.101) (-529.018) (-527.848) * [-531.948] (-527.976) (-533.005) (-532.761) -- 0:00:09
837000 -- (-528.220) (-528.935) (-528.163) [-528.635] * (-532.637) (-527.532) (-528.704) [-529.634] -- 0:00:09
837500 -- (-529.886) [-527.103] (-530.057) (-531.360) * (-531.396) (-528.006) (-527.307) [-530.203] -- 0:00:09
838000 -- (-529.972) [-527.238] (-531.123) (-530.898) * (-527.996) [-527.346] (-528.980) (-528.134) -- 0:00:09
838500 -- (-530.344) (-526.918) (-530.838) [-528.570] * (-530.297) [-530.833] (-533.071) (-531.325) -- 0:00:09
839000 -- (-533.253) (-527.922) [-530.170] (-533.392) * (-528.074) (-527.635) [-529.719] (-527.586) -- 0:00:09
839500 -- (-528.482) (-529.426) [-529.591] (-531.595) * [-529.640] (-528.611) (-527.904) (-530.866) -- 0:00:09
840000 -- (-529.595) [-527.863] (-532.209) (-527.859) * (-528.372) [-529.705] (-530.639) (-530.175) -- 0:00:09
Average standard deviation of split frequencies: 0.006659
840500 -- [-529.275] (-528.304) (-529.589) (-527.828) * [-529.008] (-530.203) (-528.389) (-528.419) -- 0:00:09
841000 -- (-529.119) (-527.171) (-529.653) [-527.608] * (-528.303) [-531.096] (-528.906) (-531.381) -- 0:00:09
841500 -- (-532.278) [-529.134] (-530.005) (-528.772) * (-529.421) (-530.738) [-529.147] (-529.682) -- 0:00:09
842000 -- (-529.603) (-531.044) (-528.624) [-529.540] * (-527.771) (-529.999) (-529.866) [-530.861] -- 0:00:09
842500 -- (-531.220) (-528.446) [-531.833] (-529.489) * (-528.850) [-528.600] (-530.405) (-533.092) -- 0:00:09
843000 -- (-528.261) (-530.500) (-528.556) [-533.397] * (-533.085) [-529.170] (-529.888) (-530.574) -- 0:00:09
843500 -- (-528.119) (-529.033) [-529.529] (-532.934) * (-529.253) [-527.832] (-529.330) (-529.777) -- 0:00:09
844000 -- (-531.373) [-528.644] (-529.423) (-529.950) * (-527.309) (-528.388) [-529.846] (-528.505) -- 0:00:09
844500 -- [-527.402] (-528.959) (-533.299) (-530.610) * (-528.039) (-527.292) (-528.686) [-529.337] -- 0:00:09
845000 -- (-527.145) [-529.874] (-530.400) (-532.221) * (-529.828) [-527.313] (-527.291) (-531.511) -- 0:00:08
Average standard deviation of split frequencies: 0.006652
845500 -- (-527.240) (-530.299) [-528.989] (-527.720) * (-528.275) (-527.659) (-532.262) [-530.173] -- 0:00:08
846000 -- (-529.001) (-534.093) [-532.604] (-528.267) * (-527.957) (-528.330) (-529.407) [-527.840] -- 0:00:09
846500 -- (-528.071) [-527.942] (-530.011) (-529.667) * (-530.061) (-527.748) [-530.292] (-528.878) -- 0:00:09
847000 -- (-528.623) [-528.995] (-529.643) (-531.505) * [-533.000] (-526.919) (-528.266) (-528.907) -- 0:00:09
847500 -- (-527.555) (-528.703) (-528.536) [-529.072] * (-535.386) [-529.909] (-537.147) (-527.003) -- 0:00:08
848000 -- (-528.968) [-527.554] (-527.722) (-531.268) * (-528.931) (-528.124) (-537.677) [-528.275] -- 0:00:08
848500 -- (-530.222) (-530.028) [-528.890] (-527.470) * (-529.331) (-529.868) [-527.933] (-528.558) -- 0:00:08
849000 -- (-531.450) [-538.275] (-528.197) (-528.232) * [-530.360] (-527.549) (-529.636) (-531.575) -- 0:00:08
849500 -- (-528.407) [-527.845] (-532.405) (-528.994) * (-529.918) (-533.475) [-529.557] (-528.424) -- 0:00:08
850000 -- [-528.114] (-528.508) (-531.642) (-527.035) * (-528.363) [-527.446] (-531.649) (-527.205) -- 0:00:08
Average standard deviation of split frequencies: 0.006407
850500 -- (-528.131) [-530.287] (-529.170) (-532.735) * (-527.606) (-529.742) [-528.617] (-527.466) -- 0:00:08
851000 -- (-528.387) [-530.258] (-537.337) (-530.687) * (-528.666) (-531.097) (-527.211) [-530.246] -- 0:00:08
851500 -- (-531.044) [-530.327] (-528.190) (-529.610) * [-528.683] (-529.876) (-527.497) (-531.531) -- 0:00:08
852000 -- (-530.833) (-530.498) [-530.577] (-530.741) * (-529.622) (-529.075) (-531.958) [-531.812] -- 0:00:08
852500 -- (-527.541) (-530.370) [-529.264] (-527.728) * (-531.320) (-527.754) (-528.958) [-533.652] -- 0:00:08
853000 -- (-530.999) [-528.142] (-532.812) (-531.472) * [-530.613] (-529.189) (-529.069) (-530.501) -- 0:00:08
853500 -- (-530.732) (-529.098) [-528.858] (-527.853) * (-540.589) (-527.312) (-530.194) [-530.348] -- 0:00:08
854000 -- (-529.770) [-527.969] (-527.425) (-533.203) * (-528.043) (-527.424) (-529.141) [-527.700] -- 0:00:08
854500 -- (-530.285) (-533.301) [-527.674] (-531.802) * (-531.561) [-531.422] (-530.943) (-529.154) -- 0:00:08
855000 -- (-527.864) (-529.266) [-528.781] (-528.868) * (-529.086) (-532.184) [-529.613] (-530.398) -- 0:00:08
Average standard deviation of split frequencies: 0.006746
855500 -- (-530.984) (-531.598) (-529.128) [-531.702] * (-533.701) (-530.762) [-528.030] (-527.882) -- 0:00:08
856000 -- (-527.726) [-529.814] (-528.313) (-530.756) * [-528.427] (-531.378) (-528.256) (-527.697) -- 0:00:08
856500 -- (-527.480) (-529.573) (-531.838) [-530.547] * [-532.875] (-528.780) (-528.885) (-530.354) -- 0:00:08
857000 -- (-528.156) (-529.543) (-528.768) [-529.914] * [-528.749] (-528.164) (-527.986) (-531.947) -- 0:00:08
857500 -- (-528.237) (-527.362) (-535.530) [-530.078] * [-528.636] (-535.589) (-529.195) (-529.261) -- 0:00:08
858000 -- (-528.286) [-527.117] (-527.781) (-527.422) * (-529.092) [-529.320] (-528.947) (-531.338) -- 0:00:08
858500 -- (-529.332) [-527.306] (-531.736) (-530.423) * (-528.519) (-532.911) (-527.426) [-528.379] -- 0:00:08
859000 -- (-527.361) [-529.387] (-528.889) (-527.290) * (-528.156) [-529.798] (-527.155) (-530.048) -- 0:00:08
859500 -- [-529.569] (-528.845) (-529.025) (-528.943) * [-529.073] (-528.843) (-529.056) (-530.368) -- 0:00:08
860000 -- [-530.857] (-530.182) (-534.463) (-527.671) * (-533.637) [-532.076] (-527.780) (-532.514) -- 0:00:08
Average standard deviation of split frequencies: 0.006367
860500 -- (-527.878) (-529.435) (-527.019) [-527.713] * (-532.006) [-529.653] (-530.578) (-530.495) -- 0:00:08
861000 -- (-528.944) (-531.100) (-531.069) [-528.518] * (-528.765) [-528.640] (-528.596) (-529.743) -- 0:00:08
861500 -- (-529.406) (-530.535) (-528.753) [-527.206] * (-527.752) [-530.037] (-527.495) (-528.418) -- 0:00:08
862000 -- (-527.513) (-530.823) (-530.352) [-529.603] * (-531.143) (-529.519) (-533.578) [-528.104] -- 0:00:08
862500 -- (-528.683) (-529.236) (-528.828) [-527.256] * (-536.837) (-532.948) [-529.589] (-530.938) -- 0:00:07
863000 -- [-530.455] (-533.072) (-528.302) (-528.619) * (-527.843) (-528.184) (-529.233) [-531.334] -- 0:00:08
863500 -- (-531.934) (-528.815) [-529.619] (-526.840) * (-527.746) [-527.227] (-530.711) (-527.414) -- 0:00:08
864000 -- (-529.722) [-528.443] (-532.398) (-526.976) * [-532.432] (-528.144) (-529.246) (-527.503) -- 0:00:08
864500 -- (-528.734) (-530.005) (-527.885) [-527.319] * (-528.231) [-528.930] (-528.004) (-530.993) -- 0:00:07
865000 -- [-528.341] (-527.734) (-529.899) (-527.882) * (-530.709) (-527.316) (-527.973) [-527.637] -- 0:00:07
Average standard deviation of split frequencies: 0.006396
865500 -- [-529.285] (-528.213) (-530.574) (-527.306) * (-529.281) [-528.416] (-536.938) (-529.517) -- 0:00:07
866000 -- (-529.648) (-531.723) (-532.319) [-529.001] * (-527.457) [-528.917] (-529.706) (-527.387) -- 0:00:07
866500 -- (-531.767) (-533.507) [-531.431] (-528.050) * [-532.775] (-527.837) (-533.064) (-528.774) -- 0:00:07
867000 -- (-533.796) (-533.166) (-532.623) [-529.390] * (-531.430) [-529.439] (-530.550) (-529.457) -- 0:00:07
867500 -- (-530.374) (-528.819) (-530.491) [-528.457] * (-527.574) (-528.467) (-529.050) [-528.967] -- 0:00:07
868000 -- (-529.807) [-531.735] (-532.535) (-530.178) * (-528.563) (-530.745) [-527.748] (-527.882) -- 0:00:07
868500 -- [-530.096] (-530.450) (-529.387) (-528.045) * [-529.149] (-532.068) (-528.738) (-530.984) -- 0:00:07
869000 -- [-527.273] (-527.469) (-530.631) (-530.248) * (-528.902) (-531.387) [-527.210] (-532.178) -- 0:00:07
