--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Jan 24 09:20:01 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1294/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.35 -349.60
2 -346.41 -350.34
--------------------------------------
TOTAL -346.38 -350.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891688 0.085073 0.356749 1.456219 0.857652 1501.00 1501.00 1.000
r(A<->C){all} 0.163578 0.019820 0.000004 0.447294 0.125445 239.09 268.30 1.003
r(A<->G){all} 0.153608 0.017010 0.000065 0.413415 0.120591 294.70 302.57 1.000
r(A<->T){all} 0.168778 0.020235 0.000114 0.446384 0.129499 112.60 214.64 1.001
r(C<->G){all} 0.176389 0.021631 0.000029 0.469762 0.139827 172.71 217.06 1.000
r(C<->T){all} 0.159868 0.018998 0.000032 0.448835 0.122190 76.14 136.16 1.002
r(G<->T){all} 0.177778 0.022557 0.000142 0.482849 0.137699 107.75 187.89 1.000
pi(A){all} 0.222996 0.000665 0.174482 0.273642 0.222187 1241.26 1278.82 1.002
pi(C){all} 0.284948 0.000774 0.230220 0.339884 0.284163 1210.33 1339.70 1.002
pi(G){all} 0.304901 0.000799 0.254981 0.363897 0.304171 1167.76 1212.86 1.000
pi(T){all} 0.187155 0.000582 0.137818 0.233558 0.186173 1245.30 1307.28 1.000
alpha{1,2} 0.414892 0.225222 0.000101 1.402263 0.240039 1250.75 1295.44 1.001
alpha{3} 0.465595 0.235729 0.000476 1.429992 0.301062 1206.20 1255.29 1.000
pinvar{all} 0.993538 0.000061 0.979035 0.999998 0.995911 1134.97 1218.12 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -336.353143
Model 2: PositiveSelection -336.353142
Model 0: one-ratio -336.353144
Model 7: beta -336.35315
Model 8: beta&w>1 -336.353133
Model 0 vs 1 1.9999999949504854E-6
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 3.400000002784509E-5
>C1
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C2
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C3
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C4
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C5
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C6
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=84
C1 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C2 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C3 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C4 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C5 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C6 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
**************************************************
C1 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C2 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C3 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C4 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C5 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C6 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 84 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 84 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2520]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2520]--->[2520]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.606 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C2 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C3 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C4 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C5 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
C6 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
**************************************************
C1 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C2 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C3 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C4 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C5 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
C6 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
C2 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
C3 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
C4 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
C5 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
C6 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
**************************************************
C1 CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
C2 CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
C3 CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
C4 CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
C5 CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
C6 CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
**************************************************
C1 AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
C2 AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
C3 AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
C4 AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
C5 AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
C6 AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
**************************************************
C1 TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
C2 TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
C3 TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
C4 TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
C5 TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
C6 TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
**************************************************
C1 GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
C2 GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
C3 GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
C4 GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
C5 GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
C6 GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
**************************************************
C1 GG
C2 GG
C3 GG
C4 GG
C5 GG
C6 GG
**
>C1
TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
GG
>C2
TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
GG
>C3
TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
GG
>C4
TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
GG
>C5
TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
GG
>C6
TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA
CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG
AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT
TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG
GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC
GG
>C1
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C2
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C3
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C4
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C5
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
>C6
LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 252 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579857524
Setting output file names to "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1717850156
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5248598772
Seed = 1943921780
Swapseed = 1579857524
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -563.988082 -- -24.965149
Chain 2 -- -563.987996 -- -24.965149
Chain 3 -- -563.988049 -- -24.965149
Chain 4 -- -563.988082 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -563.988049 -- -24.965149
Chain 2 -- -563.988049 -- -24.965149
Chain 3 -- -563.988082 -- -24.965149
Chain 4 -- -563.988082 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-563.988] (-563.988) (-563.988) (-563.988) * [-563.988] (-563.988) (-563.988) (-563.988)
500 -- [-350.201] (-354.000) (-356.320) (-351.950) * (-352.156) (-351.239) (-351.284) [-351.098] -- 0:00:00
1000 -- (-358.117) (-353.975) (-359.566) [-354.490] * (-353.559) (-354.844) [-353.848] (-358.750) -- 0:00:00
1500 -- (-357.875) (-350.313) (-351.286) [-352.107] * (-360.013) (-355.017) (-361.138) [-359.851] -- 0:00:00
2000 -- (-362.792) (-361.002) [-357.532] (-357.538) * (-353.971) (-355.334) (-353.791) [-360.613] -- 0:00:00
2500 -- (-366.090) [-353.339] (-363.469) (-350.316) * (-357.027) (-353.163) (-357.584) [-352.776] -- 0:00:00
3000 -- (-353.071) (-361.539) (-356.014) [-355.111] * (-358.099) (-361.669) (-364.085) [-358.593] -- 0:00:00
3500 -- (-359.459) (-352.684) [-352.479] (-358.842) * (-360.313) (-356.463) [-356.329] (-362.893) -- 0:00:00
4000 -- [-356.252] (-356.568) (-357.778) (-361.292) * [-357.238] (-354.322) (-356.944) (-361.516) -- 0:00:00
4500 -- (-353.313) (-362.179) [-361.867] (-358.342) * [-360.243] (-353.660) (-353.008) (-358.435) -- 0:00:00
5000 -- (-358.130) (-353.230) (-354.575) [-354.910] * [-361.425] (-359.329) (-350.557) (-354.985) -- 0:00:00
Average standard deviation of split frequencies: 0.062854
5500 -- (-357.562) [-354.001] (-360.205) (-357.170) * (-364.218) [-353.208] (-369.448) (-356.420) -- 0:00:00
6000 -- (-359.478) [-355.542] (-352.372) (-357.000) * [-357.627] (-362.625) (-356.455) (-359.262) -- 0:00:00
6500 -- [-349.924] (-367.307) (-355.668) (-350.281) * (-366.115) [-357.100] (-357.186) (-360.101) -- 0:00:00
7000 -- (-353.901) [-351.485] (-355.506) (-354.061) * [-361.638] (-356.836) (-364.851) (-367.320) -- 0:00:00
7500 -- (-349.352) (-373.140) (-375.773) [-358.179] * (-366.839) (-359.755) [-351.569] (-358.175) -- 0:00:00
8000 -- (-352.747) (-354.990) (-373.069) [-361.487] * [-353.907] (-357.811) (-372.495) (-350.400) -- 0:00:00
8500 -- (-358.381) [-355.155] (-364.048) (-367.573) * (-360.181) [-358.101] (-359.320) (-349.092) -- 0:01:56
9000 -- (-356.786) [-359.823] (-361.559) (-360.019) * (-350.599) (-360.091) (-358.499) [-345.840] -- 0:01:50
9500 -- (-357.790) (-354.617) [-352.410] (-363.592) * (-349.440) (-355.274) (-349.967) [-346.116] -- 0:01:44
10000 -- (-353.830) (-365.426) [-349.098] (-364.654) * [-346.871] (-359.102) (-347.341) (-347.353) -- 0:01:39
Average standard deviation of split frequencies: 0.070711
10500 -- [-353.282] (-362.189) (-350.801) (-351.782) * [-346.021] (-375.358) (-349.095) (-345.174) -- 0:01:34
11000 -- (-350.650) (-354.447) (-348.257) [-346.851] * (-349.082) (-355.564) (-346.138) [-347.135] -- 0:01:29
11500 -- (-345.305) (-355.908) (-347.690) [-347.265] * (-346.679) [-357.207] (-347.534) (-346.443) -- 0:01:25
12000 -- [-345.439] (-360.003) (-345.930) (-351.398) * (-351.135) [-357.180] (-346.960) (-346.382) -- 0:01:22
12500 -- [-346.126] (-368.837) (-345.342) (-346.922) * (-346.249) (-355.068) [-347.353] (-346.965) -- 0:01:19
13000 -- [-347.287] (-357.965) (-346.564) (-346.026) * (-345.060) (-360.815) [-346.281] (-347.561) -- 0:01:15
13500 -- (-351.215) [-347.944] (-345.662) (-347.668) * (-349.209) [-353.260] (-347.348) (-344.973) -- 0:01:13
14000 -- (-345.722) [-345.453] (-346.779) (-347.296) * [-347.829] (-353.104) (-346.864) (-346.227) -- 0:01:10
14500 -- (-347.058) (-350.264) (-351.077) [-346.035] * (-346.679) [-355.795] (-349.323) (-346.258) -- 0:01:07
15000 -- (-347.617) (-346.473) (-351.690) [-346.343] * (-350.019) (-355.350) [-347.843] (-347.689) -- 0:01:05
Average standard deviation of split frequencies: 0.055979
15500 -- (-346.890) (-348.610) (-346.196) [-345.111] * (-347.048) (-352.665) [-348.791] (-347.721) -- 0:01:03
16000 -- (-347.536) (-346.689) (-346.206) [-352.282] * (-348.476) (-363.626) (-347.793) [-348.660] -- 0:01:01
16500 -- (-347.786) [-345.016] (-346.458) (-351.690) * (-345.745) [-351.539] (-345.003) (-345.999) -- 0:00:59
17000 -- (-349.811) (-349.335) [-345.909] (-354.366) * [-347.131] (-356.371) (-348.956) (-347.925) -- 0:00:57
17500 -- [-350.147] (-353.502) (-346.464) (-348.573) * (-351.568) (-364.808) (-347.466) [-348.199] -- 0:00:56
18000 -- (-347.012) (-352.068) [-346.928] (-348.641) * (-345.787) (-350.527) [-350.077] (-349.758) -- 0:00:54
18500 -- (-347.387) (-349.767) (-349.854) [-347.628] * [-345.944] (-348.163) (-345.911) (-348.629) -- 0:00:53
19000 -- [-344.883] (-348.694) (-345.438) (-346.247) * [-346.492] (-348.185) (-350.183) (-348.387) -- 0:00:51
19500 -- (-348.797) (-347.596) [-346.567] (-348.146) * (-348.748) (-345.980) [-347.192] (-347.427) -- 0:00:50
20000 -- (-345.889) (-346.134) [-347.894] (-352.816) * (-345.631) [-346.220] (-348.567) (-347.174) -- 0:00:49
Average standard deviation of split frequencies: 0.061227
20500 -- (-350.323) [-345.404] (-347.467) (-347.377) * (-345.743) (-352.151) (-350.170) [-346.163] -- 0:00:47
21000 -- (-351.073) (-349.930) (-349.758) [-346.102] * (-347.857) [-347.794] (-351.538) (-346.160) -- 0:00:46
21500 -- [-345.923] (-346.792) (-346.634) (-347.185) * [-345.408] (-345.448) (-345.901) (-346.577) -- 0:00:45
22000 -- (-349.598) (-348.349) [-345.264] (-346.782) * (-347.600) (-347.685) [-347.117] (-345.673) -- 0:00:44
22500 -- (-346.683) [-345.950] (-347.813) (-345.455) * (-345.642) (-347.899) [-348.775] (-348.889) -- 0:00:43
23000 -- (-347.235) [-346.777] (-347.645) (-348.590) * [-349.408] (-354.104) (-350.087) (-347.850) -- 0:00:42