869500 -- (-529.399) (-527.754) [-527.977] (-527.091) * [-531.714] (-529.382) (-530.229) (-529.713) -- 0:00:07
870000 -- (-528.314) (-529.315) (-529.612) [-528.557] * (-530.692) (-534.761) [-528.381] (-529.919) -- 0:00:07
Average standard deviation of split frequencies: 0.006328
870500 -- (-529.174) (-530.475) (-532.654) [-529.400] * (-531.654) (-528.554) [-529.058] (-534.482) -- 0:00:07
871000 -- (-530.057) (-528.396) (-527.340) [-528.624] * [-532.192] (-527.701) (-527.775) (-530.659) -- 0:00:07
871500 -- (-529.900) (-529.805) (-529.838) [-534.759] * [-530.444] (-527.714) (-527.830) (-531.057) -- 0:00:07
872000 -- [-530.265] (-531.931) (-531.533) (-531.152) * (-535.183) (-527.447) (-528.654) [-528.685] -- 0:00:07
872500 -- (-529.133) (-527.953) (-529.491) [-530.838] * [-527.466] (-530.097) (-528.973) (-527.146) -- 0:00:07
873000 -- (-527.342) (-528.041) (-529.389) [-529.184] * (-528.501) (-529.931) (-529.780) [-529.075] -- 0:00:07
873500 -- (-528.019) (-528.377) (-527.483) [-527.057] * (-532.821) (-531.385) [-529.342] (-527.850) -- 0:00:07
874000 -- (-528.947) (-529.838) (-529.764) [-526.891] * (-531.484) [-527.847] (-529.610) (-529.997) -- 0:00:07
874500 -- (-528.318) [-531.325] (-534.231) (-528.680) * (-530.023) (-535.318) [-527.807] (-531.289) -- 0:00:07
875000 -- (-532.911) [-527.396] (-531.961) (-527.543) * [-530.263] (-529.704) (-528.194) (-530.989) -- 0:00:07
Average standard deviation of split frequencies: 0.006323
875500 -- (-527.321) [-531.466] (-531.400) (-527.789) * [-531.528] (-530.919) (-530.900) (-531.033) -- 0:00:07
876000 -- [-528.326] (-527.143) (-530.451) (-532.351) * [-529.241] (-531.304) (-528.738) (-530.323) -- 0:00:07
876500 -- (-531.362) (-530.741) (-530.848) [-535.588] * (-532.262) [-530.925] (-529.944) (-531.867) -- 0:00:07
877000 -- [-530.812] (-529.950) (-529.407) (-529.944) * (-527.561) [-527.597] (-528.246) (-530.178) -- 0:00:07
877500 -- (-528.146) [-532.519] (-531.824) (-532.998) * (-530.363) (-527.480) [-529.437] (-532.319) -- 0:00:07
878000 -- (-529.010) [-528.107] (-528.688) (-531.024) * (-529.118) [-532.853] (-528.747) (-529.368) -- 0:00:07
878500 -- (-527.280) [-527.845] (-529.482) (-529.373) * (-530.944) (-530.298) [-531.584] (-528.518) -- 0:00:07
879000 -- (-531.229) [-527.568] (-528.755) (-527.171) * (-528.367) (-533.663) [-533.782] (-528.765) -- 0:00:07
879500 -- [-529.618] (-527.411) (-529.200) (-529.008) * (-529.927) (-530.124) [-530.603] (-528.023) -- 0:00:06
880000 -- (-527.624) (-533.813) (-527.847) [-529.217] * (-532.241) (-527.127) [-527.696] (-529.020) -- 0:00:07
Average standard deviation of split frequencies: 0.006316
880500 -- (-530.155) [-533.089] (-530.911) (-528.017) * (-528.654) [-528.487] (-530.075) (-535.033) -- 0:00:07
881000 -- (-527.123) (-531.183) (-529.861) [-528.667] * (-529.285) [-529.819] (-528.546) (-531.918) -- 0:00:07
881500 -- [-530.744] (-529.416) (-527.501) (-530.904) * (-529.637) (-527.821) [-528.907] (-528.120) -- 0:00:06
882000 -- (-532.875) (-531.711) (-530.012) [-528.217] * (-532.819) (-530.914) [-529.657] (-532.997) -- 0:00:06
882500 -- (-528.609) [-531.400] (-529.958) (-528.046) * (-534.098) (-530.704) [-530.003] (-528.786) -- 0:00:06
883000 -- (-529.516) (-529.548) [-529.962] (-527.663) * [-529.325] (-528.298) (-528.924) (-533.935) -- 0:00:06
883500 -- (-530.621) (-529.537) (-530.861) [-529.244] * (-528.526) (-529.405) (-532.110) [-532.457] -- 0:00:06
884000 -- (-532.179) (-528.637) (-530.469) [-528.950] * [-530.882] (-530.481) (-530.688) (-532.249) -- 0:00:06
884500 -- (-527.735) (-527.811) (-533.146) [-529.042] * (-528.263) (-529.629) (-528.361) [-528.663] -- 0:00:06
885000 -- (-531.514) [-527.772] (-530.214) (-531.455) * (-529.365) (-534.028) (-528.172) [-528.442] -- 0:00:06
Average standard deviation of split frequencies: 0.006572
885500 -- [-531.230] (-528.957) (-528.982) (-528.376) * (-529.023) (-534.395) (-532.076) [-530.153] -- 0:00:06
886000 -- (-530.949) (-528.593) [-531.342] (-529.168) * (-532.503) [-531.188] (-529.494) (-532.583) -- 0:00:06
886500 -- (-529.316) (-527.653) (-527.843) [-528.121] * (-530.471) [-531.681] (-527.904) (-529.484) -- 0:00:06
887000 -- [-527.977] (-528.958) (-529.061) (-529.444) * (-530.136) (-530.539) (-529.348) [-528.049] -- 0:00:06
887500 -- (-528.443) (-530.804) [-527.425] (-529.094) * (-533.339) [-526.950] (-527.277) (-530.870) -- 0:00:06
888000 -- (-529.017) (-530.511) (-528.338) [-530.157] * [-527.837] (-527.412) (-529.459) (-528.781) -- 0:00:06
888500 -- [-527.632] (-534.158) (-529.497) (-529.268) * (-531.965) [-527.266] (-528.892) (-527.524) -- 0:00:06
889000 -- [-527.173] (-530.061) (-529.448) (-530.771) * (-530.205) (-529.051) [-528.276] (-529.111) -- 0:00:06
889500 -- (-526.900) (-527.291) (-529.306) [-534.447] * (-529.247) (-529.182) [-528.234] (-527.939) -- 0:00:06
890000 -- (-529.481) (-527.210) [-529.118] (-534.951) * (-527.021) [-529.838] (-528.718) (-528.866) -- 0:00:06
Average standard deviation of split frequencies: 0.006087
890500 -- [-527.175] (-527.505) (-531.317) (-536.222) * [-527.879] (-527.112) (-528.273) (-530.144) -- 0:00:06
891000 -- (-530.119) (-527.606) [-528.831] (-529.970) * (-528.407) (-528.333) (-529.082) [-531.151] -- 0:00:06
891500 -- (-530.107) (-528.240) [-528.051] (-530.941) * (-529.514) (-529.581) (-530.002) [-527.478] -- 0:00:06
892000 -- (-528.335) [-527.871] (-528.936) (-532.593) * [-529.357] (-529.490) (-527.906) (-528.531) -- 0:00:06
892500 -- (-528.922) [-527.782] (-529.319) (-538.328) * (-533.511) (-531.211) (-529.234) [-530.681] -- 0:00:06
893000 -- (-528.479) [-528.073] (-530.025) (-529.414) * (-532.619) (-528.121) [-527.743] (-529.531) -- 0:00:06
893500 -- [-528.028] (-528.934) (-528.049) (-528.327) * (-530.151) [-529.179] (-528.508) (-529.605) -- 0:00:06
894000 -- (-527.881) (-533.661) (-530.723) [-529.289] * [-527.401] (-529.223) (-529.520) (-529.170) -- 0:00:06
894500 -- (-528.121) (-532.546) [-528.988] (-533.901) * (-528.550) (-528.744) [-528.042] (-528.717) -- 0:00:06
895000 -- (-532.141) [-528.357] (-532.954) (-532.027) * (-528.061) [-527.812] (-529.267) (-532.364) -- 0:00:06
Average standard deviation of split frequencies: 0.005853
895500 -- (-529.344) (-528.622) [-530.707] (-531.612) * (-528.061) (-528.983) (-532.985) [-529.922] -- 0:00:06
896000 -- (-527.993) (-528.416) [-529.815] (-529.032) * [-527.845] (-532.891) (-532.305) (-526.989) -- 0:00:06
896500 -- (-528.798) (-528.647) [-527.818] (-527.666) * (-527.073) (-530.148) [-528.940] (-528.931) -- 0:00:06
897000 -- (-529.657) (-527.819) (-528.750) [-527.754] * (-530.140) (-533.364) (-528.744) [-534.739] -- 0:00:06
897500 -- [-530.739] (-532.101) (-527.909) (-527.857) * (-530.131) (-534.481) (-528.055) [-529.196] -- 0:00:06
898000 -- (-527.920) (-529.106) [-527.983] (-529.806) * (-530.139) [-532.825] (-528.171) (-533.150) -- 0:00:06
898500 -- (-527.833) (-532.326) [-528.756] (-528.832) * (-528.324) (-530.592) [-530.269] (-529.371) -- 0:00:05
899000 -- [-529.403] (-529.994) (-530.915) (-529.703) * (-528.420) (-529.128) (-528.873) [-527.974] -- 0:00:05
899500 -- (-530.788) (-530.162) (-528.166) [-534.315] * (-534.274) (-529.951) (-527.410) [-528.806] -- 0:00:05
900000 -- (-530.633) [-530.540] (-529.038) (-534.521) * [-528.639] (-532.580) (-530.217) (-528.398) -- 0:00:05
Average standard deviation of split frequencies: 0.005561
900500 -- (-529.588) (-531.136) (-527.936) [-531.218] * (-530.219) (-531.769) [-527.745] (-530.099) -- 0:00:05
901000 -- (-533.201) (-529.405) [-531.138] (-530.575) * [-527.268] (-530.122) (-527.471) (-527.670) -- 0:00:05
901500 -- (-531.354) (-535.341) [-530.047] (-527.806) * (-527.694) (-529.538) (-530.314) [-528.564] -- 0:00:05
902000 -- (-531.948) (-530.133) (-528.435) [-527.130] * (-527.787) (-532.908) [-527.373] (-528.738) -- 0:00:05