23500 -- (-347.243) [-347.265] (-348.114) (-350.867) * (-349.295) (-349.790) (-348.308) [-345.220] -- 0:00:41
24000 -- (-348.283) [-346.742] (-348.777) (-350.110) * (-347.144) [-347.089] (-348.099) (-349.479) -- 0:00:40
24500 -- (-348.092) [-346.861] (-348.145) (-347.574) * (-353.840) [-345.298] (-347.176) (-348.294) -- 0:00:39
25000 -- (-345.608) [-352.154] (-345.654) (-347.349) * (-347.686) (-346.558) [-345.904] (-347.306) -- 0:00:39
Average standard deviation of split frequencies: 0.056041
25500 -- (-346.983) [-348.293] (-345.907) (-346.400) * (-348.375) (-346.345) [-348.815] (-347.660) -- 0:00:38
26000 -- (-346.759) [-347.051] (-350.299) (-348.334) * (-347.165) [-348.630] (-348.952) (-347.819) -- 0:01:14
26500 -- (-347.299) (-346.999) (-347.170) [-346.676] * (-347.073) (-345.248) (-355.872) [-345.312] -- 0:01:13
27000 -- (-345.569) (-346.466) (-346.482) [-346.359] * (-355.236) [-346.531] (-349.733) (-350.029) -- 0:01:12
27500 -- (-347.411) (-345.338) (-349.010) [-345.705] * (-348.930) (-347.803) (-347.457) [-347.033] -- 0:01:10
28000 -- (-349.070) [-345.381] (-350.374) (-345.769) * (-348.116) (-345.478) [-348.298] (-345.408) -- 0:01:09
28500 -- [-346.011] (-346.262) (-345.706) (-346.259) * (-350.645) (-353.648) [-345.707] (-346.275) -- 0:01:08
29000 -- (-346.712) (-351.914) (-345.876) [-350.230] * (-346.015) [-345.441] (-345.895) (-346.367) -- 0:01:06
29500 -- (-346.520) (-347.521) (-347.594) [-346.011] * [-345.567] (-350.061) (-346.530) (-347.773) -- 0:01:05
30000 -- (-347.764) [-345.354] (-347.671) (-346.961) * (-347.852) (-348.427) [-347.089] (-346.973) -- 0:01:04
Average standard deviation of split frequencies: 0.040526
30500 -- (-347.473) (-349.100) [-346.724] (-350.199) * (-345.585) (-347.403) (-346.328) [-345.535] -- 0:01:03
31000 -- (-348.883) [-347.426] (-346.832) (-347.573) * (-347.188) [-346.854] (-348.774) (-346.351) -- 0:01:02
31500 -- (-347.216) (-347.028) [-345.341] (-348.051) * (-349.297) [-346.530] (-345.262) (-346.252) -- 0:01:01
32000 -- (-346.590) (-346.418) (-346.211) [-346.444] * (-350.634) (-347.823) [-346.258] (-346.520) -- 0:01:00
32500 -- (-353.676) (-345.927) (-346.157) [-347.996] * (-347.971) (-344.889) [-345.294] (-348.552) -- 0:00:59
33000 -- (-348.756) [-348.236] (-354.885) (-346.927) * [-348.763] (-347.112) (-345.876) (-351.116) -- 0:00:58
33500 -- (-346.532) [-345.330] (-349.057) (-346.433) * (-347.512) (-349.363) [-346.384] (-348.608) -- 0:00:57
34000 -- (-345.512) [-345.992] (-350.388) (-346.184) * (-346.509) (-346.620) (-345.240) [-348.035] -- 0:00:56
34500 -- (-346.041) (-348.379) (-348.512) [-346.716] * (-345.736) (-346.309) [-345.262] (-349.952) -- 0:00:55
35000 -- (-346.161) [-349.066] (-350.704) (-346.430) * (-344.850) (-348.098) [-346.167] (-347.127) -- 0:00:55
Average standard deviation of split frequencies: 0.035712
35500 -- (-346.401) (-348.297) (-346.567) [-346.383] * (-350.219) (-347.855) (-350.051) [-347.538] -- 0:00:54
36000 -- (-345.066) (-346.395) (-349.579) [-348.342] * [-347.061] (-348.928) (-345.639) (-348.224) -- 0:00:53
36500 -- [-347.800] (-347.895) (-348.926) (-350.580) * [-345.159] (-347.109) (-348.682) (-348.462) -- 0:00:52
37000 -- (-349.722) [-347.976] (-346.734) (-351.621) * (-350.001) [-346.722] (-345.654) (-345.880) -- 0:00:52
37500 -- (-347.786) (-345.735) [-345.967] (-346.460) * (-345.246) (-345.976) [-346.281] (-345.873) -- 0:00:51
38000 -- (-345.969) (-351.664) (-346.103) [-348.025] * (-344.978) (-347.013) [-352.115] (-345.587) -- 0:00:50
38500 -- (-344.823) (-349.394) (-345.880) [-347.466] * (-348.995) (-347.472) [-348.425] (-348.136) -- 0:00:49
39000 -- (-344.945) [-347.858] (-350.713) (-345.261) * (-346.130) (-346.204) [-346.839] (-346.442) -- 0:00:49
39500 -- [-345.209] (-347.299) (-346.533) (-348.144) * [-346.526] (-355.537) (-348.079) (-345.873) -- 0:00:48
40000 -- [-345.930] (-347.564) (-346.011) (-347.542) * [-346.365] (-350.457) (-345.923) (-346.211) -- 0:00:48
Average standard deviation of split frequencies: 0.035328
40500 -- (-349.841) (-349.206) [-345.483] (-349.417) * (-345.371) (-352.337) [-347.606] (-346.485) -- 0:00:47
41000 -- [-347.498] (-345.633) (-348.080) (-346.460) * [-345.560] (-349.339) (-348.084) (-347.544) -- 0:00:46
41500 -- (-345.723) [-346.221] (-351.914) (-350.252) * (-346.130) (-346.878) (-348.585) [-347.841] -- 0:00:46
42000 -- (-346.886) (-347.025) [-352.390] (-355.356) * (-348.472) [-348.063] (-345.113) (-347.949) -- 0:00:45
42500 -- (-347.394) (-347.199) [-349.302] (-345.990) * [-345.597] (-349.489) (-349.214) (-349.214) -- 0:01:07
43000 -- [-345.496] (-345.853) (-346.481) (-349.283) * (-349.439) [-346.737] (-345.245) (-346.483) -- 0:01:06
43500 -- (-345.687) (-345.945) [-346.423] (-350.300) * [-345.491] (-348.732) (-345.449) (-351.204) -- 0:01:05
44000 -- [-346.387] (-347.937) (-345.236) (-346.980) * (-349.377) (-348.641) [-347.074] (-348.121) -- 0:01:05
44500 -- (-345.766) (-345.791) [-347.767] (-348.763) * [-347.166] (-349.516) (-345.839) (-348.519) -- 0:01:04
45000 -- (-345.224) [-345.145] (-352.952) (-346.301) * (-346.422) (-350.204) [-346.096] (-349.952) -- 0:01:03
Average standard deviation of split frequencies: 0.027949
45500 -- [-345.464] (-347.635) (-347.112) (-347.091) * (-347.526) [-346.632] (-352.671) (-348.428) -- 0:01:02
46000 -- (-348.848) (-345.841) (-349.623) [-346.748] * (-346.103) (-350.407) [-346.764] (-347.678) -- 0:01:02
46500 -- (-350.601) (-346.093) (-348.834) [-345.824] * [-346.582] (-349.684) (-345.900) (-347.863) -- 0:01:01
47000 -- [-349.852] (-349.852) (-349.082) (-349.225) * (-347.380) (-347.985) [-345.082] (-346.689) -- 0:01:00
47500 -- (-347.844) (-348.181) [-345.126] (-348.903) * (-345.191) [-347.174] (-345.519) (-347.068) -- 0:01:00
48000 -- (-349.501) [-345.044] (-348.826) (-345.565) * (-350.630) (-350.476) [-346.853] (-345.382) -- 0:00:59
48500 -- (-350.118) (-346.192) (-346.019) [-344.807] * (-347.007) (-351.104) [-346.548] (-347.757) -- 0:00:58
49000 -- (-350.061) [-346.516] (-345.517) (-350.058) * (-347.160) (-351.825) (-348.085) [-346.373] -- 0:00:58
49500 -- (-347.140) [-346.638] (-347.642) (-347.309) * (-345.767) (-351.695) [-346.432] (-347.579) -- 0:00:57
50000 -- [-347.371] (-350.029) (-345.587) (-349.519) * (-344.787) [-348.291] (-348.991) (-346.011) -- 0:00:57
Average standard deviation of split frequencies: 0.028355
50500 -- (-348.537) [-346.118] (-347.155) (-345.756) * (-347.017) (-346.106) (-349.851) [-347.139] -- 0:00:56
51000 -- (-346.605) (-348.309) (-348.661) [-346.567] * [-346.415] (-346.053) (-349.147) (-349.201) -- 0:00:55
51500 -- (-346.508) [-348.516] (-348.098) (-345.409) * [-346.150] (-345.633) (-346.276) (-350.505) -- 0:00:55
52000 -- [-346.636] (-346.246) (-347.611) (-348.419) * (-346.331) (-348.503) (-352.286) [-351.781] -- 0:00:54
52500 -- [-349.042] (-345.467) (-345.939) (-346.567) * [-347.816] (-347.069) (-350.261) (-349.463) -- 0:00:54
53000 -- [-347.247] (-347.237) (-346.693) (-346.347) * [-346.838] (-350.374) (-346.592) (-348.946) -- 0:00:53
53500 -- [-348.132] (-345.609) (-349.814) (-346.923) * (-346.627) (-347.398) [-346.274] (-347.707) -- 0:00:53
54000 -- (-348.495) (-352.206) (-359.869) [-347.584] * (-347.435) (-347.203) (-345.840) [-348.197] -- 0:00:52
54500 -- (-345.880) [-346.925] (-353.490) (-348.344) * (-351.703) (-347.115) (-345.918) [-345.461] -- 0:00:52
55000 -- [-350.053] (-348.842) (-348.175) (-347.016) * [-347.264] (-347.201) (-351.936) (-346.977) -- 0:00:51
Average standard deviation of split frequencies: 0.028355
55500 -- (-346.284) [-348.070] (-345.799) (-347.611) * (-345.627) (-346.707) [-346.438] (-347.755) -- 0:00:51
56000 -- (-346.766) (-346.017) (-346.870) [-346.177] * (-345.606) [-347.927] (-347.939) (-354.295) -- 0:00:50
56500 -- (-348.258) [-346.264] (-345.562) (-345.853) * [-351.283] (-347.918) (-347.322) (-347.622) -- 0:00:50
57000 -- (-347.182) (-348.041) [-345.373] (-344.927) * (-347.045) (-346.070) [-347.582] (-351.748) -- 0:00:49
57500 -- (-347.743) (-345.513) (-349.859) [-346.845] * (-347.932) [-349.053] (-348.503) (-348.467) -- 0:00:49
58000 -- [-346.950] (-350.356) (-349.594) (-346.008) * (-346.789) (-351.447) [-345.776] (-348.439) -- 0:00:48
58500 -- (-350.703) (-347.178) [-346.983] (-346.280) * (-346.721) (-348.853) (-348.403) [-344.955] -- 0:00:48
59000 -- (-347.313) (-345.944) [-347.425] (-348.341) * [-346.654] (-345.945) (-351.330) (-345.182) -- 0:00:47
59500 -- [-346.624] (-347.118) (-347.898) (-346.075) * (-346.194) [-347.724] (-347.107) (-348.534) -- 0:01:03
60000 -- (-350.253) (-344.959) [-345.043] (-348.012) * [-346.312] (-352.959) (-345.580) (-349.167) -- 0:01:02
Average standard deviation of split frequencies: 0.022880
60500 -- (-346.807) (-345.361) (-347.586) [-349.625] * (-347.087) (-350.629) [-346.433] (-346.710) -- 0:01:02
61000 -- (-349.739) (-345.145) (-348.544) [-348.676] * (-347.231) (-347.305) (-349.270) [-345.508] -- 0:01:01
61500 -- (-345.783) [-346.004] (-348.266) (-350.799) * (-346.373) (-346.680) [-346.833] (-349.087) -- 0:01:01
62000 -- (-345.434) [-350.467] (-348.046) (-346.012) * (-346.493) [-345.960] (-350.507) (-348.985) -- 0:01:00
62500 -- (-347.505) (-348.670) (-360.686) [-345.633] * (-346.347) [-345.426] (-345.942) (-347.911) -- 0:01:00
63000 -- (-347.098) (-346.833) [-345.420] (-348.926) * [-348.502] (-345.612) (-347.006) (-347.153) -- 0:00:59
63500 -- (-346.104) (-345.361) (-345.605) [-346.662] * (-347.195) [-347.476] (-348.246) (-348.741) -- 0:00:58
64000 -- (-346.444) (-347.812) (-348.577) [-348.364] * (-349.384) [-347.771] (-347.901) (-350.573) -- 0:00:58
64500 -- (-346.641) (-347.955) (-347.175) [-350.615] * [-348.647] (-348.406) (-347.765) (-354.028) -- 0:00:58
65000 -- (-345.882) (-346.944) [-347.026] (-348.078) * [-346.042] (-347.777) (-347.963) (-346.844) -- 0:00:57
Average standard deviation of split frequencies: 0.024435
65500 -- (-346.644) [-347.276] (-346.505) (-351.300) * (-348.232) (-346.063) [-345.276] (-346.006) -- 0:00:57
66000 -- (-346.952) (-345.640) (-348.331) [-346.086] * [-345.857] (-346.705) (-347.289) (-347.437) -- 0:00:56
66500 -- (-348.267) (-349.055) (-346.178) [-345.657] * (-346.999) (-345.570) (-351.014) [-346.449] -- 0:00:56
67000 -- (-351.146) (-346.769) (-347.893) [-352.800] * [-347.230] (-347.066) (-348.150) (-344.858) -- 0:00:55
67500 -- [-345.856] (-345.466) (-349.126) (-347.354) * [-346.178] (-350.421) (-348.488) (-345.558) -- 0:00:55
68000 -- [-345.326] (-348.177) (-346.919) (-348.968) * (-347.428) (-347.805) [-347.607] (-348.810) -- 0:00:54
68500 -- (-348.412) (-347.906) (-347.155) [-347.255] * [-348.468] (-346.911) (-347.533) (-345.615) -- 0:00:54
69000 -- [-349.403] (-352.252) (-346.894) (-347.193) * [-348.312] (-347.646) (-350.673) (-345.129) -- 0:00:53
69500 -- (-346.473) (-345.792) (-345.100) [-345.874] * (-350.062) (-346.483) [-347.113] (-348.198) -- 0:00:53
70000 -- [-345.407] (-346.494) (-346.431) (-348.638) * (-345.710) (-348.314) [-346.286] (-346.803) -- 0:00:53
Average standard deviation of split frequencies: 0.025942
70500 -- (-349.157) (-348.148) [-346.140] (-347.855) * (-345.325) [-348.445] (-352.638) (-346.652) -- 0:00:52
71000 -- (-346.445) [-345.554] (-347.913) (-346.512) * (-347.924) [-345.104] (-350.105) (-349.900) -- 0:00:52
71500 -- [-345.056] (-351.786) (-347.297) (-346.729) * (-347.853) (-347.482) [-348.158] (-350.712) -- 0:00:51
72000 -- (-346.120) (-346.621) [-347.594] (-345.097) * (-346.617) [-349.372] (-349.245) (-348.926) -- 0:00:51
72500 -- (-346.217) [-346.774] (-346.131) (-345.579) * (-347.452) [-346.632] (-349.768) (-348.801) -- 0:00:51
73000 -- (-347.925) (-346.209) (-345.908) [-345.314] * [-349.820] (-347.447) (-347.716) (-348.278) -- 0:00:50
73500 -- (-346.493) (-345.851) (-348.655) [-346.507] * (-348.247) [-345.532] (-345.667) (-352.370) -- 0:00:50
74000 -- (-349.538) (-349.065) (-350.098) [-347.221] * (-347.162) [-349.210] (-350.694) (-350.456) -- 0:00:50
74500 -- (-347.156) (-347.149) (-348.450) [-349.086] * (-346.253) (-348.465) (-346.015) [-348.189] -- 0:00:49
75000 -- (-348.984) [-350.257] (-347.161) (-348.645) * (-345.648) (-347.140) [-353.143] (-345.260) -- 0:00:49
Average standard deviation of split frequencies: 0.022743
75500 -- (-348.110) [-345.150] (-347.242) (-348.622) * [-346.639] (-346.272) (-351.894) (-345.042) -- 0:00:48
76000 -- (-347.411) [-348.658] (-345.973) (-347.752) * (-349.574) (-347.180) (-349.504) [-347.877] -- 0:01:00
76500 -- (-347.456) [-349.172] (-347.318) (-345.380) * (-351.557) (-350.905) (-347.765) [-345.545] -- 0:01:00
77000 -- (-346.196) [-345.317] (-345.169) (-346.692) * (-347.409) (-348.489) (-345.950) [-347.347] -- 0:00:59
77500 -- [-345.818] (-353.567) (-346.150) (-353.315) * (-348.755) (-344.988) (-346.141) [-346.540] -- 0:00:59
78000 -- (-345.608) (-344.889) (-346.100) [-349.687] * (-355.609) [-344.806] (-347.151) (-347.586) -- 0:00:59