902500 -- [-528.621] (-531.429) (-531.109) (-530.045) * [-531.216] (-528.329) (-527.522) (-532.445) -- 0:00:05
903000 -- (-529.417) (-527.142) (-531.100) [-527.676] * (-529.720) [-529.115] (-530.925) (-527.699) -- 0:00:05
903500 -- [-529.794] (-530.172) (-529.577) (-528.174) * (-531.544) (-531.039) [-529.779] (-528.134) -- 0:00:05
904000 -- (-530.392) (-530.681) [-528.977] (-529.476) * (-531.646) (-528.205) [-528.140] (-528.370) -- 0:00:05
904500 -- [-530.373] (-528.182) (-530.542) (-527.786) * [-532.123] (-528.735) (-530.547) (-529.900) -- 0:00:05
905000 -- (-529.376) [-532.660] (-528.880) (-530.183) * (-530.885) (-529.753) (-534.203) [-530.371] -- 0:00:05
Average standard deviation of split frequencies: 0.005431
905500 -- (-528.996) [-530.936] (-529.036) (-531.815) * (-528.346) (-529.202) [-528.413] (-529.789) -- 0:00:05
906000 -- (-528.595) [-528.930] (-529.127) (-528.527) * (-528.435) (-528.016) [-527.696] (-528.069) -- 0:00:05
906500 -- (-530.635) (-528.891) [-528.164] (-530.402) * (-531.518) (-527.781) [-528.605] (-526.889) -- 0:00:05
907000 -- (-527.645) [-528.314] (-527.955) (-527.915) * [-529.315] (-533.140) (-527.503) (-528.357) -- 0:00:05
907500 -- (-530.311) (-529.650) (-530.637) [-527.134] * (-528.114) [-530.775] (-528.560) (-528.998) -- 0:00:05
908000 -- (-528.928) (-530.862) [-528.375] (-529.002) * (-526.768) [-530.669] (-529.273) (-528.947) -- 0:00:05
908500 -- (-529.576) [-533.868] (-527.392) (-530.717) * (-529.400) [-529.517] (-529.647) (-527.471) -- 0:00:05
909000 -- (-530.128) [-527.464] (-528.370) (-528.493) * (-530.372) (-528.228) (-532.577) [-528.469] -- 0:00:05
909500 -- (-529.692) [-528.770] (-529.122) (-527.312) * (-531.330) (-528.126) [-530.793] (-531.435) -- 0:00:05
910000 -- (-530.461) (-537.242) (-528.276) [-527.923] * (-531.251) [-529.090] (-530.660) (-527.809) -- 0:00:05
Average standard deviation of split frequencies: 0.005763
910500 -- (-528.563) (-529.097) (-531.413) [-526.993] * (-526.874) (-527.138) [-529.290] (-529.877) -- 0:00:05
911000 -- (-535.085) (-527.451) (-533.289) [-526.957] * (-530.069) (-531.032) [-528.299] (-528.585) -- 0:00:05
911500 -- (-527.857) (-529.259) [-529.411] (-529.579) * (-531.883) (-530.547) (-530.381) [-528.252] -- 0:00:05
912000 -- (-533.797) (-533.058) [-528.227] (-528.927) * [-531.637] (-531.750) (-532.688) (-535.245) -- 0:00:05
912500 -- [-529.342] (-531.258) (-529.818) (-530.136) * (-530.163) (-532.453) (-527.333) [-527.794] -- 0:00:05
913000 -- (-528.767) (-531.594) (-528.757) [-528.988] * (-527.402) [-529.072] (-527.677) (-528.821) -- 0:00:05
913500 -- (-530.081) (-529.115) (-528.775) [-527.888] * (-533.064) (-531.375) (-528.403) [-532.099] -- 0:00:05
914000 -- [-528.894] (-528.023) (-530.145) (-528.268) * (-530.125) (-533.597) [-527.016] (-529.421) -- 0:00:05
914500 -- (-529.580) [-528.708] (-527.517) (-529.541) * [-529.047] (-534.370) (-533.877) (-528.625) -- 0:00:05
915000 -- (-527.501) (-529.933) [-528.350] (-527.704) * (-532.562) (-527.835) (-527.849) [-528.731] -- 0:00:05
Average standard deviation of split frequencies: 0.005833
915500 -- [-527.665] (-528.833) (-530.028) (-529.604) * (-528.682) (-531.476) [-528.156] (-529.090) -- 0:00:04
916000 -- (-532.130) (-527.817) (-531.702) [-530.078] * (-529.121) (-530.473) (-528.114) [-528.696] -- 0:00:04
916500 -- [-529.229] (-532.561) (-531.429) (-528.027) * (-530.030) [-529.118] (-527.364) (-529.426) -- 0:00:04
917000 -- (-526.946) (-530.088) (-529.973) [-531.787] * (-528.790) (-528.416) (-530.881) [-530.313] -- 0:00:04
917500 -- (-532.340) (-528.188) (-529.931) [-527.512] * (-528.970) (-527.080) (-534.184) [-529.789] -- 0:00:04
918000 -- (-528.645) (-528.916) [-534.338] (-532.040) * (-528.828) (-528.154) [-531.616] (-529.744) -- 0:00:04
918500 -- (-528.110) [-532.975] (-532.025) (-528.608) * (-528.937) (-529.399) [-530.092] (-528.405) -- 0:00:04
919000 -- (-527.133) (-536.088) [-528.807] (-528.830) * (-528.654) (-529.013) (-528.672) [-527.175] -- 0:00:04
919500 -- (-530.476) (-529.924) [-527.636] (-527.923) * [-529.465] (-531.607) (-528.043) (-529.147) -- 0:00:04
920000 -- (-528.081) (-528.442) [-527.322] (-529.392) * [-527.579] (-531.757) (-527.373) (-529.424) -- 0:00:04
Average standard deviation of split frequencies: 0.005564
920500 -- [-528.607] (-528.900) (-527.937) (-530.369) * (-527.305) (-528.936) (-528.636) [-527.831] -- 0:00:04
921000 -- (-531.161) (-532.356) [-532.087] (-534.147) * (-529.221) (-528.044) (-530.426) [-530.365] -- 0:00:04
921500 -- (-531.807) (-527.708) [-531.436] (-530.738) * [-531.115] (-529.523) (-528.155) (-529.351) -- 0:00:04
922000 -- (-529.014) [-528.822] (-532.735) (-528.987) * (-532.491) [-533.317] (-530.349) (-532.818) -- 0:00:04
922500 -- (-529.721) [-527.240] (-528.511) (-529.098) * (-533.446) [-529.940] (-528.687) (-527.356) -- 0:00:04
923000 -- (-529.442) [-528.584] (-532.042) (-529.305) * (-529.202) (-532.811) [-533.367] (-530.340) -- 0:00:04
923500 -- (-529.341) (-528.270) (-528.071) [-528.143] * [-528.955] (-532.012) (-530.500) (-531.086) -- 0:00:04
924000 -- [-528.524] (-528.484) (-527.451) (-530.687) * (-529.338) (-529.186) [-528.194] (-530.486) -- 0:00:04
924500 -- (-529.324) (-528.233) [-527.358] (-529.381) * (-530.240) (-528.648) (-528.185) [-529.427] -- 0:00:04
925000 -- (-528.624) (-530.389) (-527.175) [-528.534] * (-532.327) [-528.301] (-527.342) (-529.987) -- 0:00:04
Average standard deviation of split frequencies: 0.005803
925500 -- (-531.159) (-528.513) [-527.129] (-528.189) * (-531.299) [-531.156] (-533.453) (-529.499) -- 0:00:04
926000 -- (-531.384) (-533.376) (-527.864) [-528.437] * (-530.286) (-528.471) [-532.974] (-529.744) -- 0:00:04
926500 -- (-531.630) (-531.092) [-527.672] (-534.845) * (-529.927) [-528.348] (-529.008) (-528.391) -- 0:00:04
927000 -- (-528.993) [-533.808] (-528.025) (-528.389) * (-527.764) (-530.588) (-529.637) [-527.965] -- 0:00:04
927500 -- (-529.979) (-533.289) (-529.070) [-528.190] * [-532.003] (-528.297) (-534.908) (-528.085) -- 0:00:04
928000 -- [-528.179] (-529.605) (-527.753) (-528.393) * (-531.970) [-529.188] (-531.518) (-527.057) -- 0:00:04
928500 -- (-527.957) (-529.476) [-529.292] (-528.007) * (-527.547) [-530.977] (-532.625) (-527.593) -- 0:00:04
929000 -- (-530.949) [-532.411] (-531.299) (-528.402) * (-532.050) (-528.104) (-530.406) [-528.746] -- 0:00:04
929500 -- (-529.445) [-529.113] (-532.741) (-529.805) * (-530.055) (-529.285) (-528.943) [-528.609] -- 0:00:04
930000 -- [-529.696] (-531.999) (-527.039) (-528.703) * [-529.285] (-529.109) (-529.666) (-532.119) -- 0:00:04
Average standard deviation of split frequencies: 0.005707
930500 -- (-528.713) (-530.349) (-527.749) [-531.456] * (-528.940) (-532.017) (-529.028) [-529.372] -- 0:00:04
931000 -- (-532.465) [-529.769] (-527.325) (-527.912) * [-529.951] (-531.125) (-528.924) (-527.814) -- 0:00:04
931500 -- (-528.812) (-530.695) (-527.900) [-528.558] * (-528.770) (-534.298) (-530.671) [-529.642] -- 0:00:04
932000 -- (-535.966) (-531.181) [-528.721] (-531.213) * (-531.091) [-528.482] (-533.829) (-529.168) -- 0:00:04
932500 -- (-527.563) (-531.414) (-529.869) [-530.078] * (-529.431) (-529.717) [-528.184] (-529.038) -- 0:00:03
933000 -- [-527.833] (-532.708) (-528.943) (-528.897) * [-528.022] (-530.605) (-530.816) (-527.778) -- 0:00:03
933500 -- (-527.679) (-531.558) (-529.722) [-529.093] * (-528.843) (-531.840) (-530.156) [-528.329] -- 0:00:03
934000 -- (-531.460) [-532.375] (-529.295) (-528.894) * (-527.823) (-530.301) [-530.057] (-526.833) -- 0:00:03
934500 -- [-529.797] (-528.773) (-528.674) (-529.213) * (-527.599) (-529.427) [-530.539] (-528.238) -- 0:00:03
935000 -- (-530.100) (-530.516) [-527.891] (-530.668) * (-528.350) [-527.305] (-528.499) (-528.430) -- 0:00:03