78500 -- (-347.281) (-346.849) [-350.714] (-350.203) * (-346.036) (-346.038) [-348.355] (-346.367) -- 0:00:58
79000 -- (-350.432) (-346.330) [-347.997] (-347.595) * (-345.019) [-345.019] (-351.115) (-350.946) -- 0:00:58
79500 -- (-347.868) [-345.024] (-347.527) (-349.462) * (-345.074) [-348.211] (-348.766) (-346.810) -- 0:00:57
80000 -- (-345.873) (-346.708) (-347.844) [-345.214] * (-346.054) (-346.121) [-350.333] (-348.284) -- 0:00:57
Average standard deviation of split frequencies: 0.024674
80500 -- (-345.912) (-354.255) (-347.485) [-347.351] * (-345.957) (-347.754) [-347.484] (-345.754) -- 0:00:57
81000 -- [-346.389] (-353.225) (-347.240) (-346.278) * (-345.374) (-346.950) (-346.118) [-345.728] -- 0:00:56
81500 -- (-350.587) (-346.447) [-346.780] (-345.872) * (-345.615) (-347.163) [-346.387] (-347.674) -- 0:00:56
82000 -- (-346.629) (-347.296) [-347.563] (-348.487) * (-346.695) [-349.985] (-346.083) (-356.010) -- 0:00:55
82500 -- [-345.312] (-346.996) (-347.579) (-347.823) * (-346.556) (-347.827) [-344.743] (-346.936) -- 0:00:55
83000 -- [-347.270] (-348.522) (-346.915) (-347.737) * (-346.955) [-348.125] (-346.930) (-349.038) -- 0:00:55
83500 -- [-347.953] (-350.205) (-349.611) (-346.131) * (-347.649) (-346.763) (-349.602) [-349.229] -- 0:00:54
84000 -- (-352.216) [-347.445] (-348.577) (-355.147) * (-346.516) (-351.452) (-347.274) [-345.837] -- 0:00:54
84500 -- (-345.958) (-347.304) [-346.599] (-346.613) * (-346.763) (-347.494) (-346.493) [-348.724] -- 0:00:54
85000 -- [-349.522] (-349.333) (-346.634) (-346.008) * (-344.861) (-347.219) (-348.756) [-345.234] -- 0:00:53
Average standard deviation of split frequencies: 0.023753
85500 -- (-350.131) [-347.943] (-346.385) (-346.106) * (-347.813) (-346.761) (-349.946) [-347.755] -- 0:00:53
86000 -- (-347.649) (-347.808) [-345.876] (-347.420) * [-345.896] (-348.459) (-347.676) (-350.202) -- 0:00:53
86500 -- (-349.074) (-347.451) (-345.908) [-350.429] * (-346.814) (-344.959) [-346.900] (-344.851) -- 0:00:52
87000 -- [-346.096] (-346.773) (-348.095) (-347.494) * [-348.338] (-348.427) (-345.981) (-347.033) -- 0:00:52
87500 -- [-347.881] (-347.653) (-347.908) (-344.765) * (-347.089) [-346.992] (-345.574) (-349.475) -- 0:00:52
88000 -- (-348.734) (-346.215) (-348.755) [-346.022] * [-346.277] (-345.586) (-347.242) (-348.995) -- 0:00:51
88500 -- (-347.702) [-352.083] (-352.482) (-349.327) * (-346.536) (-346.983) (-346.884) [-346.309] -- 0:00:51
89000 -- (-349.633) [-345.371] (-352.982) (-346.945) * (-350.667) (-349.304) (-345.496) [-345.633] -- 0:00:51
89500 -- (-346.102) (-351.047) [-346.863] (-346.652) * (-349.917) (-347.008) [-345.976] (-345.931) -- 0:00:50
90000 -- [-346.237] (-345.822) (-347.380) (-346.940) * [-347.093] (-349.484) (-346.166) (-346.140) -- 0:00:50
Average standard deviation of split frequencies: 0.021979
90500 -- (-344.850) (-349.290) [-346.034] (-347.293) * [-346.271] (-345.770) (-347.102) (-346.057) -- 0:00:50
91000 -- (-347.949) [-346.255] (-346.045) (-347.193) * (-347.923) (-345.012) (-346.910) [-345.722] -- 0:00:49
91500 -- (-353.976) (-345.574) (-347.882) [-347.210] * (-345.937) [-346.228] (-346.174) (-346.704) -- 0:00:49
92000 -- (-346.978) (-346.258) [-345.872] (-348.269) * (-347.576) (-347.737) [-347.470] (-346.258) -- 0:00:49
92500 -- (-348.540) [-346.252] (-346.462) (-346.363) * [-346.987] (-345.515) (-347.379) (-351.803) -- 0:00:49
93000 -- (-347.035) (-345.753) [-348.531] (-347.124) * (-348.013) [-349.776] (-345.457) (-346.880) -- 0:00:48
93500 -- (-345.264) [-346.778] (-351.569) (-346.402) * [-347.776] (-353.147) (-345.779) (-349.873) -- 0:00:48
94000 -- (-348.165) (-347.000) [-348.883] (-345.718) * (-348.161) [-348.340] (-345.061) (-350.649) -- 0:00:57
94500 -- (-347.077) [-347.967] (-347.321) (-345.410) * (-347.877) [-350.086] (-345.259) (-348.514) -- 0:00:57
95000 -- [-346.205] (-349.899) (-346.424) (-346.932) * (-348.620) [-345.996] (-348.824) (-348.184) -- 0:00:57
Average standard deviation of split frequencies: 0.017923
95500 -- [-348.060] (-345.676) (-345.285) (-351.105) * (-346.154) (-346.969) (-345.824) [-345.042] -- 0:00:56
96000 -- (-347.031) [-347.993] (-346.690) (-346.531) * [-347.425] (-347.711) (-347.634) (-348.753) -- 0:00:56
96500 -- [-346.594] (-349.147) (-347.299) (-346.462) * [-346.601] (-346.005) (-345.971) (-348.137) -- 0:00:56
97000 -- (-348.953) [-348.126] (-345.502) (-346.383) * [-345.794] (-348.601) (-345.916) (-346.455) -- 0:00:55
97500 -- [-348.705] (-346.697) (-347.739) (-345.478) * [-350.207] (-346.163) (-345.645) (-347.729) -- 0:00:55
98000 -- [-349.254] (-350.641) (-345.260) (-345.961) * [-347.704] (-350.407) (-345.975) (-348.068) -- 0:00:55
98500 -- [-347.644] (-346.451) (-351.114) (-350.778) * [-349.370] (-347.441) (-349.891) (-346.566) -- 0:00:54
99000 -- (-346.854) [-344.839] (-346.670) (-346.984) * [-346.643] (-346.283) (-347.035) (-348.996) -- 0:00:54
99500 -- (-345.810) (-349.835) [-347.236] (-350.626) * [-346.720] (-347.541) (-346.922) (-345.019) -- 0:00:54
100000 -- (-346.659) (-346.799) [-348.765] (-350.944) * (-346.403) (-347.480) (-347.829) [-349.804] -- 0:00:54
Average standard deviation of split frequencies: 0.018238
100500 -- (-346.582) (-346.006) (-345.810) [-349.798] * [-345.785] (-347.781) (-346.195) (-347.753) -- 0:00:53
101000 -- (-344.830) (-346.377) (-346.300) [-346.344] * (-347.939) (-349.169) [-345.734] (-345.854) -- 0:00:53
101500 -- [-344.707] (-348.688) (-346.922) (-346.115) * [-345.201] (-348.102) (-348.563) (-348.205) -- 0:00:53
102000 -- (-345.903) (-345.906) (-345.903) [-347.369] * [-346.360] (-347.253) (-347.747) (-349.191) -- 0:00:52
102500 -- (-347.147) (-346.190) [-346.784] (-346.460) * (-346.821) (-346.837) (-348.714) [-347.294] -- 0:00:52
103000 -- [-346.346] (-348.935) (-349.173) (-346.281) * (-346.066) (-350.007) [-348.869] (-345.509) -- 0:00:52
103500 -- (-347.115) (-349.778) [-346.632] (-350.407) * (-345.233) [-346.187] (-345.831) (-345.943) -- 0:00:51
104000 -- (-347.423) (-347.213) (-349.619) [-349.588] * (-347.427) (-345.246) (-347.011) [-348.221] -- 0:00:51
104500 -- (-347.918) [-345.857] (-353.839) (-349.204) * (-345.774) [-347.551] (-347.459) (-346.728) -- 0:00:51
105000 -- [-349.365] (-349.597) (-350.873) (-346.216) * (-347.264) [-346.063] (-346.323) (-349.795) -- 0:00:51
Average standard deviation of split frequencies: 0.017577
105500 -- [-346.943] (-347.464) (-345.529) (-346.197) * [-345.500] (-345.834) (-348.243) (-346.589) -- 0:00:50
106000 -- [-346.675] (-346.132) (-345.558) (-348.069) * (-344.838) (-347.826) [-346.715] (-346.454) -- 0:00:50
106500 -- [-346.327] (-347.179) (-348.495) (-348.273) * (-345.222) [-350.064] (-345.861) (-346.129) -- 0:00:50
107000 -- (-348.320) (-347.336) (-346.005) [-344.774] * (-348.386) [-349.229] (-345.346) (-347.812) -- 0:00:50
107500 -- (-347.903) [-347.846] (-346.554) (-347.713) * (-350.369) (-346.457) [-345.688] (-346.605) -- 0:00:49
108000 -- [-347.936] (-348.659) (-346.089) (-347.546) * (-349.926) [-346.557] (-347.799) (-346.044) -- 0:00:49
108500 -- (-348.827) [-347.930] (-345.712) (-345.420) * (-347.234) (-348.704) [-346.138] (-346.247) -- 0:00:49
109000 -- (-348.826) [-346.595] (-344.865) (-345.478) * (-348.161) [-346.022] (-346.355) (-346.098) -- 0:00:49
109500 -- [-347.154] (-345.802) (-345.459) (-346.435) * [-344.910] (-346.564) (-346.305) (-347.578) -- 0:00:48
110000 -- [-347.564] (-346.150) (-347.798) (-346.506) * [-346.781] (-345.730) (-345.768) (-345.488) -- 0:00:48
Average standard deviation of split frequencies: 0.019676
110500 -- (-350.766) (-354.832) (-345.919) [-346.318] * (-350.228) [-347.532] (-348.020) (-348.698) -- 0:00:48
111000 -- (-350.564) (-346.009) (-349.298) [-345.213] * [-347.132] (-348.809) (-348.553) (-346.645) -- 0:00:56
111500 -- (-350.535) [-346.313] (-345.608) (-347.065) * [-348.495] (-356.411) (-347.793) (-345.418) -- 0:00:55
112000 -- [-349.896] (-348.596) (-346.962) (-347.164) * [-346.160] (-351.133) (-348.482) (-345.675) -- 0:00:55
112500 -- [-347.248] (-347.161) (-348.386) (-347.301) * (-353.981) [-349.661] (-346.231) (-350.137) -- 0:00:55
113000 -- [-349.203] (-348.013) (-349.056) (-346.858) * [-348.093] (-348.405) (-346.731) (-347.584) -- 0:00:54
113500 -- (-347.062) [-347.090] (-348.984) (-348.182) * (-345.608) (-347.630) (-345.354) [-346.851] -- 0:00:54
114000 -- [-348.649] (-346.571) (-347.448) (-347.673) * [-345.725] (-349.304) (-347.188) (-347.812) -- 0:00:54
114500 -- [-345.188] (-345.288) (-347.511) (-348.755) * (-346.013) (-348.438) (-347.674) [-346.610] -- 0:00:54
115000 -- [-345.644] (-350.981) (-346.455) (-346.197) * (-349.779) [-346.688] (-347.222) (-348.678) -- 0:00:53
Average standard deviation of split frequencies: 0.017610
115500 -- (-349.751) (-344.924) (-346.480) [-345.056] * (-347.248) [-347.501] (-345.804) (-346.333) -- 0:00:53
116000 -- (-346.995) (-348.194) [-347.252] (-346.156) * (-347.467) [-344.875] (-345.748) (-346.233) -- 0:00:53
116500 -- [-348.186] (-348.299) (-346.421) (-348.290) * (-348.857) (-345.618) [-346.762] (-348.250) -- 0:00:53
117000 -- (-348.255) (-348.618) (-347.686) [-345.792] * (-346.359) [-346.430] (-345.460) (-347.343) -- 0:00:52
117500 -- (-350.402) [-349.856] (-346.765) (-348.670) * [-348.333] (-346.652) (-346.485) (-346.398) -- 0:00:52
118000 -- [-348.064] (-347.347) (-348.948) (-345.978) * (-347.933) (-347.272) (-346.998) [-348.619] -- 0:00:52
118500 -- (-347.221) [-346.069] (-346.411) (-351.264) * (-348.652) (-349.156) [-346.702] (-347.305) -- 0:00:52
119000 -- [-346.422] (-349.082) (-346.702) (-346.784) * (-349.459) (-347.215) (-345.372) [-346.580] -- 0:00:51
119500 -- (-346.969) (-346.254) [-349.469] (-348.957) * (-345.831) (-346.162) [-345.410] (-348.450) -- 0:00:51
120000 -- [-346.552] (-346.803) (-347.271) (-345.991) * [-345.917] (-348.564) (-347.063) (-346.042) -- 0:00:51
Average standard deviation of split frequencies: 0.019533
120500 -- [-347.021] (-346.203) (-347.048) (-345.880) * (-346.722) (-350.537) [-352.359] (-351.428) -- 0:00:51
121000 -- (-346.985) [-346.349] (-350.740) (-350.401) * [-346.728] (-345.414) (-348.159) (-349.183) -- 0:00:50
121500 -- (-347.286) (-348.054) [-349.438] (-346.282) * [-346.996] (-346.328) (-349.506) (-351.969) -- 0:00:50
122000 -- [-346.082] (-347.231) (-347.258) (-345.106) * [-347.125] (-345.803) (-346.049) (-350.987) -- 0:00:50
122500 -- [-345.392] (-351.425) (-345.912) (-345.043) * (-346.597) [-346.273] (-346.817) (-345.987) -- 0:00:50
123000 -- (-348.999) (-348.289) (-348.087) [-345.707] * [-345.965] (-348.741) (-348.723) (-351.885) -- 0:00:49
123500 -- [-352.230] (-345.219) (-346.779) (-344.823) * (-346.882) (-347.125) [-345.780] (-345.344) -- 0:00:49
124000 -- (-348.116) [-347.022] (-346.760) (-346.969) * (-353.361) [-347.334] (-349.876) (-346.083) -- 0:00:49
124500 -- (-349.265) [-346.193] (-346.067) (-346.658) * [-349.761] (-347.685) (-348.188) (-346.856) -- 0:00:49
125000 -- (-345.879) (-346.071) [-345.952] (-353.962) * [-346.997] (-346.939) (-347.545) (-345.333) -- 0:00:49
Average standard deviation of split frequencies: 0.018707
125500 -- (-345.020) [-346.735] (-347.160) (-348.507) * (-346.678) (-346.545) [-346.301] (-347.214) -- 0:00:48
126000 -- (-346.882) (-345.501) (-346.172) [-348.091] * (-346.820) (-348.808) [-346.579] (-346.506) -- 0:00:48
126500 -- (-346.305) [-349.409] (-347.763) (-348.239) * (-349.356) [-348.146] (-347.505) (-346.066) -- 0:00:48
127000 -- [-345.087] (-345.651) (-352.161) (-345.587) * (-352.307) (-345.771) (-348.045) [-346.461] -- 0:00:48
127500 -- (-345.648) (-345.245) (-346.495) [-348.399] * (-348.336) (-346.216) [-346.845] (-348.331) -- 0:00:47
128000 -- (-348.963) (-346.976) [-346.593] (-349.834) * (-347.824) (-348.612) [-346.539] (-347.885) -- 0:00:47
128500 -- (-347.163) [-347.185] (-352.019) (-346.253) * (-347.060) [-346.307] (-346.455) (-345.568) -- 0:00:54
129000 -- (-345.867) [-345.624] (-346.430) (-352.303) * [-346.718] (-348.843) (-346.879) (-345.793) -- 0:00:54
129500 -- (-347.421) [-346.427] (-348.565) (-348.591) * (-348.649) (-346.336) (-347.469) [-346.532] -- 0:00:53
130000 -- (-348.723) (-351.673) [-347.460] (-345.786) * [-346.808] (-346.514) (-345.444) (-349.377) -- 0:00:53
Average standard deviation of split frequencies: 0.017497
130500 -- [-346.383] (-347.923) (-346.099) (-348.545) * (-348.203) (-346.585) (-346.917) [-346.299] -- 0:00:53
131000 -- (-347.319) (-347.692) (-347.238) [-346.900] * (-349.287) [-351.917] (-347.225) (-345.715) -- 0:00:53
131500 -- (-346.830) (-349.077) [-347.418] (-346.672) * (-346.289) (-350.209) (-346.457) [-349.304] -- 0:00:52
132000 -- (-346.273) (-345.529) [-347.441] (-345.519) * (-348.244) (-347.808) (-347.483) [-347.106] -- 0:00:52
132500 -- (-347.907) (-348.860) [-348.443] (-346.279) * [-348.722] (-348.671) (-345.995) (-345.715) -- 0:00:52