Average standard deviation of split frequencies: 0.005574
935500 -- (-529.557) (-529.937) (-528.457) [-530.552] * (-527.224) (-528.093) (-530.555) [-530.885] -- 0:00:03
936000 -- (-529.885) (-527.840) (-531.669) [-529.404] * (-531.068) [-528.757] (-530.430) (-528.742) -- 0:00:03
936500 -- (-528.082) (-528.867) (-530.103) [-531.387] * (-529.051) (-529.883) [-526.886] (-528.284) -- 0:00:03
937000 -- (-528.197) (-527.279) (-528.263) [-530.994] * (-528.930) (-527.824) (-528.033) [-528.476] -- 0:00:03
937500 -- [-527.788] (-528.997) (-528.500) (-532.525) * [-528.110] (-527.609) (-528.698) (-527.112) -- 0:00:03
938000 -- (-530.512) (-527.816) (-530.914) [-527.576] * (-529.107) [-527.432] (-528.607) (-530.440) -- 0:00:03
938500 -- (-530.732) (-527.199) (-530.317) [-528.499] * (-528.166) (-529.945) (-527.698) [-527.044] -- 0:00:03
939000 -- (-528.700) [-527.764] (-528.452) (-531.749) * (-527.536) [-527.336] (-527.754) (-527.539) -- 0:00:03
939500 -- (-529.856) (-527.978) (-528.130) [-531.983] * [-529.844] (-527.342) (-529.530) (-528.974) -- 0:00:03
940000 -- (-528.518) [-528.690] (-528.563) (-528.378) * (-530.776) (-527.642) [-530.355] (-528.494) -- 0:00:03
Average standard deviation of split frequencies: 0.005212
940500 -- (-532.721) (-528.572) (-530.983) [-527.548] * (-536.128) (-528.143) [-529.568] (-529.641) -- 0:00:03
941000 -- (-529.449) (-528.539) [-529.116] (-529.354) * (-530.431) [-527.191] (-537.346) (-531.659) -- 0:00:03
941500 -- [-528.403] (-527.855) (-527.506) (-528.517) * (-529.797) [-526.951] (-529.772) (-530.917) -- 0:00:03
942000 -- [-529.075] (-527.741) (-527.917) (-532.039) * (-528.378) [-530.899] (-527.513) (-529.964) -- 0:00:03
942500 -- (-530.667) [-529.267] (-530.363) (-529.251) * (-528.801) (-528.053) [-532.650] (-527.879) -- 0:00:03
943000 -- (-528.512) (-530.764) (-530.436) [-528.991] * [-529.988] (-529.004) (-534.156) (-529.906) -- 0:00:03
943500 -- (-527.594) [-531.960] (-531.289) (-529.687) * [-532.806] (-528.108) (-528.233) (-529.364) -- 0:00:03
944000 -- (-533.635) [-527.949] (-533.297) (-528.182) * (-530.336) [-529.139] (-529.137) (-529.737) -- 0:00:03
944500 -- (-530.903) (-527.335) [-528.883] (-531.815) * (-527.716) [-529.724] (-529.176) (-529.543) -- 0:00:03
945000 -- (-527.009) (-535.268) [-528.120] (-531.312) * [-527.590] (-530.794) (-527.326) (-530.842) -- 0:00:03
Average standard deviation of split frequencies: 0.004950
945500 -- [-527.457] (-529.613) (-529.017) (-527.847) * (-527.571) (-529.157) [-530.706] (-528.980) -- 0:00:03
946000 -- [-527.635] (-528.726) (-528.507) (-527.226) * [-528.821] (-528.687) (-532.150) (-527.514) -- 0:00:03
946500 -- (-528.701) [-528.138] (-528.834) (-528.680) * (-528.201) [-527.876] (-529.475) (-533.966) -- 0:00:03
947000 -- (-529.885) [-527.941] (-528.825) (-529.833) * (-528.008) (-527.028) [-528.362] (-532.948) -- 0:00:03
947500 -- (-528.785) [-528.040] (-530.206) (-529.799) * (-528.433) (-527.936) [-528.989] (-533.735) -- 0:00:03
948000 -- (-529.475) [-528.239] (-530.253) (-530.623) * (-528.843) [-530.003] (-528.697) (-528.163) -- 0:00:03
948500 -- (-531.130) (-534.247) [-527.886] (-529.267) * (-532.217) (-530.425) (-531.326) [-529.049] -- 0:00:03
949000 -- (-530.542) [-530.729] (-529.003) (-530.720) * (-531.574) (-532.072) [-530.375] (-528.771) -- 0:00:03
949500 -- [-529.748] (-528.201) (-528.995) (-528.764) * (-532.931) [-530.948] (-533.942) (-532.252) -- 0:00:02
950000 -- (-529.689) (-527.695) (-533.610) [-530.886] * (-533.132) (-529.399) [-527.750] (-531.144) -- 0:00:02
Average standard deviation of split frequencies: 0.005190
950500 -- (-531.171) (-530.808) (-527.874) [-528.919] * (-529.657) (-529.150) [-528.734] (-529.739) -- 0:00:02
951000 -- (-530.074) (-530.970) [-527.518] (-528.103) * [-530.072] (-529.523) (-529.891) (-533.131) -- 0:00:02
951500 -- [-528.005] (-531.086) (-527.978) (-529.736) * (-529.764) (-529.798) (-532.929) [-530.800] -- 0:00:02
952000 -- [-529.962] (-527.637) (-531.365) (-528.886) * (-529.963) (-531.181) (-528.516) [-528.225] -- 0:00:02
952500 -- (-527.769) [-527.358] (-528.735) (-527.879) * (-529.280) [-528.561] (-528.794) (-530.617) -- 0:00:02
953000 -- (-527.685) (-529.136) (-527.060) [-529.122] * (-527.544) (-530.482) (-527.851) [-529.276] -- 0:00:02
953500 -- [-530.395] (-528.044) (-529.761) (-531.710) * (-528.840) (-529.326) [-527.845] (-529.225) -- 0:00:02
954000 -- (-527.919) [-527.663] (-528.634) (-530.281) * (-528.552) (-527.889) [-527.890] (-528.745) -- 0:00:02
954500 -- (-530.944) (-527.396) (-533.883) [-527.384] * (-528.161) [-530.073] (-527.889) (-527.854) -- 0:00:02
955000 -- (-530.100) [-527.940] (-535.138) (-530.516) * (-528.412) [-527.636] (-528.060) (-532.997) -- 0:00:02
Average standard deviation of split frequencies: 0.005260
955500 -- (-528.795) (-527.815) [-532.021] (-528.624) * (-534.046) (-529.608) [-528.957] (-527.412) -- 0:00:02
956000 -- (-529.152) (-527.780) (-528.129) [-529.744] * (-531.930) [-527.692] (-527.486) (-528.185) -- 0:00:02
956500 -- [-531.961] (-528.377) (-528.265) (-531.099) * (-528.128) [-527.436] (-528.680) (-527.707) -- 0:00:02
957000 -- (-529.717) [-528.429] (-529.722) (-531.439) * (-528.572) (-527.607) [-529.366] (-529.123) -- 0:00:02
957500 -- (-527.359) (-530.844) [-530.471] (-531.775) * (-529.108) (-528.359) [-530.859] (-527.284) -- 0:00:02
958000 -- [-527.004] (-528.687) (-528.620) (-530.278) * (-527.524) [-530.791] (-531.556) (-529.905) -- 0:00:02
958500 -- (-527.470) [-528.656] (-535.376) (-531.828) * (-531.942) [-527.388] (-530.675) (-527.503) -- 0:00:02
959000 -- (-527.544) (-527.484) (-529.561) [-529.737] * (-529.913) [-527.285] (-527.946) (-531.449) -- 0:00:02
959500 -- (-528.564) (-528.285) [-528.377] (-529.637) * [-527.936] (-532.394) (-528.465) (-530.463) -- 0:00:02
960000 -- [-527.695] (-528.054) (-528.697) (-528.902) * [-528.822] (-529.789) (-529.930) (-531.064) -- 0:00:02
Average standard deviation of split frequencies: 0.005594
960500 -- (-528.420) (-527.014) (-527.963) [-532.142] * (-532.057) (-528.579) (-530.267) [-529.861] -- 0:00:02
961000 -- (-532.529) (-528.189) [-527.114] (-528.507) * (-528.910) [-528.631] (-534.872) (-530.583) -- 0:00:02
961500 -- (-528.568) (-532.109) (-528.369) [-528.430] * (-529.689) [-529.314] (-528.210) (-528.278) -- 0:00:02
962000 -- [-527.438] (-528.525) (-528.866) (-530.700) * (-529.818) (-531.312) [-528.677] (-527.467) -- 0:00:02
962500 -- (-533.064) [-528.413] (-530.879) (-531.847) * (-529.493) (-527.612) (-531.886) [-527.897] -- 0:00:02
963000 -- (-533.822) (-528.561) [-528.224] (-529.886) * (-528.946) (-528.232) [-527.978] (-528.488) -- 0:00:02
963500 -- (-527.147) (-527.060) (-529.441) [-528.482] * (-530.820) [-533.735] (-529.761) (-528.316) -- 0:00:02
964000 -- (-528.156) [-528.393] (-527.507) (-528.472) * (-528.455) (-530.522) (-528.458) [-530.862] -- 0:00:02
964500 -- (-528.725) (-527.820) [-527.445] (-528.964) * [-529.263] (-528.969) (-527.403) (-531.092) -- 0:00:02
965000 -- (-528.606) (-530.453) [-528.131] (-528.590) * (-529.437) (-528.778) [-529.345] (-529.677) -- 0:00:02
Average standard deviation of split frequencies: 0.006019
965500 -- (-530.672) (-527.660) [-527.409] (-531.050) * (-528.666) [-528.205] (-536.293) (-528.836) -- 0:00:02
966000 -- (-535.261) (-529.560) (-528.874) [-529.189] * (-527.029) [-528.494] (-529.769) (-529.042) -- 0:00:02
966500 -- (-529.187) (-527.169) (-528.689) [-530.853] * (-530.167) (-530.381) (-528.592) [-528.278] -- 0:00:01
967000 -- [-528.966] (-533.214) (-531.656) (-529.622) * (-528.989) [-528.056] (-530.517) (-528.341) -- 0:00:01
967500 -- [-528.334] (-530.147) (-530.064) (-531.173) * (-531.911) (-528.678) (-530.410) [-529.528] -- 0:00:01
968000 -- [-527.006] (-528.753) (-528.194) (-529.426) * (-528.797) [-527.668] (-530.818) (-530.664) -- 0:00:01
968500 -- (-527.760) (-529.945) (-527.100) [-531.617] * (-529.027) (-533.751) (-528.991) [-532.491] -- 0:00:01
969000 -- (-528.296) [-528.499] (-529.025) (-542.217) * (-529.045) [-529.617] (-527.965) (-529.806) -- 0:00:01
969500 -- (-529.314) (-530.706) [-526.901] (-529.885) * [-527.537] (-530.846) (-528.275) (-528.730) -- 0:00:01
970000 -- (-527.589) [-534.200] (-527.378) (-529.137) * [-530.580] (-537.570) (-529.704) (-530.082) -- 0:00:01
Average standard deviation of split frequencies: 0.006411
970500 -- (-528.522) [-531.435] (-528.639) (-529.934) * (-529.177) [-527.827] (-528.504) (-529.061) -- 0:00:01
971000 -- (-528.063) (-529.281) [-529.439] (-532.591) * [-527.757] (-527.054) (-529.413) (-528.141) -- 0:00:01
971500 -- (-529.588) [-527.703] (-527.776) (-530.929) * (-530.772) (-527.387) (-531.345) [-529.441] -- 0:00:01
972000 -- (-530.307) [-529.161] (-528.180) (-530.242) * (-532.035) [-528.300] (-528.960) (-531.363) -- 0:00:01
972500 -- (-528.944) (-528.217) (-530.791) [-527.978] * (-527.510) (-529.829) [-527.472] (-530.581) -- 0:00:01
973000 -- (-528.690) (-528.540) (-529.688) [-528.748] * (-531.335) [-529.298] (-533.468) (-535.323) -- 0:00:01
973500 -- (-529.532) (-530.829) (-527.868) [-530.983] * (-529.829) (-530.186) (-531.686) [-530.744] -- 0:00:01
974000 -- (-530.782) (-530.469) [-529.299] (-532.689) * [-529.781] (-531.769) (-527.588) (-527.760) -- 0:00:01
974500 -- (-530.578) [-529.318] (-528.496) (-531.325) * (-529.646) (-531.407) (-530.682) [-528.031] -- 0:00:01
975000 -- (-534.826) [-529.455] (-529.122) (-529.607) * [-527.278] (-527.558) (-527.601) (-530.834) -- 0:00:01
Average standard deviation of split frequencies: 0.006665
975500 -- (-530.065) (-530.480) (-530.638) [-526.900] * [-529.341] (-527.568) (-529.069) (-529.541) -- 0:00:01
976000 -- (-528.360) [-527.997] (-530.778) (-532.036) * (-528.823) [-527.513] (-531.025) (-531.555) -- 0:00:01
976500 -- (-530.407) (-532.124) [-530.685] (-531.274) * [-529.197] (-528.534) (-529.265) (-530.251) -- 0:00:01
977000 -- (-533.265) (-529.620) [-528.625] (-530.389) * (-529.367) (-530.247) [-530.737] (-530.172) -- 0:00:01
977500 -- (-532.402) (-530.415) [-527.810] (-532.943) * (-530.734) (-529.528) (-529.599) [-529.286] -- 0:00:01
978000 -- (-528.349) (-530.190) (-528.108) [-531.371] * (-529.875) [-529.060] (-528.283) (-530.854) -- 0:00:01
978500 -- [-528.740] (-532.786) (-527.227) (-530.700) * (-530.058) (-531.590) [-530.233] (-528.940) -- 0:00:01
979000 -- (-529.329) (-527.028) [-527.237] (-531.922) * (-528.949) [-527.352] (-530.558) (-532.406) -- 0:00:01
979500 -- (-528.231) [-527.322] (-528.566) (-529.860) * [-529.209] (-527.194) (-528.851) (-529.257) -- 0:00:01
980000 -- [-529.280] (-528.627) (-528.227) (-528.942) * [-528.228] (-527.975) (-527.406) (-528.183) -- 0:00:01
Average standard deviation of split frequencies: 0.006281
980500 -- [-527.818] (-527.899) (-531.561) (-528.090) * (-530.440) [-529.859] (-531.371) (-530.173) -- 0:00:01
981000 -- (-527.816) [-527.155] (-528.465) (-529.516) * (-529.535) [-529.327] (-530.026) (-530.521) -- 0:00:01
981500 -- [-529.754] (-528.297) (-530.516) (-528.824) * (-536.416) (-529.454) [-528.412] (-530.168) -- 0:00:01
982000 -- (-529.600) (-532.395) (-527.890) [-532.534] * (-530.809) (-526.756) (-527.074) [-529.214] -- 0:00:01
982500 -- (-530.848) (-529.380) [-530.590] (-533.342) * (-532.049) (-528.514) [-527.455] (-531.674) -- 0:00:01
983000 -- (-527.803) (-531.173) [-528.131] (-531.141) * (-531.296) [-528.925] (-529.416) (-528.449) -- 0:00:01
983500 -- (-529.777) (-531.508) [-532.604] (-528.770) * (-529.280) (-529.491) (-531.048) [-527.662] -- 0:00:00
984000 -- (-531.146) (-530.895) (-531.068) [-527.229] * (-528.788) [-529.519] (-530.983) (-527.228) -- 0:00:00
984500 -- (-529.214) [-532.551] (-529.415) (-527.366) * (-529.475) [-529.166] (-531.319) (-534.780) -- 0:00:00
985000 -- [-527.631] (-527.842) (-529.417) (-528.856) * (-532.045) (-528.181) [-527.388] (-529.123) -- 0:00:00
Average standard deviation of split frequencies: 0.006693
985500 -- (-528.779) (-528.514) (-531.805) [-528.572] * (-529.080) (-529.589) [-528.433] (-530.202) -- 0:00:00
986000 -- (-529.630) (-529.230) (-528.194) [-529.071] * (-527.881) (-529.337) (-532.921) [-527.527] -- 0:00:00
986500 -- (-528.615) (-530.087) (-529.025) [-527.133] * (-528.229) (-529.772) [-528.393] (-528.359) -- 0:00:00
987000 -- (-528.344) [-533.733] (-529.850) (-528.443) * [-528.883] (-529.256) (-528.920) (-528.853) -- 0:00:00
987500 -- (-527.900) [-529.560] (-529.024) (-529.740) * (-529.270) (-527.682) [-527.392] (-528.249) -- 0:00:00
988000 -- (-528.418) (-527.774) [-528.212] (-529.767) * (-528.166) [-527.492] (-528.003) (-528.548) -- 0:00:00
988500 -- (-535.941) (-527.615) (-533.513) [-528.788] * (-527.729) [-528.944] (-531.578) (-528.839) -- 0:00:00
989000 -- (-528.295) (-529.249) (-531.923) [-529.287] * (-529.191) (-533.482) (-529.346) [-530.252] -- 0:00:00
989500 -- (-530.041) (-529.716) (-531.406) [-528.764] * (-529.251) [-528.725] (-532.016) (-528.195) -- 0:00:00
990000 -- (-528.293) (-528.190) (-531.009) [-528.746] * (-528.099) (-529.826) [-529.993] (-534.921) -- 0:00:00
Average standard deviation of split frequencies: 0.006567
990500 -- (-528.690) [-527.799] (-530.903) (-528.101) * (-530.865) [-528.831] (-528.380) (-532.111) -- 0:00:00
991000 -- [-529.701] (-528.504) (-533.665) (-528.872) * (-532.910) [-530.454] (-528.577) (-529.362) -- 0:00:00
991500 -- (-528.136) (-530.031) [-529.141] (-532.211) * (-530.505) (-528.665) (-527.571) [-530.755] -- 0:00:00
992000 -- (-528.724) (-528.973) [-533.177] (-530.698) * [-528.066] (-528.830) (-527.842) (-527.433) -- 0:00:00
992500 -- [-530.282] (-528.238) (-530.317) (-530.639) * (-528.825) (-528.563) [-531.039] (-530.503) -- 0:00:00
993000 -- [-527.309] (-528.054) (-531.537) (-530.386) * (-532.470) (-530.174) (-529.618) [-527.412] -- 0:00:00
993500 -- (-528.063) [-529.024] (-529.464) (-527.457) * [-526.867] (-537.876) (-527.681) (-527.922) -- 0:00:00
994000 -- [-527.883] (-529.682) (-529.614) (-531.436) * (-527.495) (-529.121) (-527.513) [-527.852] -- 0:00:00
994500 -- (-528.690) (-529.717) [-529.885] (-527.846) * [-529.662] (-527.443) (-527.674) (-530.957) -- 0:00:00
995000 -- (-534.147) (-528.133) [-530.783] (-529.024) * (-528.979) (-531.510) (-527.986) [-531.100] -- 0:00:00
Average standard deviation of split frequencies: 0.006689
995500 -- (-529.074) (-530.106) [-528.357] (-530.590) * (-527.910) (-527.994) (-528.469) [-529.036] -- 0:00:00
996000 -- (-529.502) (-527.710) (-532.335) [-529.308] * (-530.311) (-530.760) (-527.228) [-531.437] -- 0:00:00
996500 -- (-530.251) (-529.378) (-530.718) [-529.295] * [-528.288] (-528.799) (-532.816) (-532.154) -- 0:00:00
997000 -- (-528.965) [-527.484] (-529.912) (-530.261) * [-527.478] (-527.869) (-530.835) (-527.500) -- 0:00:00
997500 -- (-527.689) [-529.757] (-527.950) (-528.817) * [-529.127] (-535.281) (-530.383) (-528.258) -- 0:00:00
998000 -- (-530.983) (-531.658) [-530.012] (-528.875) * [-528.816] (-531.065) (-534.770) (-528.822) -- 0:00:00
998500 -- (-528.230) (-530.400) [-528.181] (-530.264) * (-528.567) [-529.491] (-528.408) (-530.752) -- 0:00:00
999000 -- (-532.513) (-528.142) [-530.566] (-530.084) * [-528.402] (-529.256) (-527.392) (-527.657) -- 0:00:00
999500 -- [-527.851] (-529.384) (-532.484) (-528.260) * (-530.392) [-527.575] (-527.474) (-529.040) -- 0:00:00
1000000 -- (-527.799) (-528.780) [-528.883] (-528.114) * (-531.589) [-527.565] (-529.628) (-530.470) -- 0:00:00
Average standard deviation of split frequencies: 0.006815
Analysis completed in 59 seconds
Analysis used 57.72 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -526.69