133000 -- (-346.093) (-349.724) [-345.674] (-346.153) * (-346.018) (-351.671) (-347.336) [-345.155] -- 0:00:52
133500 -- [-345.776] (-345.570) (-346.976) (-346.879) * [-346.562] (-348.788) (-345.712) (-345.047) -- 0:00:51
134000 -- (-346.049) [-346.473] (-349.951) (-347.563) * (-350.007) (-351.224) (-347.780) [-348.153] -- 0:00:51
134500 -- (-346.232) [-348.550] (-346.628) (-347.027) * (-344.934) (-347.999) [-346.132] (-347.475) -- 0:00:51
135000 -- (-345.389) (-345.249) (-347.221) [-346.644] * (-348.207) [-348.643] (-347.250) (-347.105) -- 0:00:51
Average standard deviation of split frequencies: 0.017678
135500 -- (-345.840) (-348.492) (-349.077) [-349.511] * (-345.631) (-346.336) [-344.962] (-350.632) -- 0:00:51
136000 -- (-353.098) (-347.365) (-349.352) [-345.518] * (-346.332) [-346.665] (-348.610) (-351.226) -- 0:00:50
136500 -- [-348.870] (-347.280) (-346.151) (-346.199) * (-346.290) [-345.848] (-350.164) (-346.971) -- 0:00:50
137000 -- (-345.991) [-346.168] (-347.842) (-346.939) * (-346.111) (-352.622) (-347.181) [-346.175] -- 0:00:50
137500 -- (-347.365) [-345.656] (-347.583) (-349.965) * (-347.344) (-347.335) [-345.875] (-351.046) -- 0:00:50
138000 -- (-345.915) [-346.607] (-345.372) (-347.138) * (-347.445) (-348.039) (-350.018) [-351.645] -- 0:00:49
138500 -- (-347.059) (-348.315) (-347.618) [-347.009] * (-348.068) [-350.687] (-350.196) (-348.612) -- 0:00:49
139000 -- (-347.061) (-346.446) (-347.439) [-348.489] * (-352.399) [-350.390] (-350.419) (-347.277) -- 0:00:49
139500 -- (-345.283) [-346.159] (-346.453) (-347.070) * (-345.967) [-347.773] (-349.444) (-345.390) -- 0:00:49
140000 -- (-346.522) (-346.776) [-345.826] (-346.321) * (-346.228) [-348.268] (-345.366) (-346.345) -- 0:00:49
Average standard deviation of split frequencies: 0.017929
140500 -- (-347.893) [-346.211] (-348.367) (-346.995) * [-346.037] (-346.592) (-348.978) (-345.782) -- 0:00:48
141000 -- (-346.772) (-346.186) (-345.083) [-350.679] * [-345.914] (-345.954) (-348.086) (-345.973) -- 0:00:48
141500 -- (-347.161) (-346.044) (-348.735) [-345.957] * [-346.799] (-344.850) (-346.450) (-349.589) -- 0:00:48
142000 -- (-346.536) (-345.571) (-345.609) [-346.650] * (-345.303) [-345.760] (-346.495) (-349.080) -- 0:00:48
142500 -- (-348.750) (-349.021) [-347.153] (-348.971) * (-348.228) (-347.927) (-347.999) [-349.513] -- 0:00:48
143000 -- [-346.946] (-347.805) (-346.635) (-351.895) * (-347.926) (-348.371) [-346.316] (-348.593) -- 0:00:47
143500 -- (-345.404) [-345.692] (-347.762) (-345.427) * (-346.075) (-347.145) [-347.896] (-345.533) -- 0:00:47
144000 -- (-346.412) (-349.292) (-346.293) [-346.494] * (-345.171) (-348.509) (-348.768) [-347.780] -- 0:00:47
144500 -- (-347.514) (-347.208) [-348.034] (-344.902) * (-350.855) (-347.269) [-345.202] (-347.009) -- 0:00:47
145000 -- [-345.754] (-347.125) (-345.416) (-347.126) * (-348.549) (-349.715) (-349.227) [-345.600] -- 0:00:47
Average standard deviation of split frequencies: 0.015221
145500 -- (-348.483) (-353.041) [-348.339] (-349.580) * (-345.274) (-345.601) [-345.770] (-348.086) -- 0:00:52
146000 -- (-350.601) (-345.889) [-345.566] (-347.737) * [-346.771] (-345.343) (-346.678) (-346.738) -- 0:00:52
146500 -- (-348.099) (-346.788) (-345.387) [-348.708] * (-345.936) (-346.974) [-345.639] (-347.901) -- 0:00:52
147000 -- [-346.353] (-347.324) (-346.411) (-346.957) * (-346.336) (-345.985) [-346.003] (-346.199) -- 0:00:52
147500 -- (-347.307) (-347.110) (-346.620) [-348.864] * [-347.427] (-345.867) (-347.016) (-352.010) -- 0:00:52
148000 -- (-350.027) (-345.951) [-345.436] (-345.773) * (-346.664) (-348.413) (-346.440) [-350.689] -- 0:00:51
148500 -- (-346.433) (-345.720) [-349.871] (-345.364) * (-346.183) [-345.294] (-345.912) (-350.632) -- 0:00:51
149000 -- (-349.432) [-345.716] (-348.895) (-348.932) * (-347.080) (-347.147) (-347.154) [-350.254] -- 0:00:51
149500 -- (-349.937) (-345.793) [-347.262] (-348.224) * (-346.492) (-347.979) (-346.232) [-352.659] -- 0:00:51
150000 -- (-349.650) (-346.566) [-347.689] (-346.654) * (-346.010) (-346.499) [-345.357] (-352.130) -- 0:00:51
Average standard deviation of split frequencies: 0.015644
150500 -- [-348.142] (-347.406) (-349.152) (-347.816) * (-345.573) (-346.941) (-349.184) [-348.019] -- 0:00:50
151000 -- (-347.603) (-346.406) (-347.534) [-345.080] * (-347.386) [-349.431] (-346.753) (-345.393) -- 0:00:50
151500 -- (-346.627) [-345.826] (-350.128) (-348.225) * (-345.880) (-351.180) [-345.523] (-352.288) -- 0:00:50
152000 -- (-345.707) (-346.463) [-347.254] (-346.650) * [-345.437] (-350.962) (-346.240) (-346.721) -- 0:00:50
152500 -- [-347.394] (-347.599) (-346.892) (-347.053) * (-345.545) (-345.937) [-346.923] (-346.342) -- 0:00:50
153000 -- (-346.653) [-345.274] (-345.456) (-347.787) * (-347.000) [-346.463] (-346.872) (-346.715) -- 0:00:49
153500 -- (-346.934) (-345.801) (-347.075) [-345.884] * (-347.311) (-346.070) (-347.963) [-346.930] -- 0:00:49
154000 -- [-349.179] (-347.327) (-347.974) (-345.509) * (-346.860) (-345.764) (-346.981) [-346.288] -- 0:00:49
154500 -- (-348.756) (-345.204) [-346.690] (-346.760) * [-346.010] (-351.768) (-345.962) (-349.327) -- 0:00:49
155000 -- (-346.514) (-346.135) (-345.966) [-346.729] * (-348.634) (-347.435) [-345.753] (-345.466) -- 0:00:49
Average standard deviation of split frequencies: 0.016016
155500 -- (-348.397) [-346.782] (-350.614) (-346.744) * (-346.408) (-348.452) [-346.744] (-345.108) -- 0:00:48
156000 -- (-348.470) (-352.620) [-348.795] (-346.950) * (-348.882) (-347.935) [-348.606] (-347.243) -- 0:00:48
156500 -- (-346.548) (-349.213) (-347.891) [-347.051] * (-348.381) (-345.924) [-347.575] (-348.361) -- 0:00:48
157000 -- (-346.962) [-345.434] (-353.161) (-345.698) * (-347.435) [-345.620] (-349.567) (-351.278) -- 0:00:48
157500 -- (-347.033) [-347.670] (-348.376) (-347.827) * (-347.069) [-347.004] (-348.892) (-348.343) -- 0:00:48
158000 -- (-349.095) (-347.731) (-348.669) [-347.945] * (-347.332) (-346.223) [-347.383] (-349.884) -- 0:00:47
158500 -- [-347.447] (-348.172) (-345.434) (-349.380) * (-351.311) (-345.401) (-347.954) [-348.867] -- 0:00:47
159000 -- (-350.099) (-345.796) [-346.234] (-347.072) * (-350.510) (-350.117) (-346.968) [-346.924] -- 0:00:47
159500 -- (-346.221) (-350.835) (-349.757) [-347.195] * (-349.175) (-345.844) (-349.682) [-345.697] -- 0:00:47
160000 -- (-346.247) (-349.333) (-348.756) [-346.825] * [-348.065] (-346.331) (-350.245) (-348.750) -- 0:00:47
Average standard deviation of split frequencies: 0.016396
160500 -- (-346.193) [-348.225] (-350.481) (-349.464) * (-347.243) (-349.647) [-348.892] (-349.368) -- 0:00:47
161000 -- [-348.598] (-348.186) (-348.211) (-348.570) * (-346.388) (-350.646) [-347.858] (-350.315) -- 0:00:46
161500 -- (-345.461) (-346.318) [-348.659] (-346.761) * (-347.640) (-351.658) (-346.933) [-346.112] -- 0:00:46
162000 -- [-345.790] (-345.612) (-354.923) (-346.275) * (-345.567) [-345.607] (-346.171) (-346.428) -- 0:00:46
162500 -- (-350.510) [-348.519] (-347.959) (-349.453) * [-349.492] (-347.741) (-346.617) (-348.186) -- 0:00:46
163000 -- (-347.270) (-345.943) [-345.175] (-345.855) * (-347.690) (-345.110) (-345.597) [-348.106] -- 0:00:51
163500 -- (-346.070) (-347.672) [-346.263] (-345.986) * [-349.957] (-345.831) (-347.728) (-349.737) -- 0:00:51
164000 -- [-348.257] (-349.370) (-351.732) (-349.219) * (-350.274) [-345.191] (-347.183) (-346.405) -- 0:00:50
164500 -- [-345.286] (-348.006) (-347.877) (-349.385) * (-346.340) (-345.505) [-347.632] (-348.038) -- 0:00:50
165000 -- [-345.620] (-351.460) (-348.441) (-346.977) * (-345.782) [-347.453] (-347.955) (-347.594) -- 0:00:50
Average standard deviation of split frequencies: 0.016565
165500 -- [-346.720] (-348.174) (-346.009) (-347.193) * (-347.070) (-347.086) [-347.475] (-348.211) -- 0:00:50
166000 -- (-348.270) (-345.804) (-349.027) [-347.565] * (-349.321) (-349.663) [-346.389] (-347.356) -- 0:00:50
166500 -- (-349.935) (-347.415) [-347.269] (-345.665) * (-347.620) [-347.956] (-347.032) (-347.759) -- 0:00:50
167000 -- (-350.045) (-345.610) (-345.817) [-345.687] * (-347.965) [-347.935] (-349.606) (-347.728) -- 0:00:49
167500 -- (-346.620) [-345.203] (-347.317) (-347.520) * (-347.066) (-346.200) [-347.740] (-345.858) -- 0:00:49
168000 -- (-345.206) [-350.503] (-346.265) (-345.070) * [-346.093] (-345.729) (-347.009) (-347.455) -- 0:00:49
168500 -- [-346.047] (-346.790) (-349.489) (-345.503) * [-345.454] (-351.549) (-348.382) (-346.396) -- 0:00:49
169000 -- [-346.520] (-345.322) (-349.469) (-346.237) * [-347.658] (-348.830) (-352.566) (-350.739) -- 0:00:49
169500 -- (-345.428) (-348.444) (-349.752) [-345.503] * (-346.110) (-345.077) [-345.170] (-347.214) -- 0:00:48
170000 -- (-345.861) (-345.756) (-351.028) [-348.330] * (-348.835) (-347.592) (-347.504) [-345.386] -- 0:00:48
Average standard deviation of split frequencies: 0.017033
170500 -- (-346.257) (-345.135) (-349.056) [-347.896] * (-347.440) (-350.105) (-348.353) [-347.100] -- 0:00:48
171000 -- (-347.397) (-346.135) (-348.898) [-346.566] * (-347.114) [-345.403] (-347.616) (-348.564) -- 0:00:48
171500 -- (-345.361) (-351.802) [-346.729] (-345.037) * (-349.292) [-347.314] (-348.240) (-347.715) -- 0:00:48
172000 -- [-345.454] (-349.889) (-345.664) (-344.986) * [-346.956] (-345.520) (-349.000) (-347.831) -- 0:00:48
172500 -- (-349.616) [-346.882] (-346.864) (-345.900) * (-347.564) [-347.486] (-346.416) (-349.292) -- 0:00:47
173000 -- (-347.473) (-346.250) [-346.424] (-345.897) * [-348.901] (-348.666) (-346.159) (-351.593) -- 0:00:47
173500 -- [-349.192] (-346.831) (-350.241) (-345.099) * (-348.264) [-346.176] (-349.537) (-346.095) -- 0:00:47
174000 -- (-347.366) [-347.156] (-347.142) (-345.121) * (-349.627) (-346.761) (-346.141) [-346.097] -- 0:00:47
174500 -- (-345.683) (-350.781) [-347.646] (-348.124) * (-348.708) (-346.166) [-348.508] (-350.524) -- 0:00:47
175000 -- (-346.090) (-349.669) [-348.124] (-349.923) * (-347.069) (-348.358) [-347.840] (-352.348) -- 0:00:47
Average standard deviation of split frequencies: 0.015178
175500 -- (-346.209) (-347.664) [-348.060] (-347.479) * (-349.878) (-348.430) [-346.304] (-345.936) -- 0:00:46
176000 -- (-346.514) [-346.991] (-346.654) (-349.940) * (-346.532) [-348.567] (-349.493) (-345.735) -- 0:00:46
176500 -- (-345.083) [-351.097] (-346.137) (-345.034) * (-347.835) [-349.255] (-349.528) (-346.537) -- 0:00:46
177000 -- (-348.778) (-346.023) (-348.467) [-345.767] * (-348.942) (-346.507) [-350.072] (-350.038) -- 0:00:46
177500 -- (-346.526) (-348.313) [-346.148] (-345.037) * [-346.075] (-346.468) (-348.485) (-347.827) -- 0:00:46
178000 -- (-348.825) [-347.020] (-346.448) (-346.325) * [-348.700] (-346.653) (-345.913) (-347.598) -- 0:00:46
178500 -- (-348.060) [-350.788] (-348.165) (-345.435) * [-347.076] (-347.421) (-348.636) (-347.055) -- 0:00:46
179000 -- (-349.158) [-346.316] (-351.281) (-346.619) * (-345.158) [-346.469] (-345.064) (-347.887) -- 0:00:45
179500 -- (-348.561) (-349.274) [-348.842] (-350.220) * (-348.533) [-348.052] (-347.205) (-346.547) -- 0:00:45
180000 -- (-348.594) [-346.985] (-348.291) (-346.797) * [-348.007] (-349.684) (-348.578) (-347.417) -- 0:00:50
Average standard deviation of split frequencies: 0.013660
180500 -- (-345.725) [-347.592] (-345.458) (-348.533) * [-349.131] (-349.810) (-345.806) (-347.479) -- 0:00:49
181000 -- [-346.249] (-347.599) (-347.137) (-346.031) * (-345.805) (-350.361) [-345.261] (-351.195) -- 0:00:49
181500 -- [-346.902] (-347.307) (-346.374) (-345.565) * (-346.687) (-348.361) [-349.081] (-349.408) -- 0:00:49
182000 -- (-347.995) (-346.400) [-347.805] (-346.554) * (-346.536) (-345.395) (-345.671) [-346.827] -- 0:00:49
182500 -- (-349.279) [-347.944] (-346.197) (-345.612) * (-347.871) [-347.061] (-350.895) (-347.023) -- 0:00:49
183000 -- (-345.667) (-346.666) [-346.333] (-348.283) * (-350.255) (-345.239) [-346.344] (-348.552) -- 0:00:49
183500 -- (-346.736) [-345.112] (-348.968) (-347.960) * (-347.729) (-347.081) (-347.271) [-347.181] -- 0:00:48
184000 -- (-351.169) (-346.369) (-345.618) [-345.123] * (-349.050) [-344.969] (-346.233) (-349.730) -- 0:00:48
184500 -- (-353.421) [-344.996] (-347.381) (-347.084) * (-349.219) (-345.420) [-347.910] (-347.663) -- 0:00:48
185000 -- (-348.448) (-347.326) [-346.504] (-349.835) * [-345.664] (-345.381) (-351.126) (-346.536) -- 0:00:48
Average standard deviation of split frequencies: 0.015505
185500 -- (-350.007) (-347.648) (-347.151) [-345.915] * [-349.090] (-350.273) (-347.550) (-346.760) -- 0:00:48
186000 -- [-348.954] (-347.458) (-348.141) (-347.267) * [-347.487] (-347.631) (-348.539) (-349.069) -- 0:00:48
186500 -- [-347.442] (-348.491) (-346.041) (-344.821) * (-349.376) (-345.952) [-346.581] (-348.431) -- 0:00:47
187000 -- [-348.008] (-346.640) (-345.187) (-347.203) * (-353.147) (-349.052) [-346.262] (-353.562) -- 0:00:47