Likelihood of best state for "cold" chain of run 2 was -526.69
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 62 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
35.4 % ( 25 %) Dirichlet(Pi{all})
36.2 % ( 20 %) Slider(Pi{all})
78.6 % ( 55 %) Multiplier(Alpha{1,2})
77.7 % ( 54 %) Multiplier(Alpha{3})
26.2 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.1 % ( 76 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.3 % ( 97 %) Nodeslider(V{all})
30.7 % ( 17 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.8 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
36.1 % ( 25 %) Dirichlet(Pi{all})
35.7 % ( 32 %) Slider(Pi{all})
79.1 % ( 56 %) Multiplier(Alpha{1,2})
77.8 % ( 50 %) Multiplier(Alpha{3})
24.6 % ( 22 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 87 %) ParsSPR(Tau{all},V{all})
28.2 % ( 27 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.7 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166344 0.82 0.67
3 | 166804 166396 0.84
4 | 166486 167385 166585
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166316 0.82 0.67
3 | 166647 166805 0.84
4 | 166768 166488 166976
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -528.36
| 1 |
| 1 1 2 1 |
| 2 22 1 2 1 2 |
| * 2 2 1 2 2 |
| 1 2 2 *1 1 * 1 1 2|
|2 1 1 2 21 1 2 11 * 11 |
| 2 1 22 1 2 2 21 * 1 2 1 2 1|
| 1 2 21 2 1 22 2 22 2 *122 1 |
| 21 2 2 * 1 1 1 |
| 1 2 21 1 2 1 * 2 |
|1 1 1 1 1 2 2 * 1 2 1 |
| 12 1 2 1 |
| 2 2 |
| 1 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -530.13
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -528.38 -532.05
2 -528.42 -531.04
--------------------------------------
TOTAL -528.40 -531.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900658 0.092611 0.365219 1.500311 0.868094 1501.00 1501.00 1.000
r(A<->C){all} 0.176594 0.019789 0.000001 0.456062 0.143700 196.04 220.17 1.005
r(A<->G){all} 0.157882 0.018917 0.000004 0.428793 0.121342 179.25 191.91 1.000
r(A<->T){all} 0.165016 0.021719 0.000025 0.463584 0.120503 187.18 187.97 1.000
r(C<->G){all} 0.167988 0.019107 0.000013 0.439835 0.133919 107.50 239.23 1.001
r(C<->T){all} 0.167833 0.019936 0.000001 0.446411 0.133091 204.78 292.39 1.004
r(G<->T){all} 0.164687 0.018953 0.000101 0.433610 0.128741 258.69 271.38 1.000
pi(A){all} 0.219022 0.000434 0.180638 0.261814 0.218461 1333.43 1361.25 1.000
pi(C){all} 0.249387 0.000469 0.204265 0.289641 0.249177 1285.78 1393.39 1.000
pi(G){all} 0.279489 0.000517 0.237580 0.325740 0.279100 1333.31 1337.69 1.001
pi(T){all} 0.252102 0.000491 0.212248 0.298121 0.251451 1255.02 1270.94 1.001
alpha{1,2} 0.422326 0.238581 0.000178 1.416390 0.246950 1158.11 1329.55 1.000
alpha{3} 0.469314 0.243453 0.000252 1.493609 0.302912 1076.64 1214.93 1.000
pinvar{all} 0.995783 0.000025 0.986942 0.999999 0.997378 1134.73 1219.44 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- ....**
9 -- .****.
10 -- .**.**
11 -- .*.***
12 -- .*...*
13 -- ..**..
14 -- ...**.
15 -- .***.*
16 -- ..****
17 -- .*..*.
18 -- ...*.*
19 -- .**...
20 -- .*.*..
21 -- ..*..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.000942 0.153231 0.154564 2
8 447 0.148901 0.017430 0.136576 0.161226 2
9 447 0.148901 0.004240 0.145903 0.151899 2
10 439 0.146236 0.003298 0.143904 0.148568 2
11 438 0.145903 0.004711 0.142572 0.149234 2
12 438 0.145903 0.008480 0.139907 0.151899 2
13 434 0.144570 0.011306 0.136576 0.152565 2
14 427 0.142239 0.000471 0.141905 0.142572 2
15 427 0.142239 0.008009 0.136576 0.147901 2
16 426 0.141905 0.004711 0.138574 0.145237 2
17 426 0.141905 0.009422 0.135243 0.148568 2
18 424 0.141239 0.000000 0.141239 0.141239 2
19 422 0.140573 0.012248 0.131912 0.149234 2
20 413 0.137575 0.002355 0.135909 0.139241 2
21 397 0.132245 0.014604 0.121919 0.142572 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097728 0.009615 0.000001 0.285129 0.066993 1.000 2
length{all}[2] 0.101810 0.010658 0.000085 0.309030 0.069744 1.002 2
length{all}[3] 0.101884 0.010696 0.000041 0.307227 0.070032 1.000 2
length{all}[4] 0.101486 0.010141 0.000002 0.312130 0.069924 1.000 2
length{all}[5] 0.099006 0.010026 0.000014 0.304369 0.067808 1.000 2
length{all}[6] 0.099516 0.009835 0.000032 0.297239 0.069196 1.000 2
length{all}[7] 0.096486 0.009390 0.000194 0.279826 0.068703 1.005 2
length{all}[8] 0.096806 0.009835 0.000193 0.310406 0.059301 0.998 2
length{all}[9] 0.098616 0.009408 0.000028 0.306750 0.068874 1.011 2
length{all}[10] 0.103033 0.010183 0.000033 0.280491 0.075081 0.999 2
length{all}[11] 0.099823 0.011163 0.000601 0.293433 0.069263 1.001 2
length{all}[12] 0.101600 0.010615 0.000016 0.295282 0.068865 0.999 2
length{all}[13] 0.115267 0.015071 0.000077 0.375921 0.074460 1.003 2
length{all}[14] 0.101133 0.010958 0.000107 0.320127 0.068183 0.998 2
length{all}[15] 0.101463 0.010957 0.000066 0.303553 0.069399 1.000 2
length{all}[16] 0.103206 0.011760 0.000038 0.294264 0.072113 1.000 2
length{all}[17] 0.094392 0.009698 0.000023 0.301392 0.065138 1.002 2
length{all}[18] 0.100898 0.010840 0.000554 0.319420 0.070411 0.998 2
length{all}[19] 0.103948 0.010445 0.000149 0.293358 0.072929 1.001 2
length{all}[20] 0.086788 0.007044 0.000240 0.257218 0.065948 0.998 2
length{all}[21] 0.101236 0.011050 0.001027 0.313012 0.065956 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006815
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 381
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 127 / 127 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 127 / 127 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.069344 0.042878 0.047976 0.107751 0.068933 0.029338 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -552.276667
Iterating by ming2
Initial: fx= 552.276667
x= 0.06934 0.04288 0.04798 0.10775 0.06893 0.02934 0.30000 1.30000
1 h-m-p 0.0000 0.0002 305.1879 +++ 530.411212 m 0.0002 14 | 1/8
2 h-m-p 0.0015 0.0073 41.6169 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 279.6721 ++ 521.927334 m 0.0001 45 | 2/8
4 h-m-p 0.0009 0.0104 30.0564 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 250.4567 ++ 519.364843 m 0.0000 76 | 3/8
6 h-m-p 0.0004 0.0136 23.5394 ----------.. | 3/8
7 h-m-p 0.0000 0.0002 216.7758 +++ 511.436325 m 0.0002 107 | 4/8
8 h-m-p 0.0017 0.0192 17.1515 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 177.4261 ++ 511.332232 m 0.0000 139 | 5/8
10 h-m-p 0.0001 0.0307 11.0520 ---------.. | 5/8
11 h-m-p 0.0000 0.0003 125.0599 +++ 506.456616 m 0.0003 169 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 506.456616 m 8.0000 180 | 6/8
13 h-m-p 0.4062 8.0000 0.0000 -C 506.456616 0 0.0254 194 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 ---------Y 506.456616 0 0.0000 216
Out..
lnL = -506.456616
217 lfun, 217 eigenQcodon, 1302 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.043283 0.012044 0.064901 0.048953 0.078008 0.038180 0.299865 0.782040 0.375239
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.668244
np = 9
lnL0 = -541.657960
Iterating by ming2
Initial: fx= 541.657960
x= 0.04328 0.01204 0.06490 0.04895 0.07801 0.03818 0.29987 0.78204 0.37524
1 h-m-p 0.0000 0.0001 297.0233 ++ 532.921540 m 0.0001 14 | 1/9
2 h-m-p 0.0002 0.0009 154.8531 ++ 516.707839 m 0.0009 26 | 2/9
3 h-m-p 0.0000 0.0000 5472.3249 ++ 514.236706 m 0.0000 38 | 3/9
4 h-m-p 0.0001 0.0003 225.5070 ++ 511.809036 m 0.0003 50 | 4/9
5 h-m-p 0.0000 0.0000 2341.1816 ++ 507.892017 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0001 1360.0077 ++ 506.479389 m 0.0001 74 | 6/9
7 h-m-p 0.0064 0.0702 4.9753 ------------.. | 6/9
8 h-m-p 0.0000 0.0000 125.6955 ++ 506.456613 m 0.0000 108 | 7/9
9 h-m-p 0.0160 8.0000 0.0000 Y 506.456613 0 0.0012 120 | 7/9
10 h-m-p 0.0882 8.0000 0.0000 -------Y 506.456613 0 0.0000 141
Out..
lnL = -506.456613
142 lfun, 426 eigenQcodon, 1704 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.108238 0.105999 0.080640 0.052217 0.091904 0.026627 0.249046 0.916117 0.154907 0.398594 1.543974
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 9.705849
np = 11
lnL0 = -562.138058
Iterating by ming2
Initial: fx= 562.138058
x= 0.10824 0.10600 0.08064 0.05222 0.09190 0.02663 0.24905 0.91612 0.15491 0.39859 1.54397
1 h-m-p 0.0000 0.0002 279.5148 +++ 543.804485 m 0.0002 17 | 1/11
2 h-m-p 0.0002 0.0008 158.7525 ++ 528.133582 m 0.0008 31 | 2/11
3 h-m-p 0.0000 0.0001 1340.9504 ++ 514.627110 m 0.0001 45 | 3/11
4 h-m-p 0.0002 0.0008 129.4816 ++ 510.078466 m 0.0008 59 | 4/11
5 h-m-p 0.0000 0.0001 1567.5655 ++ 508.137582 m 0.0001 73 | 5/11
6 h-m-p 0.0107 0.2038 3.2232 -------------.. | 5/11
7 h-m-p 0.0000 0.0000 175.9533 ++ 506.701638 m 0.0000 112 | 6/11
8 h-m-p 0.0031 0.1294 1.8422 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 125.5007 ++ 506.456613 m 0.0000 150 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 506.456613 m 8.0000 167 | 7/11
11 h-m-p 0.1694 8.0000 0.0001 +++ 506.456613 m 8.0000 186 | 7/11
12 h-m-p 0.0160 8.0000 0.8339 --------C 506.456613 0 0.0000 212 | 7/11
13 h-m-p 0.0160 8.0000 0.0041 +++++ 506.456613 m 8.0000 233 | 7/11
14 h-m-p 0.0130 6.4948 23.8236 ---------Y 506.456613 0 0.0000 260 | 7/11
15 h-m-p 0.0160 8.0000 0.0001 +++++ 506.456613 m 8.0000 277 | 7/11
16 h-m-p 0.0160 8.0000 0.0965 +++++ 506.456612 m 8.0000 298 | 7/11
17 h-m-p 0.0386 7.4278 20.0259 --------------.. | 7/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 506.456612 m 8.0000 345 | 7/11
19 h-m-p 0.0396 8.0000 0.0049 ++++ 506.456611 m 8.0000 365 | 7/11
20 h-m-p 0.0433 8.0000 0.9111 ----------C 506.456611 0 0.0000 393 | 7/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 506.456611 m 8.0000 414 | 7/11
22 h-m-p 0.0160 8.0000 0.9379 ------------Y 506.456611 0 0.0000 444 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 +++++ 506.456611 m 8.0000 465 | 7/11
24 h-m-p 0.0147 7.3528 26.0083 ------------C 506.456611 0 0.0000 495 | 7/11
25 h-m-p 0.0160 8.0000 0.0005 +++++ 506.456611 m 8.0000 512 | 7/11
26 h-m-p 0.0160 8.0000 1.4170 -----------Y 506.456611 0 0.0000 541 | 7/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 506.456611 m 8.0000 558 | 7/11
28 h-m-p 0.0160 8.0000 2.3649 ------------N 506.456611 0 0.0000 588 | 7/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 506.456611 m 8.0000 605 | 7/11
30 h-m-p 0.0160 8.0000 1.9259 ----------C 506.456611 0 0.0000 633 | 7/11
31 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
32 h-m-p 0.0160 8.0000 0.0000 +++++ 506.456611 m 8.0000 679 | 7/11
33 h-m-p 0.0160 8.0000 1.8181 -----------Y 506.456611 0 0.0000 708 | 7/11
34 h-m-p 0.0160 8.0000 0.0000 +++++ 506.456611 m 8.0000 725 | 7/11
35 h-m-p 0.0002 0.0861 1.3800 +++++ 506.456609 m 0.0861 746 | 8/11
36 h-m-p 0.2151 1.0757 0.3438 ++ 506.456608 m 1.0757 760 | 9/11
37 h-m-p 0.1148 8.0000 0.3179 -------------Y 506.456608 0 0.0000 790 | 9/11
38 h-m-p 0.0160 8.0000 0.0000 ---N 506.456608 0 0.0001 809
Out..
lnL = -506.456608
810 lfun, 3240 eigenQcodon, 14580 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -506.462621 S = -506.454724 -0.003020
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:04
did 20 / 48 patterns 0:04
did 30 / 48 patterns 0:04
did 40 / 48 patterns 0:04
did 48 / 48 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059896 0.089216 0.100050 0.103284 0.049399 0.086295 0.000100 0.613905 1.030422
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.991974
np = 9
lnL0 = -563.884929
Iterating by ming2
Initial: fx= 563.884929
x= 0.05990 0.08922 0.10005 0.10328 0.04940 0.08630 0.00011 0.61391 1.03042
1 h-m-p 0.0000 0.0000 270.8398 ++ 563.742042 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0117 52.5159 +++++ 539.001610 m 0.0117 29 | 2/9
3 h-m-p 0.0006 0.0029 44.7624 ++ 533.274920 m 0.0029 41 | 3/9
4 h-m-p 0.0001 0.0003 40.7915 ++ 530.355949 m 0.0003 53 | 4/9
5 h-m-p 0.0022 0.0509 4.4012 ------------.. | 4/9
6 h-m-p 0.0000 0.0002 238.1724 ++ 521.770480 m 0.0002 87 | 5/9
7 h-m-p 0.0160 8.0000 2.0108 -------------.. | 5/9
8 h-m-p 0.0000 0.0000 207.7273 ++ 519.997031 m 0.0000 122 | 6/9
9 h-m-p 0.0160 8.0000 1.4698 -------------.. | 6/9
10 h-m-p 0.0000 0.0004 167.3010 +++ 508.865461 m 0.0004 158 | 7/9
11 h-m-p 0.0433 8.0000 1.0527 --------------.. | 7/9
12 h-m-p 0.0000 0.0002 122.5178 ++ 506.456591 m 0.0002 194 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 -Y 506.456591 0 0.1000 207 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 ---N 506.456591 0 0.0063 223
Out..
lnL = -506.456591
224 lfun, 2464 eigenQcodon, 13440 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032008 0.050887 0.067148 0.093894 0.101082 0.058344 0.000100 0.900000 0.574174 1.828010 1.299997
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.821965
np = 11
lnL0 = -552.964080
Iterating by ming2
Initial: fx= 552.964080
x= 0.03201 0.05089 0.06715 0.09389 0.10108 0.05834 0.00011 0.90000 0.57417 1.82801 1.30000
1 h-m-p 0.0000 0.0000 262.1329 ++ 552.820204 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0011 165.4877 ++++ 531.488527 m 0.0011 32 | 2/11
3 h-m-p 0.0000 0.0001 556.3491 ++ 520.452636 m 0.0001 46 | 3/11
4 h-m-p 0.0009 0.0044 30.0112 ++ 517.890473 m 0.0044 60 | 4/11
5 h-m-p 0.0000 0.0001 474.8933 ++ 515.654363 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0001 7357.2765 ++ 508.725605 m 0.0001 88 | 6/11
7 h-m-p 0.0000 0.0000 8474.9154 ++ 508.634449 m 0.0000 102 | 7/11
8 h-m-p 0.0010 0.1301 6.4287 -----------.. | 7/11
9 h-m-p 0.0000 0.0001 121.9637 ++ 506.456607 m 0.0001 139 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 506.456607 m 8.0000 153 | 8/11
11 h-m-p 0.0191 8.0000 0.0024 +++++ 506.456606 m 8.0000 173 | 8/11
12 h-m-p 0.0134 5.1222 1.4435 ---------Y 506.456606 0 0.0000 199 | 8/11
13 h-m-p 0.0163 8.0000 0.0000 C 506.456606 0 0.0182 213 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 ---N 506.456606 0 0.0001 233
Out..
lnL = -506.456606
234 lfun, 2808 eigenQcodon, 15444 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -506.467341 S = -506.454952 -0.005438
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:12
did 20 / 48 patterns 0:12
did 30 / 48 patterns 0:12
did 40 / 48 patterns 0:12
did 48 / 48 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=127
NC_011896_1_WP_010907955_1_875_MLBR_RS04105 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
NC_002677_1_NP_301631_1_503_ML0837 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL
**************************************************
NC_011896_1_WP_010907955_1_875_MLBR_RS04105 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
NC_002677_1_NP_301631_1_503_ML0837 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620 SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG
**************************************************
NC_011896_1_WP_010907955_1_875_MLBR_RS04105 IRRTIAIPVFGDHADISRVGIDIERHL
NC_002677_1_NP_301631_1_503_ML0837 IRRTIAIPVFGDHADISRVGIDIERHL
NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700 IRRTIAIPVFGDHADISRVGIDIERHL
NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680 IRRTIAIPVFGDHADISRVGIDIERHL
NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545 IRRTIAIPVFGDHADISRVGIDIERHL
NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620 IRRTIAIPVFGDHADISRVGIDIERHL
***************************
>NC_011896_1_WP_010907955_1_875_MLBR_RS04105 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC GCGCGTCGGCATCGATATTGAGCGTCATCTG >NC_002677_1_NP_301631_1_503_ML0837 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC GCGCGTCGGCATCGATATTGAGCGTCATCTG >NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC GCGCGTCGGCATCGATATTGAGCGTCATCTG >NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC GCGCGTCGGCATCGATATTGAGCGTCATCTG >NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC GCGCGTCGGCATCGATATTGAGCGTCATCTG >NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620 ATGCCAGACACGACCAGTAACATTGCGGTTCGCAGCGGGCGGACCGTAGT AATCACCGGCAGTGGATTGGCCAAGGTTGAGCTTACCGCTGACGATATGG TAAAAGTGAATATTGCTGATCCCCAAATTATTTCGGGAATACGATGCCTG TCGGCAGGGGCCATCATTCACACCGGTGTTTTCCGTGCTAGTTATACCGA TGCCGTGGTGCACATCCATCTGTCATATGTGATGGCACAGTCGCTTGACG TCCCAAGTGTGCTGCGGTTCAGTGGCTATGAGCTGATCAAACGGCTGGGG ATCAGACGAACCATTGCCATTCCGGTCTTTGGCGATCACGCCGATATTTC GCGCGTCGGCATCGATATTGAGCGTCATCTG
>NC_011896_1_WP_010907955_1_875_MLBR_RS04105 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG IRRTIAIPVFGDHADISRVGIDIERHL >NC_002677_1_NP_301631_1_503_ML0837 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG IRRTIAIPVFGDHADISRVGIDIERHL >NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG IRRTIAIPVFGDHADISRVGIDIERHL >NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG IRRTIAIPVFGDHADISRVGIDIERHL >NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG IRRTIAIPVFGDHADISRVGIDIERHL >NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620 MPDTTSNIAVRSGRTVVITGSGLAKVELTADDMVKVNIADPQIISGIRCL SAGAIIHTGVFRASYTDAVVHIHLSYVMAQSLDVPSVLRFSGYELIKRLG IRRTIAIPVFGDHADISRVGIDIERHL
#NEXUS
[ID: 0347073948]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907955_1_875_MLBR_RS04105
NC_002677_1_NP_301631_1_503_ML0837
NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700
NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680
NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545
NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907955_1_875_MLBR_RS04105,
2 NC_002677_1_NP_301631_1_503_ML0837,
3 NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700,
4 NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680,
5 NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545,
6 NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06699263,2:0.06974423,3:0.07003189,4:0.06992401,5:0.06780839,6:0.06919629);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06699263,2:0.06974423,3:0.07003189,4:0.06992401,5:0.06780839,6:0.06919629);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -528.38 -532.05
2 -528.42 -531.04
--------------------------------------