187500 -- (-346.063) (-345.143) [-346.249] (-349.475) * (-348.506) (-351.935) [-347.875] (-350.543) -- 0:00:47
188000 -- (-350.511) (-348.117) [-347.367] (-346.440) * [-345.400] (-346.834) (-348.521) (-347.391) -- 0:00:47
188500 -- (-346.615) (-346.598) (-348.685) [-346.331] * (-346.082) (-348.964) (-350.095) [-350.136] -- 0:00:47
189000 -- (-352.265) [-351.225] (-350.882) (-347.194) * [-346.266] (-347.864) (-349.977) (-348.896) -- 0:00:47
189500 -- (-347.116) (-353.139) [-346.697] (-345.797) * (-347.890) (-349.201) (-349.299) [-348.306] -- 0:00:47
190000 -- (-346.068) [-348.286] (-345.971) (-346.894) * (-347.613) (-350.419) (-347.917) [-348.452] -- 0:00:46
Average standard deviation of split frequencies: 0.015271
190500 -- (-346.688) [-345.590] (-345.702) (-347.326) * (-350.097) [-348.224] (-348.797) (-346.862) -- 0:00:46
191000 -- (-345.454) (-345.768) [-346.897] (-346.527) * (-349.816) [-345.711] (-349.595) (-347.725) -- 0:00:46
191500 -- (-354.199) (-345.289) [-346.637] (-349.622) * (-347.588) (-345.410) (-347.548) [-346.143] -- 0:00:46
192000 -- (-350.731) [-346.703] (-350.522) (-346.179) * (-345.054) (-345.605) (-347.729) [-347.566] -- 0:00:46
192500 -- (-353.167) (-349.048) (-346.242) [-349.535] * (-346.578) (-345.467) [-346.773] (-348.380) -- 0:00:46
193000 -- (-349.241) [-349.637] (-345.517) (-348.213) * (-347.653) [-345.387] (-349.639) (-348.157) -- 0:00:45
193500 -- (-346.049) (-346.261) [-348.069] (-347.917) * (-350.459) (-345.876) (-348.586) [-345.429] -- 0:00:45
194000 -- (-347.035) [-348.750] (-346.494) (-351.188) * (-345.959) [-349.403] (-351.104) (-350.244) -- 0:00:45
194500 -- [-346.647] (-346.356) (-345.681) (-349.713) * [-347.140] (-350.600) (-345.962) (-346.097) -- 0:00:45
195000 -- (-346.745) (-349.148) (-352.478) [-346.952] * (-345.036) (-347.087) [-346.124] (-345.520) -- 0:00:45
Average standard deviation of split frequencies: 0.015704
195500 -- (-346.830) (-348.100) [-351.253] (-347.326) * (-350.527) (-346.208) (-347.479) [-346.236] -- 0:00:45
196000 -- [-345.294] (-347.481) (-347.132) (-348.450) * [-345.265] (-348.874) (-350.642) (-349.311) -- 0:00:45
196500 -- (-347.322) (-355.559) [-346.764] (-346.124) * [-348.593] (-347.684) (-348.658) (-349.466) -- 0:00:44
197000 -- (-348.792) (-346.551) (-347.647) [-345.362] * (-349.538) [-348.969] (-347.394) (-351.514) -- 0:00:48
197500 -- [-348.824] (-346.464) (-347.246) (-348.235) * (-350.049) [-348.483] (-347.429) (-347.194) -- 0:00:48
198000 -- (-349.765) [-351.608] (-346.491) (-348.145) * (-345.120) [-347.301] (-346.468) (-345.997) -- 0:00:48
198500 -- [-346.457] (-351.824) (-348.137) (-347.805) * (-345.498) (-346.123) [-346.175] (-353.334) -- 0:00:48
199000 -- [-346.612] (-350.101) (-348.011) (-346.352) * [-346.797] (-347.044) (-347.809) (-346.005) -- 0:00:48
199500 -- (-346.500) (-346.693) [-346.678] (-347.376) * (-346.422) (-347.166) (-353.574) [-346.241] -- 0:00:48
200000 -- (-350.754) (-349.173) [-347.014] (-349.495) * (-348.790) (-346.035) [-348.308] (-346.235) -- 0:00:48
Average standard deviation of split frequencies: 0.014786
200500 -- (-347.256) (-348.793) (-346.091) [-350.231] * (-348.098) (-349.010) [-346.132] (-347.786) -- 0:00:47
201000 -- [-346.578] (-349.819) (-346.704) (-345.524) * (-345.525) (-350.728) [-345.815] (-346.148) -- 0:00:47
201500 -- (-348.903) (-345.575) (-350.448) [-350.921] * (-346.382) (-347.283) [-346.758] (-346.033) -- 0:00:47
202000 -- (-347.271) (-345.498) (-347.887) [-346.390] * [-349.061] (-345.852) (-347.992) (-348.575) -- 0:00:47
202500 -- (-347.727) [-346.715] (-347.689) (-348.042) * (-345.609) (-347.224) [-347.350] (-347.292) -- 0:00:47
203000 -- [-348.774] (-345.252) (-347.073) (-348.903) * [-346.567] (-347.597) (-349.573) (-345.945) -- 0:00:47
203500 -- (-347.717) (-346.374) (-347.625) [-346.186] * (-351.095) [-347.392] (-345.400) (-347.517) -- 0:00:46
204000 -- (-348.600) (-345.004) [-347.039] (-348.362) * (-349.392) (-345.872) [-345.903] (-349.165) -- 0:00:46
204500 -- [-348.123] (-346.699) (-349.325) (-346.432) * (-348.852) [-346.036] (-345.871) (-348.523) -- 0:00:46
205000 -- (-348.007) (-353.906) [-350.592] (-346.738) * (-351.127) [-349.320] (-350.037) (-349.698) -- 0:00:46
Average standard deviation of split frequencies: 0.013095
205500 -- (-346.422) (-348.135) (-349.153) [-347.891] * (-351.890) [-348.964] (-347.948) (-354.097) -- 0:00:46
206000 -- [-346.615] (-346.061) (-351.281) (-351.672) * (-349.993) (-347.807) (-347.400) [-346.222] -- 0:00:46
206500 -- (-346.041) (-346.763) [-348.376] (-347.029) * (-348.351) [-346.436] (-346.201) (-349.425) -- 0:00:46
207000 -- [-346.282] (-347.917) (-344.948) (-347.678) * (-346.870) (-350.131) (-347.727) [-350.110] -- 0:00:45
207500 -- (-348.807) (-346.868) (-347.058) [-346.702] * (-345.701) [-348.911] (-348.054) (-348.708) -- 0:00:45
208000 -- (-347.061) [-348.946] (-346.552) (-347.504) * (-346.762) (-349.196) (-348.363) [-349.651] -- 0:00:45
208500 -- (-346.202) (-350.033) (-347.149) [-347.407] * (-345.146) [-348.713] (-345.229) (-350.508) -- 0:00:45
209000 -- (-350.278) (-345.739) (-345.145) [-347.186] * [-346.788] (-347.700) (-352.870) (-348.692) -- 0:00:45
209500 -- (-351.411) (-348.224) (-345.698) [-345.344] * (-347.111) (-348.395) [-346.593] (-347.500) -- 0:00:45
210000 -- (-346.670) [-346.556] (-353.070) (-351.127) * [-346.619] (-349.031) (-345.024) (-347.897) -- 0:00:45
Average standard deviation of split frequencies: 0.013675
210500 -- (-348.842) [-346.203] (-347.276) (-347.082) * [-346.441] (-354.028) (-345.762) (-348.529) -- 0:00:45
211000 -- (-346.161) (-346.549) [-346.487] (-345.642) * (-346.050) (-348.933) [-346.926] (-345.504) -- 0:00:44
211500 -- (-346.083) (-347.682) (-344.962) [-345.551] * (-345.565) (-347.256) [-347.113] (-345.448) -- 0:00:44
212000 -- (-347.592) (-347.132) (-350.697) [-345.582] * [-346.458] (-350.959) (-348.146) (-347.352) -- 0:00:44
212500 -- (-350.438) (-346.293) (-349.794) [-347.928] * (-349.045) [-346.318] (-345.417) (-347.683) -- 0:00:44
213000 -- (-349.313) (-348.318) [-347.966] (-346.393) * (-351.213) (-346.152) [-345.104] (-350.981) -- 0:00:44
213500 -- (-347.821) (-350.418) (-345.689) [-345.652] * (-348.331) [-345.643] (-344.898) (-346.815) -- 0:00:44
214000 -- [-345.260] (-347.840) (-346.387) (-347.429) * [-348.399] (-347.188) (-347.440) (-348.910) -- 0:00:44
214500 -- (-346.716) (-348.291) (-349.433) [-345.634] * (-347.038) (-345.271) [-345.247] (-349.547) -- 0:00:47
215000 -- [-348.803] (-348.961) (-351.511) (-347.331) * (-346.464) [-348.616] (-346.125) (-354.453) -- 0:00:47
Average standard deviation of split frequencies: 0.012324
215500 -- (-349.811) (-348.911) [-346.347] (-344.921) * (-345.311) (-346.372) [-345.875] (-349.664) -- 0:00:47
216000 -- (-354.759) (-345.637) [-345.991] (-347.273) * (-345.795) [-346.447] (-345.311) (-348.772) -- 0:00:47
216500 -- (-348.420) [-346.077] (-348.194) (-347.797) * [-347.505] (-348.604) (-345.839) (-346.518) -- 0:00:47
217000 -- [-346.188] (-345.805) (-350.605) (-345.967) * (-346.141) [-346.099] (-348.026) (-347.401) -- 0:00:46
217500 -- (-346.142) [-349.054] (-348.973) (-347.244) * (-348.736) [-346.477] (-347.351) (-346.914) -- 0:00:46
218000 -- (-348.085) (-346.900) [-346.427] (-347.672) * (-345.061) (-345.768) [-348.748] (-351.410) -- 0:00:46
218500 -- (-346.609) [-348.509] (-345.296) (-350.367) * (-345.065) [-345.170] (-347.986) (-349.342) -- 0:00:46
219000 -- (-347.194) [-348.743] (-346.097) (-347.033) * [-350.064] (-346.481) (-350.666) (-346.824) -- 0:00:46
219500 -- [-348.662] (-353.750) (-347.437) (-346.676) * (-347.741) (-345.601) (-347.207) [-346.332] -- 0:00:46
220000 -- (-346.760) (-346.213) [-346.811] (-347.652) * (-349.508) [-347.721] (-345.138) (-347.013) -- 0:00:46
Average standard deviation of split frequencies: 0.013069
220500 -- (-345.352) (-348.588) [-344.956] (-348.104) * [-344.808] (-346.541) (-347.063) (-349.691) -- 0:00:45
221000 -- (-346.605) (-349.391) (-345.421) [-348.093] * (-349.353) (-348.098) (-349.918) [-346.653] -- 0:00:45
221500 -- (-347.133) (-346.846) (-347.744) [-345.153] * [-348.043] (-348.091) (-347.433) (-346.767) -- 0:00:45
222000 -- [-347.358] (-349.581) (-353.163) (-345.035) * (-345.418) (-348.393) [-345.823] (-346.924) -- 0:00:45
222500 -- [-346.687] (-349.008) (-355.846) (-347.580) * (-347.452) (-354.930) (-347.130) [-345.932] -- 0:00:45
223000 -- (-352.250) (-348.819) (-356.830) [-347.506] * [-348.272] (-352.535) (-349.022) (-349.796) -- 0:00:45
223500 -- (-348.362) (-347.021) (-358.355) [-347.217] * (-349.142) (-350.974) [-348.972] (-346.529) -- 0:00:45
224000 -- (-346.714) (-350.277) (-352.444) [-346.198] * (-347.174) [-346.968] (-346.144) (-346.749) -- 0:00:45
224500 -- (-346.284) (-347.931) (-345.477) [-346.227] * (-345.916) [-347.402] (-345.321) (-347.961) -- 0:00:44
225000 -- [-345.328] (-345.998) (-345.772) (-345.528) * [-346.409] (-347.247) (-347.698) (-346.897) -- 0:00:44
Average standard deviation of split frequencies: 0.013503
225500 -- [-349.496] (-348.980) (-348.218) (-346.505) * (-346.435) (-349.913) (-348.755) [-344.826] -- 0:00:44
226000 -- (-346.140) [-346.631] (-346.709) (-346.124) * (-347.872) (-346.307) (-351.370) [-345.381] -- 0:00:44
226500 -- (-345.565) (-345.414) [-348.224] (-346.194) * [-347.857] (-346.220) (-351.596) (-345.445) -- 0:00:44
227000 -- (-346.081) (-348.076) [-347.862] (-348.742) * (-347.748) (-350.760) (-350.143) [-347.611] -- 0:00:44
227500 -- (-347.543) [-349.490] (-346.808) (-346.955) * (-349.116) (-352.716) (-351.050) [-345.153] -- 0:00:44
228000 -- (-347.718) [-346.400] (-350.982) (-346.645) * (-346.322) [-348.226] (-346.386) (-348.243) -- 0:00:44
228500 -- (-347.655) [-347.561] (-349.394) (-347.746) * (-346.999) [-352.209] (-345.334) (-347.650) -- 0:00:43
229000 -- (-347.459) (-345.843) [-345.846] (-347.465) * (-351.018) (-347.922) [-351.608] (-346.117) -- 0:00:43
229500 -- [-346.734] (-345.835) (-345.222) (-349.327) * [-349.789] (-352.628) (-348.572) (-346.987) -- 0:00:43
230000 -- (-345.639) (-346.536) (-346.724) [-348.178] * [-346.360] (-348.465) (-345.857) (-349.163) -- 0:00:43
Average standard deviation of split frequencies: 0.012716
230500 -- (-346.065) [-348.098] (-346.430) (-348.143) * (-350.344) (-348.745) [-346.477] (-346.535) -- 0:00:43
231000 -- (-345.785) [-347.719] (-347.545) (-348.590) * (-348.077) (-346.282) (-345.917) [-348.431] -- 0:00:43
231500 -- (-350.568) [-347.977] (-349.061) (-346.431) * (-344.864) (-348.834) (-345.158) [-346.122] -- 0:00:46
232000 -- (-349.665) (-352.824) [-346.724] (-348.434) * (-348.599) (-353.184) (-352.654) [-350.650] -- 0:00:46
232500 -- [-350.474] (-349.783) (-346.340) (-345.673) * (-347.447) (-346.654) (-349.919) [-347.746] -- 0:00:46
233000 -- (-350.230) [-348.226] (-349.031) (-346.976) * (-347.528) (-346.751) (-348.582) [-347.610] -- 0:00:46
233500 -- (-348.492) (-350.969) [-345.577] (-346.725) * (-345.517) (-346.684) (-347.744) [-345.871] -- 0:00:45
234000 -- (-352.662) [-347.013] (-346.862) (-354.599) * (-348.925) [-347.847] (-350.082) (-345.970) -- 0:00:45
234500 -- [-346.338] (-346.167) (-348.986) (-347.162) * (-348.873) (-348.048) [-346.823] (-344.724) -- 0:00:45
235000 -- (-350.233) (-347.745) [-346.873] (-346.272) * (-346.388) (-349.555) [-346.476] (-348.071) -- 0:00:45
Average standard deviation of split frequencies: 0.012359
235500 -- [-347.315] (-353.799) (-352.040) (-349.050) * (-347.168) (-346.264) (-348.092) [-347.719] -- 0:00:45
236000 -- (-347.941) [-349.602] (-345.600) (-344.877) * (-345.108) (-346.679) [-346.827] (-346.282) -- 0:00:45
236500 -- (-350.901) (-347.567) [-347.936] (-347.462) * (-346.049) [-345.205] (-345.618) (-346.451) -- 0:00:45
237000 -- (-348.577) (-346.344) [-348.076] (-347.643) * (-351.208) (-346.875) [-345.852] (-347.051) -- 0:00:45
237500 -- (-348.740) (-345.951) [-345.523] (-346.729) * (-351.063) (-346.469) [-346.593] (-345.786) -- 0:00:44
238000 -- (-349.948) [-346.370] (-348.061) (-346.113) * (-349.631) [-352.776] (-346.099) (-345.710) -- 0:00:44
238500 -- (-350.076) (-346.001) [-346.613] (-348.500) * [-345.972] (-355.185) (-348.121) (-345.882) -- 0:00:44
239000 -- (-346.833) [-348.289] (-345.010) (-345.880) * (-346.734) (-349.123) [-345.206] (-347.253) -- 0:00:44
239500 -- (-346.413) (-346.000) (-347.271) [-348.061] * (-346.830) (-348.750) (-345.637) [-349.346] -- 0:00:44
240000 -- (-348.902) (-346.321) (-345.234) [-348.038] * (-350.257) [-347.595] (-345.282) (-345.927) -- 0:00:44
Average standard deviation of split frequencies: 0.011997
240500 -- (-348.989) (-346.783) (-346.981) [-347.608] * (-348.267) (-346.424) (-345.493) [-345.587] -- 0:00:44
241000 -- (-350.150) (-347.192) (-347.215) [-349.832] * (-349.812) (-346.164) [-346.795] (-350.719) -- 0:00:44