TOTAL -528.40 -531.66
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0837/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.900658 0.092611 0.365219 1.500311 0.868094 1501.00 1501.00 1.000
r(A<->C){all} 0.176594 0.019789 0.000001 0.456062 0.143700 196.04 220.17 1.005
r(A<->G){all} 0.157882 0.018917 0.000004 0.428793 0.121342 179.25 191.91 1.000
r(A<->T){all} 0.165016 0.021719 0.000025 0.463584 0.120503 187.18 187.97 1.000
r(C<->G){all} 0.167988 0.019107 0.000013 0.439835 0.133919 107.50 239.23 1.001
r(C<->T){all} 0.167833 0.019936 0.000001 0.446411 0.133091 204.78 292.39 1.004
r(G<->T){all} 0.164687 0.018953 0.000101 0.433610 0.128741 258.69 271.38 1.000
pi(A){all} 0.219022 0.000434 0.180638 0.261814 0.218461 1333.43 1361.25 1.000
pi(C){all} 0.249387 0.000469 0.204265 0.289641 0.249177 1285.78 1393.39 1.000
pi(G){all} 0.279489 0.000517 0.237580 0.325740 0.279100 1333.31 1337.69 1.001
pi(T){all} 0.252102 0.000491 0.212248 0.298121 0.251451 1255.02 1270.94 1.001
alpha{1,2} 0.422326 0.238581 0.000178 1.416390 0.246950 1158.11 1329.55 1.000
alpha{3} 0.469314 0.243453 0.000252 1.493609 0.302912 1076.64 1214.93 1.000
pinvar{all} 0.995783 0.000025 0.986942 0.999999 0.997378 1134.73 1219.44 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0837/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 127
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 2 2 2 2 2 2
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 3 3 3 3 3 3 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 2 2 2 2 2 2 | Gln CAA 1 1 1 1 1 1 | CGA 2 2 2 2 2 2
CTG 6 6 6 6 6 6 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 9 9 9 9 9 9 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 5 5 5 5 5 5
ATC 6 6 6 6 6 6 | ACC 7 7 7 7 7 7 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 6 6 6 6 6 6 | Gly GGT 1 1 1 1 1 1
GTC 3 3 3 3 3 3 | GCC 5 5 5 5 5 5 | GAC 3 3 3 3 3 3 | GGC 4 4 4 4 4 4
GTA 3 3 3 3 3 3 | GCA 2 2 2 2 2 2 | Glu GAA 0 0 0 0 0 0 | GGA 2 2 2 2 2 2
GTG 5 5 5 5 5 5 | GCG 1 1 1 1 1 1 | GAG 3 3 3 3 3 3 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907955_1_875_MLBR_RS04105
position 1: T:0.10236 C:0.22047 A:0.30709 G:0.37008
position 2: T:0.35433 C:0.22047 A:0.21260 G:0.21260
position 3: T:0.29921 C:0.30709 A:0.13386 G:0.25984
Average T:0.25197 C:0.24934 A:0.21785 G:0.28084
#2: NC_002677_1_NP_301631_1_503_ML0837
position 1: T:0.10236 C:0.22047 A:0.30709 G:0.37008
position 2: T:0.35433 C:0.22047 A:0.21260 G:0.21260
position 3: T:0.29921 C:0.30709 A:0.13386 G:0.25984
Average T:0.25197 C:0.24934 A:0.21785 G:0.28084
#3: NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700
position 1: T:0.10236 C:0.22047 A:0.30709 G:0.37008
position 2: T:0.35433 C:0.22047 A:0.21260 G:0.21260
position 3: T:0.29921 C:0.30709 A:0.13386 G:0.25984
Average T:0.25197 C:0.24934 A:0.21785 G:0.28084
#4: NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680
position 1: T:0.10236 C:0.22047 A:0.30709 G:0.37008
position 2: T:0.35433 C:0.22047 A:0.21260 G:0.21260
position 3: T:0.29921 C:0.30709 A:0.13386 G:0.25984
Average T:0.25197 C:0.24934 A:0.21785 G:0.28084
#5: NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545
position 1: T:0.10236 C:0.22047 A:0.30709 G:0.37008
position 2: T:0.35433 C:0.22047 A:0.21260 G:0.21260
position 3: T:0.29921 C:0.30709 A:0.13386 G:0.25984
Average T:0.25197 C:0.24934 A:0.21785 G:0.28084
#6: NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620
position 1: T:0.10236 C:0.22047 A:0.30709 G:0.37008
position 2: T:0.35433 C:0.22047 A:0.21260 G:0.21260
position 3: T:0.29921 C:0.30709 A:0.13386 G:0.25984
Average T:0.25197 C:0.24934 A:0.21785 G:0.28084
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 18 | Cys C TGT 0
TTC 12 | TCC 0 | TAC 0 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 24 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 12
CTC 0 | CCC 6 | CAC 18 | CGC 12
CTA 0 | CCA 12 | Gln Q CAA 6 | CGA 12
CTG 36 | CCG 6 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 54 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 30
ATC 36 | ACC 42 | AAC 6 | AGC 6
ATA 6 | ACA 0 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 18 | ACG 6 | AAG 6 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 36 | Gly G GGT 6
GTC 18 | GCC 30 | GAC 18 | GGC 24
GTA 18 | GCA 12 | Glu E GAA 0 | GGA 12
GTG 30 | GCG 6 | GAG 18 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10236 C:0.22047 A:0.30709 G:0.37008
position 2: T:0.35433 C:0.22047 A:0.21260 G:0.21260
position 3: T:0.29921 C:0.30709 A:0.13386 G:0.25984
Average T:0.25197 C:0.24934 A:0.21785 G:0.28084
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -506.456616 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299865 1.299997
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907955_1_875_MLBR_RS04105: 0.000004, NC_002677_1_NP_301631_1_503_ML0837: 0.000004, NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700: 0.000004, NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680: 0.000004, NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545: 0.000004, NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29987
omega (dN/dS) = 1.30000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 287.4 93.6 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 287.4 93.6 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 287.4 93.6 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 287.4 93.6 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 287.4 93.6 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 287.4 93.6 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -506.456613 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.249046 0.667533 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907955_1_875_MLBR_RS04105: 0.000004, NC_002677_1_NP_301631_1_503_ML0837: 0.000004, NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700: 0.000004, NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680: 0.000004, NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545: 0.000004, NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.24905
MLEs of dN/dS (w) for site classes (K=2)
p: 0.66753 0.33247
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 288.1 92.9 0.3325 0.0000 0.0000 0.0 0.0
7..2 0.000 288.1 92.9 0.3325 0.0000 0.0000 0.0 0.0
7..3 0.000 288.1 92.9 0.3325 0.0000 0.0000 0.0 0.0
7..4 0.000 288.1 92.9 0.3325 0.0000 0.0000 0.0 0.0
7..5 0.000 288.1 92.9 0.3325 0.0000 0.0000 0.0 0.0
7..6 0.000 288.1 92.9 0.3325 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -506.456608 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.366514 0.414840 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907955_1_875_MLBR_RS04105: 0.000004, NC_002677_1_NP_301631_1_503_ML0837: 0.000004, NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700: 0.000004, NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680: 0.000004, NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545: 0.000004, NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.36651 0.41484 0.21865
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 292.6 88.4 0.6335 0.0000 0.0000 0.0 0.0
7..2 0.000 292.6 88.4 0.6335 0.0000 0.0000 0.0 0.0
7..3 0.000 292.6 88.4 0.6335 0.0000 0.0000 0.0 0.0
7..4 0.000 292.6 88.4 0.6335 0.0000 0.0000 0.0 0.0
7..5 0.000 292.6 88.4 0.6335 0.0000 0.0000 0.0 0.0
7..6 0.000 292.6 88.4 0.6335 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907955_1_875_MLBR_RS04105)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -506.456591 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.046606
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907955_1_875_MLBR_RS04105: 0.000004, NC_002677_1_NP_301631_1_503_ML0837: 0.000004, NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700: 0.000004, NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680: 0.000004, NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545: 0.000004, NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.04661
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 292.6 88.4 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 292.6 88.4 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 292.6 88.4 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 292.6 88.4 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 292.6 88.4 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 292.6 88.4 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -506.456606 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.727039 0.005000 1.945688 1.743340
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907955_1_875_MLBR_RS04105: 0.000004, NC_002677_1_NP_301631_1_503_ML0837: 0.000004, NZ_LVXE01000065_1_WP_010907955_1_2442_A3216_RS12700: 0.000004, NZ_LYPH01000069_1_WP_010907955_1_2427_A8144_RS11680: 0.000004, NZ_CP029543_1_WP_010907955_1_894_DIJ64_RS04545: 0.000004, NZ_AP014567_1_WP_010907955_1_909_JK2ML_RS04620: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.72704 p = 0.00500 q = 1.94569
(p1 = 0.27296) w = 1.74334
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07270 0.07270 0.07270 0.07270 0.07270 0.07270 0.07270 0.07270 0.07270 0.07270 0.27296
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.74334
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 292.6 88.4 0.4759 0.0000 0.0000 0.0 0.0
7..2 0.000 292.6 88.4 0.4759 0.0000 0.0000 0.0 0.0
7..3 0.000 292.6 88.4 0.4759 0.0000 0.0000 0.0 0.0
7..4 0.000 292.6 88.4 0.4759 0.0000 0.0000 0.0 0.0
7..5 0.000 292.6 88.4 0.4759 0.0000 0.0000 0.0 0.0
7..6 0.000 292.6 88.4 0.4759 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907955_1_875_MLBR_RS04105)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907955_1_875_MLBR_RS04105)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Time used: 0:13
Model 1: NearlyNeutral -506.456613 Model 2: PositiveSelection -506.456608 Model 0: one-ratio -506.456616 Model 7: beta -506.456591 Model 8: beta&w>1 -506.456606 Model 0 vs 1 5.999999984851456E-6 Model 2 vs 1 9.999999974752427E-6 Model 8 vs 7 3.000000003794412E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