241500 -- [-347.300] (-345.286) (-345.782) (-345.940) * (-347.512) [-345.159] (-348.035) (-349.091) -- 0:00:43
242000 -- (-349.321) (-347.839) [-348.542] (-346.450) * [-347.546] (-346.045) (-348.951) (-351.225) -- 0:00:43
242500 -- [-347.620] (-347.696) (-350.633) (-346.999) * (-347.914) (-346.703) [-345.914] (-349.957) -- 0:00:43
243000 -- (-347.959) (-350.574) [-351.163] (-349.881) * (-347.425) [-345.949] (-349.777) (-349.836) -- 0:00:43
243500 -- (-345.635) (-348.319) [-346.169] (-350.176) * (-345.999) [-346.513] (-349.711) (-346.338) -- 0:00:43
244000 -- (-351.684) (-347.609) (-347.337) [-345.531] * (-345.003) (-345.649) (-348.446) [-349.663] -- 0:00:43
244500 -- (-347.407) [-345.429] (-346.412) (-346.652) * (-346.501) (-345.539) (-353.821) [-350.162] -- 0:00:43
245000 -- (-348.512) [-347.003] (-346.546) (-347.661) * (-347.354) [-346.065] (-347.813) (-348.290) -- 0:00:43
Average standard deviation of split frequencies: 0.012216
245500 -- (-348.092) (-345.717) [-346.279] (-349.444) * (-348.777) (-346.978) (-347.325) [-345.444] -- 0:00:43
246000 -- [-346.075] (-347.279) (-347.256) (-352.873) * (-345.787) (-347.166) (-346.365) [-345.568] -- 0:00:42
246500 -- (-347.304) [-346.097] (-346.150) (-348.556) * (-346.918) [-347.192] (-346.869) (-345.370) -- 0:00:42
247000 -- (-346.404) (-347.010) (-345.156) [-345.942] * (-349.819) [-345.720] (-347.317) (-347.405) -- 0:00:42
247500 -- (-348.003) (-346.703) (-346.490) [-346.259] * [-346.865] (-347.666) (-350.593) (-348.675) -- 0:00:42
248000 -- (-349.223) (-345.965) [-346.493] (-348.251) * (-347.770) [-349.171] (-347.212) (-346.754) -- 0:00:42
248500 -- (-348.656) (-347.764) [-345.207] (-350.631) * (-348.673) [-348.769] (-347.163) (-349.776) -- 0:00:45
249000 -- (-348.449) (-350.648) [-348.148] (-347.526) * (-348.863) [-346.320] (-347.383) (-348.010) -- 0:00:45
249500 -- (-345.715) [-347.331] (-348.522) (-347.806) * [-346.615] (-347.620) (-349.248) (-349.614) -- 0:00:45
250000 -- (-345.741) [-345.043] (-348.408) (-348.628) * (-347.699) (-346.291) (-348.056) [-347.778] -- 0:00:45
Average standard deviation of split frequencies: 0.012851
250500 -- (-348.743) (-345.416) (-346.836) [-347.039] * (-348.638) [-348.610] (-349.294) (-347.030) -- 0:00:44
251000 -- (-345.453) (-345.189) (-345.882) [-345.936] * (-354.823) (-347.196) (-350.937) [-347.103] -- 0:00:44
251500 -- (-350.673) [-345.983] (-345.524) (-346.049) * [-355.968] (-348.757) (-347.552) (-345.340) -- 0:00:44
252000 -- (-346.195) (-345.893) (-347.273) [-346.038] * [-345.842] (-346.236) (-347.337) (-345.540) -- 0:00:44
252500 -- (-346.636) (-346.394) (-347.133) [-345.892] * [-348.202] (-349.325) (-345.879) (-348.661) -- 0:00:44
253000 -- (-345.843) (-347.487) [-345.851] (-346.738) * [-345.092] (-349.565) (-347.484) (-348.966) -- 0:00:44
253500 -- [-346.575] (-349.009) (-351.496) (-350.461) * (-346.708) (-346.831) [-347.686] (-348.238) -- 0:00:44
254000 -- (-346.391) [-351.377] (-348.142) (-349.374) * (-346.889) [-345.961] (-345.692) (-344.940) -- 0:00:44
254500 -- (-346.506) (-347.686) (-347.583) [-347.082] * (-346.878) (-346.007) [-345.935] (-348.171) -- 0:00:43
255000 -- (-345.077) [-345.900] (-347.381) (-348.463) * [-348.737] (-346.472) (-346.802) (-348.864) -- 0:00:43
Average standard deviation of split frequencies: 0.012775
255500 -- [-344.757] (-345.696) (-349.248) (-346.773) * (-346.117) [-348.965] (-348.650) (-345.232) -- 0:00:43
256000 -- (-350.004) (-350.870) [-346.771] (-347.870) * (-348.036) [-347.798] (-344.825) (-352.607) -- 0:00:43
256500 -- (-348.372) (-345.095) [-345.991] (-353.356) * (-349.396) (-348.491) (-347.891) [-347.075] -- 0:00:43
257000 -- (-345.651) [-345.727] (-348.243) (-348.214) * [-350.426] (-348.946) (-345.937) (-348.556) -- 0:00:43
257500 -- (-348.750) [-345.754] (-348.815) (-345.749) * (-354.801) [-345.508] (-348.696) (-348.093) -- 0:00:43
258000 -- (-349.987) (-350.104) (-351.850) [-346.690] * (-346.923) [-347.410] (-346.424) (-348.327) -- 0:00:43
258500 -- (-348.118) (-350.083) (-347.999) [-346.889] * (-347.837) [-348.877] (-345.574) (-347.722) -- 0:00:43
259000 -- (-349.008) (-345.094) [-348.068] (-346.648) * (-347.293) (-346.823) (-345.273) [-346.303] -- 0:00:42
259500 -- (-348.375) [-348.127] (-345.292) (-349.086) * [-349.103] (-346.392) (-345.362) (-346.849) -- 0:00:42
260000 -- (-347.775) [-347.618] (-347.836) (-347.418) * (-346.782) [-351.439] (-345.623) (-345.569) -- 0:00:42
Average standard deviation of split frequencies: 0.012900
260500 -- (-348.615) [-348.927] (-355.382) (-346.368) * (-347.295) (-349.412) (-346.248) [-345.208] -- 0:00:42
261000 -- (-349.021) (-345.567) [-348.990] (-349.365) * (-347.053) (-346.565) [-345.516] (-345.395) -- 0:00:42
261500 -- [-346.679] (-347.107) (-348.500) (-349.949) * [-345.690] (-349.961) (-347.493) (-346.587) -- 0:00:42
262000 -- (-347.474) (-345.186) [-345.115] (-348.527) * (-347.000) [-346.236] (-347.093) (-346.057) -- 0:00:42
262500 -- (-345.839) (-347.406) [-347.451] (-348.975) * [-346.620] (-348.601) (-345.240) (-347.972) -- 0:00:42
263000 -- (-346.241) [-347.832] (-349.300) (-348.717) * (-348.643) [-345.686] (-345.833) (-345.892) -- 0:00:42
263500 -- (-349.079) (-346.751) [-347.314] (-347.358) * (-346.313) (-345.720) (-347.040) [-347.317] -- 0:00:41
264000 -- (-347.518) (-348.743) [-345.846] (-345.600) * (-346.904) [-345.003] (-346.733) (-346.813) -- 0:00:41
264500 -- (-348.764) (-347.646) (-345.746) [-347.109] * (-347.202) (-345.209) (-352.452) [-345.686] -- 0:00:41
265000 -- [-345.280] (-354.651) (-345.892) (-347.701) * (-348.872) (-346.318) (-348.917) [-345.582] -- 0:00:41
Average standard deviation of split frequencies: 0.011962
265500 -- [-345.949] (-352.013) (-347.003) (-352.620) * (-352.139) (-350.971) [-345.993] (-345.590) -- 0:00:44
266000 -- [-346.033] (-346.563) (-347.032) (-347.435) * (-348.408) (-347.728) (-347.126) [-347.389] -- 0:00:44
266500 -- (-349.766) (-348.342) (-346.826) [-351.113] * [-346.601] (-347.466) (-346.281) (-345.624) -- 0:00:44
267000 -- [-349.835] (-347.996) (-346.279) (-346.484) * (-347.889) (-347.488) [-347.921] (-347.170) -- 0:00:43
267500 -- (-345.764) (-347.630) [-347.709] (-346.462) * [-348.994] (-345.590) (-346.594) (-346.580) -- 0:00:43
268000 -- (-347.760) [-351.719] (-347.538) (-346.917) * [-346.624] (-345.504) (-345.764) (-349.716) -- 0:00:43
268500 -- (-346.208) (-348.601) [-345.832] (-348.148) * (-349.791) (-346.093) [-347.454] (-347.214) -- 0:00:43
269000 -- [-346.181] (-347.067) (-345.683) (-346.293) * (-347.917) [-349.231] (-348.812) (-348.406) -- 0:00:43
269500 -- [-345.478] (-350.398) (-347.705) (-345.880) * [-345.682] (-345.335) (-348.823) (-348.484) -- 0:00:43
270000 -- (-347.297) [-347.394] (-346.968) (-345.723) * (-347.328) [-347.331] (-348.705) (-349.002) -- 0:00:43
Average standard deviation of split frequencies: 0.011647
270500 -- (-348.627) [-346.015] (-347.568) (-345.924) * [-345.527] (-350.234) (-348.509) (-346.544) -- 0:00:43
271000 -- (-347.702) (-346.103) [-347.089] (-346.185) * (-345.745) (-348.751) [-347.333] (-345.521) -- 0:00:43
271500 -- (-346.447) [-346.993] (-350.373) (-348.030) * (-345.810) (-347.099) [-349.585] (-355.043) -- 0:00:42
272000 -- (-346.749) (-346.773) [-345.402] (-348.920) * [-346.282] (-351.423) (-349.548) (-352.004) -- 0:00:42
272500 -- (-344.980) (-347.092) [-347.813] (-348.445) * (-346.652) (-347.378) (-348.729) [-347.466] -- 0:00:42
273000 -- (-345.451) [-346.723] (-346.803) (-346.486) * (-347.399) (-346.860) [-346.675] (-346.039) -- 0:00:42
273500 -- (-345.543) [-346.864] (-350.046) (-348.721) * (-347.234) (-345.583) [-345.536] (-347.019) -- 0:00:42
274000 -- [-347.528] (-352.398) (-346.994) (-347.375) * [-349.300] (-346.952) (-347.206) (-347.629) -- 0:00:42
274500 -- (-347.982) (-349.696) [-346.570] (-352.809) * [-346.464] (-345.532) (-345.558) (-348.695) -- 0:00:42
275000 -- (-346.218) [-346.286] (-347.148) (-348.557) * (-345.489) [-346.333] (-348.361) (-345.771) -- 0:00:42
Average standard deviation of split frequencies: 0.011956
275500 -- (-345.595) [-348.487] (-346.006) (-351.068) * (-346.020) [-345.939] (-345.676) (-350.112) -- 0:00:42
276000 -- (-346.893) (-350.136) [-347.155] (-350.401) * (-346.150) (-346.364) [-345.838] (-347.938) -- 0:00:41
276500 -- (-350.892) (-349.947) [-346.627] (-346.869) * (-348.235) [-345.662] (-348.844) (-345.764) -- 0:00:41
277000 -- (-348.149) (-346.186) [-352.732] (-345.441) * (-349.164) [-348.490] (-346.015) (-347.484) -- 0:00:41
277500 -- (-347.641) (-346.385) [-346.479] (-347.965) * [-346.806] (-346.202) (-347.270) (-346.792) -- 0:00:41
278000 -- (-347.184) (-345.956) (-350.748) [-346.526] * (-350.918) (-345.900) [-345.008] (-351.035) -- 0:00:41
278500 -- (-346.542) (-345.811) (-347.430) [-347.209] * (-349.005) (-346.237) (-348.224) [-351.370] -- 0:00:41
279000 -- [-347.907] (-347.395) (-348.526) (-346.660) * (-346.091) [-345.989] (-346.132) (-346.450) -- 0:00:41
279500 -- (-346.093) [-347.113] (-347.041) (-354.647) * (-345.963) [-346.182] (-346.548) (-345.900) -- 0:00:41
280000 -- (-346.610) (-349.132) [-347.829] (-347.175) * (-350.272) (-347.698) (-349.295) [-345.556] -- 0:00:41
Average standard deviation of split frequencies: 0.012072
280500 -- [-349.137] (-346.282) (-346.815) (-347.211) * (-348.238) (-346.590) [-347.735] (-345.792) -- 0:00:41
281000 -- (-348.499) (-347.255) (-347.160) [-347.313] * [-347.338] (-349.320) (-346.709) (-349.341) -- 0:00:40
281500 -- (-348.358) (-346.441) [-345.884] (-346.887) * (-348.813) [-346.119] (-346.458) (-348.358) -- 0:00:40
282000 -- (-346.726) (-347.749) (-346.410) [-351.080] * [-346.081] (-345.655) (-347.142) (-346.000) -- 0:00:40
282500 -- (-347.123) (-345.710) (-348.129) [-345.657] * [-345.488] (-347.504) (-347.157) (-345.189) -- 0:00:43
283000 -- (-346.283) [-347.134] (-348.012) (-346.439) * (-347.012) [-350.160] (-348.338) (-347.835) -- 0:00:43
283500 -- (-346.590) [-348.760] (-346.048) (-346.156) * (-346.825) (-345.522) [-345.797] (-346.548) -- 0:00:42
284000 -- [-347.091] (-346.827) (-346.195) (-349.204) * (-347.193) (-346.229) (-346.530) [-346.065] -- 0:00:42
284500 -- (-347.682) (-349.036) [-346.404] (-349.713) * (-346.924) (-345.672) (-346.586) [-349.893] -- 0:00:42
285000 -- [-347.442] (-347.101) (-346.104) (-346.305) * (-345.202) [-347.357] (-345.244) (-348.223) -- 0:00:42
Average standard deviation of split frequencies: 0.010817
285500 -- (-348.981) (-349.199) (-346.038) [-347.455] * [-346.347] (-346.446) (-346.161) (-345.707) -- 0:00:42
286000 -- (-347.323) (-346.028) [-346.413] (-347.197) * [-346.774] (-350.956) (-345.723) (-349.681) -- 0:00:42
286500 -- (-345.832) (-347.130) (-347.442) [-347.613] * [-349.329] (-351.068) (-346.625) (-346.544) -- 0:00:42
287000 -- (-346.890) (-346.335) [-345.149] (-347.486) * (-344.922) (-345.593) [-346.747] (-346.204) -- 0:00:42
287500 -- [-348.246] (-346.780) (-347.339) (-346.719) * [-347.451] (-346.112) (-346.889) (-346.011) -- 0:00:42
288000 -- (-345.649) [-345.868] (-346.374) (-352.086) * (-347.780) (-348.643) (-349.005) [-347.075] -- 0:00:42
288500 -- (-346.515) (-347.922) [-346.039] (-349.763) * [-348.677] (-346.475) (-347.819) (-347.380) -- 0:00:41
289000 -- (-350.478) (-349.159) [-347.214] (-346.399) * (-345.782) (-349.425) (-346.219) [-347.816] -- 0:00:41
289500 -- [-348.275] (-348.145) (-348.428) (-345.212) * (-349.306) [-346.968] (-345.787) (-348.790) -- 0:00:41
290000 -- (-345.171) (-345.130) [-346.046] (-350.635) * (-349.956) (-349.170) [-346.310] (-347.920) -- 0:00:41
Average standard deviation of split frequencies: 0.011251
290500 -- [-346.521] (-351.048) (-346.741) (-348.064) * (-347.008) [-345.326] (-347.411) (-348.427) -- 0:00:41
291000 -- (-348.516) (-346.151) [-345.428] (-348.599) * [-351.671] (-349.927) (-347.855) (-347.484) -- 0:00:41
291500 -- (-346.713) [-349.660] (-348.136) (-345.807) * (-347.204) (-347.418) [-350.562] (-345.595) -- 0:00:41
292000 -- (-347.800) (-350.958) [-352.170] (-348.763) * (-349.181) (-347.427) (-345.593) [-346.039] -- 0:00:41
292500 -- [-345.973] (-345.296) (-351.088) (-347.132) * (-348.810) (-346.018) (-349.582) [-345.700] -- 0:00:41
293000 -- (-345.496) (-345.845) [-348.944] (-347.253) * (-352.663) (-348.765) (-346.105) [-346.471] -- 0:00:41
293500 -- (-348.872) (-346.814) (-349.815) [-347.193] * (-347.203) (-347.525) [-346.685] (-353.224) -- 0:00:40
294000 -- (-350.457) [-345.971] (-346.819) (-347.626) * (-351.051) (-346.234) (-351.160) [-349.876] -- 0:00:40
294500 -- (-351.722) (-345.279) (-348.014) [-345.314] * [-346.920] (-350.007) (-348.745) (-348.605) -- 0:00:40
295000 -- (-347.466) [-345.822] (-346.859) (-347.018) * (-346.596) [-351.031] (-348.653) (-353.724) -- 0:00:40
Average standard deviation of split frequencies: 0.010405
295500 -- (-349.491) (-345.977) (-347.642) [-346.948] * (-347.161) (-348.487) [-349.605] (-346.455) -- 0:00:40
296000 -- (-347.025) [-345.362] (-345.057) (-346.658) * (-345.749) (-348.261) [-349.690] (-345.523) -- 0:00:40
296500 -- [-347.608] (-345.607) (-346.260) (-347.027) * (-347.424) [-347.356] (-347.165) (-346.289) -- 0:00:40
297000 -- (-345.939) [-346.164] (-346.431) (-349.559) * (-348.825) (-346.651) [-346.581] (-346.197) -- 0:00:40
297500 -- (-347.078) [-345.108] (-346.875) (-345.536) * (-346.354) (-351.108) [-345.910] (-351.524) -- 0:00:40
298000 -- (-345.378) (-345.826) [-345.409] (-345.473) * (-348.283) [-348.850] (-349.118) (-345.970) -- 0:00:40
298500 -- (-345.150) (-346.296) [-346.448] (-346.890) * (-346.224) (-348.549) (-346.987) [-345.978] -- 0:00:42
299000 -- (-350.001) (-345.481) (-345.768) [-349.425] * [-348.436] (-346.600) (-347.240) (-349.801) -- 0:00:42
299500 -- [-349.603] (-347.146) (-345.857) (-346.957) * (-347.126) (-346.546) (-349.083) [-347.810] -- 0:00:42
300000 -- (-348.557) [-347.554] (-350.304) (-346.168) * (-346.686) (-349.389) [-348.094] (-350.390) -- 0:00:42
Average standard deviation of split frequencies: 0.010034
300500 -- (-346.053) (-349.216) (-346.552) [-346.089] * (-345.784) (-350.889) (-348.905) [-347.259] -- 0:00:41
301000 -- [-345.297] (-351.149) (-346.339) (-348.181) * (-346.023) (-345.670) (-348.902) [-348.256] -- 0:00:41
301500 -- (-347.579) [-348.854] (-345.981) (-349.024) * (-346.622) [-349.485] (-349.833) (-345.707) -- 0:00:41
302000 -- [-347.002] (-347.548) (-346.777) (-345.394) * [-347.161] (-349.854) (-350.743) (-346.417) -- 0:00:41
302500 -- [-349.205] (-348.338) (-347.959) (-347.347) * (-348.031) (-346.024) (-349.250) [-345.813] -- 0:00:41
303000 -- (-347.649) (-347.610) [-348.820] (-346.317) * (-347.374) [-346.474] (-353.595) (-349.282) -- 0:00:41
303500 -- [-346.667] (-347.215) (-346.945) (-344.915) * [-350.106] (-346.609) (-346.240) (-345.583) -- 0:00:41
304000 -- [-348.559] (-347.295) (-351.050) (-347.328) * (-351.242) [-345.560] (-345.462) (-344.798) -- 0:00:41
304500 -- (-351.320) [-348.139] (-348.450) (-347.043) * [-347.824] (-349.643) (-345.629) (-348.468) -- 0:00:41
305000 -- [-346.103] (-347.987) (-347.202) (-351.790) * (-349.496) [-346.096] (-347.578) (-346.517) -- 0:00:41
Average standard deviation of split frequencies: 0.009878
305500 -- [-345.186] (-346.061) (-349.145) (-344.791) * (-349.622) [-346.341] (-345.275) (-346.115) -- 0:00:40
306000 -- (-350.030) (-345.164) (-346.847) [-350.688] * (-345.895) (-347.047) [-345.531] (-345.730) -- 0:00:40
306500 -- [-345.786] (-347.486) (-348.156) (-346.606) * (-346.895) (-345.397) [-347.422] (-349.302) -- 0:00:40
307000 -- (-346.594) (-347.903) (-349.016) [-347.409] * (-345.481) [-347.318] (-347.190) (-345.921) -- 0:00:40
307500 -- [-345.302] (-348.717) (-346.867) (-350.786) * (-347.598) (-347.933) (-345.748) [-350.896] -- 0:00:40
308000 -- (-347.145) (-347.734) [-344.859] (-345.710) * (-346.500) (-345.152) (-346.127) [-349.168] -- 0:00:40
308500 -- (-347.433) (-350.169) [-345.528] (-348.766) * (-345.955) (-346.784) [-348.274] (-347.358) -- 0:00:40
309000 -- (-345.374) [-348.410] (-345.985) (-345.708) * (-345.687) (-348.917) (-346.698) [-345.195] -- 0:00:40
309500 -- (-345.038) [-345.955] (-346.316) (-347.529) * (-346.896) [-344.968] (-346.463) (-345.220) -- 0:00:40
310000 -- (-348.254) (-349.969) [-346.807] (-348.707) * (-348.842) (-348.737) (-346.802) [-345.439] -- 0:00:40
Average standard deviation of split frequencies: 0.010217
310500 -- (-346.072) (-346.203) [-348.138] (-345.944) * (-348.695) (-345.458) (-348.011) [-346.528] -- 0:00:39
311000 -- (-347.078) [-346.018] (-351.043) (-346.936) * [-347.618] (-346.106) (-347.436) (-348.430) -- 0:00:39
311500 -- [-345.101] (-348.247) (-348.097) (-350.580) * (-346.935) [-347.634] (-348.464) (-348.653) -- 0:00:39
312000 -- (-346.267) (-345.174) [-347.207] (-350.357) * (-347.442) [-349.183] (-349.394) (-345.315) -- 0:00:41
312500 -- (-346.934) [-347.365] (-351.238) (-347.239) * (-346.899) (-348.112) (-345.634) [-345.887] -- 0:00:41
313000 -- [-347.567] (-345.930) (-346.896) (-347.713) * (-345.045) [-345.379] (-348.135) (-345.820) -- 0:00:41
313500 -- (-344.994) (-351.289) [-345.178] (-345.573) * (-348.074) (-345.030) (-353.638) [-347.206] -- 0:00:41
314000 -- (-347.010) (-346.850) (-349.515) [-346.245] * [-346.135] (-349.111) (-346.310) (-346.685) -- 0:00:41
314500 -- (-348.326) (-345.908) (-347.179) [-347.076] * (-345.773) [-346.728] (-348.174) (-347.714) -- 0:00:41
315000 -- [-347.704] (-347.501) (-346.774) (-348.241) * (-344.715) (-346.021) [-348.708] (-346.308) -- 0:00:41
Average standard deviation of split frequencies: 0.010244
315500 -- (-350.971) (-347.965) (-347.283) [-345.117] * (-345.633) [-349.156] (-346.602) (-346.555) -- 0:00:41
316000 -- (-349.023) (-348.493) (-350.949) [-345.702] * [-345.541] (-345.985) (-349.141) (-347.477) -- 0:00:41
316500 -- (-348.991) (-348.414) (-349.039) [-347.439] * (-345.792) (-345.639) (-352.831) [-346.212] -- 0:00:41
317000 -- (-347.041) (-349.530) (-346.290) [-346.318] * (-345.669) (-345.911) (-346.203) [-349.016] -- 0:00:40
317500 -- (-349.681) (-347.391) (-346.816) [-346.288] * (-348.283) [-348.116] (-345.551) (-347.546) -- 0:00:40
318000 -- (-347.458) (-346.618) (-347.327) [-346.197] * [-346.885] (-347.769) (-346.852) (-351.563) -- 0:00:40
318500 -- [-345.743] (-346.192) (-347.173) (-346.900) * (-351.919) [-347.471] (-345.980) (-347.474) -- 0:00:40
319000 -- (-354.105) [-349.706] (-346.387) (-346.959) * (-349.189) (-347.384) [-347.669] (-346.642) -- 0:00:40
319500 -- [-346.146] (-350.850) (-347.793) (-345.859) * (-346.339) (-347.721) (-345.861) [-348.724] -- 0:00:40
320000 -- (-345.367) [-346.601] (-345.796) (-345.128) * [-349.499] (-346.444) (-347.051) (-346.682) -- 0:00:40
Average standard deviation of split frequencies: 0.010389
320500 -- (-346.372) (-346.360) (-347.425) [-346.080] * [-347.977] (-348.249) (-351.511) (-349.600) -- 0:00:40
321000 -- (-347.260) (-347.231) [-347.933] (-349.666) * [-346.530] (-351.685) (-346.218) (-347.563) -- 0:00:40
321500 -- (-346.369) (-347.803) (-347.474) [-352.373] * (-348.369) [-346.641] (-350.059) (-345.804) -- 0:00:40
322000 -- (-349.089) [-348.889] (-348.545) (-346.611) * [-345.980] (-350.364) (-346.604) (-349.228) -- 0:00:40
322500 -- (-351.024) [-346.114] (-347.057) (-347.660) * (-345.957) [-346.732] (-346.900) (-354.968) -- 0:00:39
323000 -- [-349.132] (-345.893) (-347.085) (-344.825) * [-352.257] (-352.141) (-346.305) (-348.915) -- 0:00:39
323500 -- (-350.350) [-351.433] (-349.323) (-347.895) * (-345.798) (-350.946) [-348.234] (-347.234) -- 0:00:39
324000 -- (-345.986) (-345.526) (-346.375) [-346.860] * (-347.396) (-346.119) (-345.462) [-345.982] -- 0:00:39
324500 -- (-349.799) [-346.485] (-346.227) (-345.948) * (-345.821) (-345.470) (-346.781) [-345.098] -- 0:00:39
325000 -- (-345.918) (-346.140) [-345.790] (-346.373) * [-345.836] (-347.313) (-345.916) (-348.357) -- 0:00:39
Average standard deviation of split frequencies: 0.010462
325500 -- (-348.534) (-345.438) (-348.181) [-346.499] * [-348.823] (-347.436) (-349.071) (-348.392) -- 0:00:39
326000 -- [-345.172] (-347.070) (-346.439) (-350.411) * (-348.846) (-349.401) (-350.426) [-346.145] -- 0:00:39
326500 -- [-352.655] (-345.835) (-345.610) (-345.483) * (-346.977) [-348.194] (-347.959) (-350.031) -- 0:00:39
327000 -- (-348.837) (-345.254) (-348.560) [-346.700] * [-349.945] (-349.478) (-347.977) (-347.549) -- 0:00:39
327500 -- [-345.546] (-348.562) (-348.174) (-345.411) * (-354.081) (-350.250) (-347.770) [-347.105] -- 0:00:39
328000 -- (-346.900) (-347.488) (-346.405) [-348.593] * (-348.454) (-346.660) [-344.831] (-349.779) -- 0:00:40
328500 -- (-350.613) (-347.798) (-347.171) [-346.604] * (-346.766) [-346.385] (-345.440) (-348.294) -- 0:00:40
329000 -- (-347.179) [-347.809] (-346.339) (-348.711) * [-347.624] (-346.636) (-345.061) (-346.702) -- 0:00:40
329500 -- (-345.784) [-348.619] (-351.061) (-347.381) * (-346.655) (-346.673) (-346.303) [-349.368] -- 0:00:40
330000 -- [-347.837] (-349.673) (-350.464) (-347.293) * (-347.407) [-345.562] (-347.486) (-349.063) -- 0:00:40
Average standard deviation of split frequencies: 0.009644
330500 -- (-350.930) (-346.480) [-348.596] (-345.147) * (-344.981) (-346.315) (-348.601) [-346.562] -- 0:00:40
331000 -- (-348.055) (-347.186) [-347.415] (-348.554) * (-350.600) [-346.867] (-348.342) (-345.596) -- 0:00:40
331500 -- (-347.394) (-347.706) (-347.340) [-346.487] * (-346.709) (-349.609) [-347.239] (-345.072) -- 0:00:40
332000 -- [-346.291] (-350.748) (-349.642) (-345.916) * (-351.850) (-347.986) [-347.873] (-345.885) -- 0:00:40
332500 -- (-346.233) (-347.076) (-347.689) [-346.290] * (-346.617) [-348.872] (-347.342) (-346.654) -- 0:00:40
333000 -- [-345.689] (-347.877) (-346.656) (-346.444) * [-348.154] (-347.117) (-345.532) (-347.075) -- 0:00:40
333500 -- (-347.676) (-347.214) [-345.832] (-346.694) * (-347.153) (-353.735) [-345.063] (-348.290) -- 0:00:39
334000 -- [-346.968] (-347.280) (-345.339) (-346.927) * (-345.105) (-357.226) (-346.104) [-345.690] -- 0:00:39
334500 -- (-349.963) (-346.352) (-346.934) [-347.024] * (-347.442) (-348.994) [-347.148] (-347.429) -- 0:00:39
335000 -- (-346.484) (-347.377) [-348.038] (-346.140) * (-347.325) (-348.012) [-346.917] (-348.265) -- 0:00:39
Average standard deviation of split frequencies: 0.010172
335500 -- [-345.808] (-345.689) (-348.449) (-351.214) * [-346.694] (-346.205) (-348.842) (-349.867) -- 0:00:39
336000 -- (-346.913) (-345.791) [-348.513] (-347.493) * (-346.915) (-355.230) (-350.884) [-346.557] -- 0:00:39
336500 -- (-346.363) (-348.085) (-353.971) [-345.938] * (-346.602) (-347.917) (-345.963) [-345.663] -- 0:00:39
337000 -- [-346.833] (-354.140) (-346.981) (-345.041) * (-346.205) [-346.184] (-348.037) (-346.225) -- 0:00:39
337500 -- [-345.800] (-349.962) (-347.178) (-348.111) * (-345.551) (-344.919) [-348.243] (-345.157) -- 0:00:39
338000 -- (-345.613) [-347.486] (-347.566) (-350.610) * (-345.354) [-346.282] (-345.600) (-346.850) -- 0:00:39
338500 -- (-346.028) (-348.832) (-349.420) [-350.356] * (-347.450) (-346.031) [-347.723] (-348.058) -- 0:00:39
339000 -- (-347.138) (-350.574) [-347.092] (-347.088) * (-350.350) (-346.255) (-349.512) [-347.685] -- 0:00:38
339500 -- (-346.376) [-347.122] (-346.524) (-348.958) * (-346.995) [-345.859] (-347.156) (-347.108) -- 0:00:38
340000 -- [-346.373] (-346.777) (-350.092) (-346.081) * (-347.100) (-348.344) (-349.549) [-350.041] -- 0:00:38
Average standard deviation of split frequencies: 0.010978
340500 -- [-347.220] (-349.121) (-346.568) (-346.432) * (-349.292) [-346.326] (-345.920) (-346.990) -- 0:00:38
341000 -- (-347.885) [-348.851] (-348.742) (-347.177) * (-348.022) (-347.342) (-345.626) [-347.379] -- 0:00:38
341500 -- (-352.559) (-345.545) [-346.475] (-348.875) * (-345.290) [-348.594] (-345.970) (-346.847) -- 0:00:38
342000 -- [-347.433] (-347.671) (-347.387) (-345.669) * (-349.393) (-347.094) (-346.715) [-345.249] -- 0:00:38
342500 -- (-349.235) (-348.599) (-348.702) [-350.774] * (-347.811) (-346.421) (-347.663) [-346.476] -- 0:00:38
343000 -- [-349.351] (-348.691) (-349.162) (-346.658) * [-348.844] (-349.241) (-348.189) (-348.117) -- 0:00:38
343500 -- [-347.466] (-349.377) (-346.652) (-346.346) * (-346.559) (-350.569) [-347.827] (-345.951) -- 0:00:38
344000 -- (-346.464) [-347.107] (-353.150) (-346.613) * [-346.140] (-347.269) (-345.853) (-346.850) -- 0:00:38
344500 -- [-346.245] (-349.137) (-349.960) (-345.016) * [-346.345] (-346.209) (-345.555) (-347.976) -- 0:00:38
345000 -- (-347.552) (-347.418) [-347.498] (-345.625) * (-349.370) (-346.912) (-344.994) [-345.925] -- 0:00:39
Average standard deviation of split frequencies: 0.011581
345500 -- (-346.034) (-353.568) [-345.053] (-345.168) * (-347.323) (-351.722) (-350.448) [-346.828] -- 0:00:39
346000 -- (-345.531) (-349.708) (-348.654) [-346.075] * (-347.487) [-346.354] (-348.325) (-345.424) -- 0:00:39
346500 -- [-346.617] (-347.656) (-345.711) (-346.897) * (-346.517) (-346.083) [-349.952] (-346.378) -- 0:00:39
347000 -- (-345.809) (-353.513) [-350.100] (-345.817) * (-347.922) (-351.984) [-348.996] (-347.880) -- 0:00:39
347500 -- (-347.235) [-348.357] (-347.244) (-348.564) * (-348.844) (-350.288) (-345.449) [-348.572] -- 0:00:39
348000 -- (-350.520) (-351.612) (-353.020) [-346.958] * (-347.725) (-346.323) (-345.280) [-348.111] -- 0:00:39
348500 -- (-352.827) [-350.035] (-347.015) (-347.120) * (-351.243) (-346.300) [-350.210] (-347.064) -- 0:00:39
349000 -- (-348.434) (-349.376) [-348.432] (-345.994) * (-346.760) (-345.061) [-347.081] (-346.172) -- 0:00:39
349500 -- (-350.582) (-347.727) [-346.322] (-346.369) * (-347.614) [-347.004] (-348.339) (-346.593) -- 0:00:39
350000 -- (-348.881) (-346.356) (-346.975) [-348.124] * [-345.347] (-346.904) (-347.962) (-346.607) -- 0:00:39
Average standard deviation of split frequencies: 0.011471
350500 -- (-346.826) (-345.156) (-346.344) [-346.037] * (-347.304) (-347.477) [-346.137] (-345.045) -- 0:00:38
351000 -- (-347.497) (-348.343) (-345.594) [-346.155] * (-346.729) [-347.723] (-345.526) (-350.632) -- 0:00:38
351500 -- [-346.328] (-346.809) (-345.338) (-346.351) * [-345.537] (-344.973) (-347.312) (-350.000) -- 0:00:38
352000 -- (-351.156) (-346.480) [-347.406] (-348.249) * (-350.980) (-345.220) (-350.925) [-346.097] -- 0:00:38
352500 -- (-345.981) (-347.527) [-348.306] (-346.354) * (-347.699) (-346.174) [-345.318] (-346.148) -- 0:00:38
353000 -- (-347.251) (-346.934) (-347.624) [-347.869] * (-352.904) (-345.790) [-346.292] (-346.137) -- 0:00:38
353500 -- (-348.624) (-345.473) [-346.568] (-346.834) * (-346.935) [-345.179] (-352.330) (-346.595) -- 0:00:38
354000 -- (-352.531) (-344.983) (-347.476) [-346.706] * (-346.009) (-346.666) (-347.533) [-345.391] -- 0:00:38
354500 -- (-347.465) [-345.316] (-349.752) (-348.422) * (-346.197) (-348.105) [-346.473] (-348.809) -- 0:00:38
355000 -- (-347.169) [-348.082] (-348.497) (-346.196) * (-347.190) (-348.875) (-345.515) [-348.909] -- 0:00:38
Average standard deviation of split frequencies: 0.012271
355500 -- (-346.667) (-348.674) (-346.727) [-345.260] * (-345.887) (-348.174) (-350.892) [-347.492] -- 0:00:38
356000 -- (-345.424) (-349.082) (-345.918) [-345.404] * (-345.870) (-346.994) (-347.834) [-347.881] -- 0:00:37
356500 -- [-349.187] (-349.355) (-349.335) (-345.443) * (-346.331) (-346.673) (-346.597) [-345.962] -- 0:00:37
357000 -- (-348.569) (-344.821) [-350.877] (-346.675) * [-348.561] (-346.428) (-348.036) (-345.484) -- 0:00:37
357500 -- [-346.048] (-349.348) (-347.216) (-350.173) * (-352.700) (-348.218) (-347.211) [-348.106] -- 0:00:37
358000 -- (-347.481) (-350.316) [-347.051] (-348.148) * [-349.016] (-353.836) (-347.931) (-346.255) -- 0:00:37
358500 -- [-347.109] (-352.728) (-345.299) (-348.298) * (-349.235) (-350.718) [-347.847] (-346.875) -- 0:00:37
359000 -- (-347.114) (-349.437) [-345.663] (-348.753) * (-347.688) [-346.406] (-345.514) (-349.670) -- 0:00:37
359500 -- (-345.806) (-347.633) (-345.403) [-347.826] * (-348.584) (-349.815) [-345.678] (-346.213) -- 0:00:37
360000 -- [-345.859] (-346.673) (-345.387) (-348.574) * [-348.709] (-346.701) (-345.887) (-348.826) -- 0:00:37
Average standard deviation of split frequencies: 0.011938
360500 -- (-346.528) (-348.199) [-346.891] (-345.349) * (-348.336) (-345.622) (-350.235) [-349.489] -- 0:00:37
361000 -- (-345.868) (-346.483) (-344.920) [-346.692] * [-345.359] (-348.487) (-349.012) (-346.886) -- 0:00:37
361500 -- (-350.986) (-346.926) (-345.191) [-346.474] * (-348.412) (-347.124) [-345.907] (-348.155) -- 0:00:37
362000 -- (-350.516) [-346.933] (-347.910) (-348.730) * (-345.993) [-348.999] (-347.855) (-352.534) -- 0:00:38
362500 -- (-347.898) (-346.706) (-347.322) [-348.793] * [-347.168] (-347.508) (-346.324) (-354.604) -- 0:00:38
363000 -- (-348.395) (-346.969) (-347.922) [-351.122] * (-347.988) (-350.986) [-345.824] (-352.800) -- 0:00:38
363500 -- [-348.340] (-349.722) (-347.971) (-347.622) * (-349.904) (-349.316) [-347.327] (-354.254) -- 0:00:38
364000 -- (-346.932) (-347.716) (-345.925) [-346.870] * (-348.277) (-345.270) [-347.800] (-352.183) -- 0:00:38
364500 -- (-349.118) (-347.596) [-346.664] (-350.526) * (-349.363) (-349.889) [-347.202] (-353.989) -- 0:00:38
365000 -- [-345.255] (-348.367) (-346.658) (-349.106) * [-349.686] (-347.502) (-348.035) (-348.629) -- 0:00:38
Average standard deviation of split frequencies: 0.012155
365500 -- (-347.107) (-347.485) [-345.572] (-347.701) * (-345.049) [-348.860] (-352.691) (-349.594) -- 0:00:38
366000 -- (-354.612) [-349.213] (-350.018) (-348.947) * [-346.745] (-347.017) (-347.168) (-347.219) -- 0:00:38
366500 -- (-358.812) (-346.809) (-346.250) [-346.560] * (-345.821) (-348.662) (-345.396) [-346.861] -- 0:00:38
367000 -- [-347.765] (-349.698) (-353.801) (-347.440) * (-346.864) (-345.188) (-348.934) [-348.215] -- 0:00:37
367500 -- (-346.017) [-346.065] (-351.280) (-346.933) * [-345.653] (-348.245) (-347.568) (-350.237) -- 0:00:37
368000 -- [-346.283] (-348.842) (-345.945) (-348.946) * (-349.318) (-348.950) (-346.575) [-350.297] -- 0:00:37
368500 -- (-345.782) (-349.032) [-348.402] (-345.990) * (-347.534) (-345.786) [-345.113] (-346.190) -- 0:00:37
369000 -- (-348.308) (-352.839) [-345.648] (-345.062) * [-346.636] (-346.132) (-349.251) (-346.516) -- 0:00:37
369500 -- (-346.613) (-348.434) (-347.141) [-345.789] * (-347.575) (-345.692) [-346.453] (-348.674) -- 0:00:37
370000 -- (-347.285) (-356.092) (-346.265) [-345.503] * [-349.272] (-346.241) (-346.069) (-349.347) -- 0:00:37
Average standard deviation of split frequencies: 0.011525
370500 -- (-345.644) [-346.250] (-345.093) (-349.900) * (-348.547) (-345.799) [-346.737] (-345.274) -- 0:00:37
371000 -- [-346.962] (-348.587) (-345.528) (-351.774) * (-347.679) (-346.751) (-346.426) [-345.925] -- 0:00:37
371500 -- (-346.302) [-346.553] (-345.110) (-349.168) * (-350.865) [-347.075] (-347.513) (-346.086) -- 0:00:37
372000 -- (-347.477) (-346.178) (-346.203) [-345.780] * (-347.090) [-346.737] (-346.690) (-348.118) -- 0:00:37
372500 -- [-345.862] (-350.334) (-349.781) (-345.297) * (-346.866) (-345.517) (-346.471) [-348.769] -- 0:00:37
373000 -- (-346.753) [-345.871] (-351.424) (-345.589) * (-345.743) (-346.716) (-352.592) [-346.012] -- 0:00:36
373500 -- [-346.732] (-345.652) (-349.266) (-345.562) * (-348.665) [-348.659] (-348.084) (-345.424) -- 0:00:36
374000 -- (-346.975) [-346.078] (-347.460) (-345.325) * (-347.709) (-350.826) [-348.747] (-347.995) -- 0:00:36
374500 -- [-345.958] (-347.187) (-349.972) (-345.085) * (-347.602) (-346.999) [-348.566] (-344.860) -- 0:00:36
375000 -- (-348.756) (-351.355) (-348.786) [-349.950] * (-349.171) [-350.186] (-347.273) (-347.521) -- 0:00:36
Average standard deviation of split frequencies: 0.011832
375500 -- (-348.062) (-349.807) [-345.403] (-346.645) * (-346.338) (-347.618) [-348.040] (-354.529) -- 0:00:36
376000 -- (-349.629) (-349.832) [-345.585] (-349.195) * (-347.928) (-348.345) [-346.572] (-348.831) -- 0:00:36
376500 -- (-348.570) (-347.343) [-345.832] (-350.913) * [-351.326] (-346.409) (-353.405) (-347.317) -- 0:00:36
377000 -- (-345.983) [-346.416] (-349.148) (-345.660) * [-349.731] (-347.559) (-351.293) (-349.060) -- 0:00:36
377500 -- [-346.445] (-345.735) (-345.577) (-348.288) * [-345.710] (-345.945) (-345.839) (-347.892) -- 0:00:36
378000 -- (-346.689) [-347.421] (-346.764) (-347.409) * (-345.717) (-351.777) [-345.657] (-349.424) -- 0:00:36
378500 -- (-348.406) (-345.470) [-347.458] (-346.221) * (-346.726) [-346.252] (-346.067) (-348.356) -- 0:00:36
379000 -- (-346.423) (-345.150) [-345.546] (-345.704) * (-348.713) [-345.556] (-346.726) (-347.449) -- 0:00:36
379500 -- (-346.939) [-345.381] (-347.358) (-348.340) * (-348.192) (-346.995) (-347.000) [-346.557] -- 0:00:37
380000 -- (-347.188) (-346.588) (-347.590) [-348.090] * [-347.556] (-347.912) (-348.403) (-349.819) -- 0:00:37
Average standard deviation of split frequencies: 0.011997
380500 -- (-347.895) [-349.010] (-345.466) (-347.854) * (-347.515) (-347.508) [-348.414] (-348.317) -- 0:00:37
381000 -- [-345.612] (-351.537) (-350.572) (-349.013) * [-347.996] (-348.700) (-348.228) (-347.485) -- 0:00:37
381500 -- (-347.234) [-348.037] (-347.868) (-347.408) * [-347.502] (-350.386) (-352.114) (-348.058) -- 0:00:37
382000 -- [-346.097] (-348.458) (-347.659) (-348.311) * (-348.669) [-345.803] (-349.750) (-346.362) -- 0:00:37
382500 -- (-346.427) (-347.069) (-347.852) [-347.102] * (-350.945) (-347.591) (-345.793) [-345.773] -- 0:00:37
383000 -- [-345.473] (-349.648) (-346.602) (-346.866) * (-348.173) (-348.961) (-347.223) [-345.390] -- 0:00:37
383500 -- [-346.844] (-347.770) (-348.284) (-345.803) * [-346.823] (-348.422) (-345.858) (-350.486) -- 0:00:36
384000 -- [-347.647] (-345.449) (-346.979) (-347.208) * (-346.271) (-348.498) [-346.741] (-346.664) -- 0:00:36
384500 -- (-348.848) (-345.641) (-347.191) [-346.800] * (-350.919) (-346.783) [-346.470] (-348.366) -- 0:00:36
385000 -- (-346.539) [-345.609] (-347.279) (-346.752) * (-345.959) (-347.184) [-349.491] (-346.895) -- 0:00:36
Average standard deviation of split frequencies: 0.012213
385500 -- (-346.105) (-347.527) [-348.016] (-344.971) * (-346.194) (-348.261) [-347.101] (-347.128) -- 0:00:36
386000 -- (-345.388) [-345.728] (-347.914) (-347.323) * (-349.039) (-349.091) (-346.731) [-347.472] -- 0:00:36
386500 -- (-349.208) [-348.071] (-347.279) (-347.614) * (-351.833) (-350.069) (-346.959) [-347.410] -- 0:00:36
387000 -- [-346.995] (-347.830) (-346.658) (-346.675) * (-348.089) [-348.121] (-349.144) (-350.321) -- 0:00:36
387500 -- (-346.027) (-346.890) (-349.786) [-346.760] * (-346.526) (-346.055) [-345.784] (-346.534) -- 0:00:36
388000 -- [-345.849] (-347.737) (-346.092) (-348.219) * (-351.788) (-348.268) (-346.739) [-347.006] -- 0:00:36
388500 -- (-347.515) (-345.675) [-349.174] (-345.134) * (-347.688) [-346.927] (-346.355) (-345.362) -- 0:00:36
389000 -- (-346.678) [-349.404] (-346.522) (-345.452) * (-345.635) (-347.393) [-346.775] (-346.523) -- 0:00:36
389500 -- (-347.287) (-348.229) (-350.808) [-346.748] * (-346.646) (-345.701) [-350.855] (-347.290) -- 0:00:36
390000 -- (-350.834) (-346.246) (-347.469) [-346.251] * (-345.402) [-345.547] (-346.750) (-348.305) -- 0:00:35
Average standard deviation of split frequencies: 0.011011
390500 -- (-347.174) [-346.601] (-349.433) (-346.316) * [-346.327] (-345.430) (-352.304) (-349.632) -- 0:00:35
391000 -- (-348.620) (-348.222) [-347.620] (-346.468) * (-345.749) (-350.961) [-351.055] (-346.819) -- 0:00:35
391500 -- (-347.532) (-347.045) (-349.470) [-345.867] * (-347.156) (-346.991) (-351.631) [-346.036] -- 0:00:35
392000 -- (-346.955) [-345.202] (-346.082) (-350.530) * (-349.184) (-345.826) (-345.951) [-345.492] -- 0:00:35
392500 -- (-348.206) (-349.941) [-345.107] (-346.633) * (-354.316) (-348.644) [-346.956] (-348.307) -- 0:00:35
393000 -- (-346.739) [-345.824] (-346.772) (-347.962) * (-353.475) [-348.176] (-347.412) (-349.339) -- 0:00:35
393500 -- (-346.925) (-345.409) (-347.257) [-347.812] * (-350.289) [-345.636] (-349.634) (-347.692) -- 0:00:35
394000 -- [-347.012] (-349.491) (-347.593) (-346.981) * (-345.462) [-346.739] (-345.965) (-346.297) -- 0:00:35
394500 -- (-347.154) [-347.690] (-350.638) (-347.119) * (-350.407) (-347.066) (-346.438) [-346.221] -- 0:00:35
395000 -- (-346.525) [-346.793] (-346.763) (-346.416) * (-348.814) [-345.447] (-345.321) (-345.314) -- 0:00:36
Average standard deviation of split frequencies: 0.010937
395500 -- [-346.675] (-346.278) (-346.194) (-350.443) * (-348.441) [-347.933] (-345.806) (-349.425) -- 0:00:36
396000 -- (-345.306) (-346.357) [-345.843] (-347.197) * (-346.696) [-349.575] (-347.436) (-348.854) -- 0:00:36
396500 -- (-346.201) (-346.127) [-347.674] (-350.922) * (-346.699) [-345.705] (-345.198) (-348.006) -- 0:00:36
397000 -- (-345.925) (-346.290) [-345.333] (-348.539) * (-345.491) (-346.798) [-345.683] (-347.554) -- 0:00:36
397500 -- (-349.887) [-346.127] (-347.171) (-346.464) * [-345.689] (-346.493) (-346.397) (-353.147) -- 0:00:36
398000 -- (-350.562) (-346.514) (-348.300) [-346.870] * (-346.532) [-348.878] (-346.945) (-347.101) -- 0:00:36
398500 -- (-346.471) (-346.274) (-348.055) [-347.284] * (-347.807) (-347.658) [-345.618] (-348.960) -- 0:00:36
399000 -- (-345.372) (-346.879) (-346.622) [-348.505] * [-345.135] (-350.440) (-346.844) (-346.559) -- 0:00:36
399500 -- (-347.173) (-349.747) [-349.399] (-353.431) * (-345.790) [-345.991] (-347.154) (-345.968) -- 0:00:36
400000 -- (-348.852) [-345.262] (-347.797) (-346.357) * [-351.379] (-345.982) (-352.044) (-349.509) -- 0:00:36
Average standard deviation of split frequencies: 0.011545
400500 -- (-352.436) (-346.796) [-347.499] (-347.858) * (-347.043) (-347.741) (-350.556) [-345.910] -- 0:00:35
401000 -- (-349.514) [-346.629] (-347.080) (-347.402) * (-346.067) (-350.751) [-348.469] (-347.008) -- 0:00:35
401500 -- (-349.993) [-349.561] (-345.618) (-349.658) * [-347.900] (-346.976) (-347.832) (-347.084) -- 0:00:35
402000 -- [-347.767] (-347.442) (-346.105) (-345.852) * (-346.702) (-354.613) (-350.470) [-346.961] -- 0:00:35
402500 -- [-346.771] (-345.998) (-349.237) (-351.098) * (-345.677) [-346.475] (-352.681) (-346.052) -- 0:00:35
403000 -- (-349.161) [-346.032] (-347.880) (-349.861) * (-346.962) [-348.150] (-348.677) (-345.640) -- 0:00:35
403500 -- (-348.050) [-347.178] (-348.197) (-346.810) * [-346.622] (-347.039) (-345.713) (-347.293) -- 0:00:35
404000 -- (-350.411) (-347.975) [-346.739] (-346.554) * [-344.858] (-347.264) (-345.611) (-347.099) -- 0:00:35
404500 -- (-348.011) (-346.788) (-346.813) [-346.298] * [-345.718] (-355.121) (-346.593) (-345.663) -- 0:00:35
405000 -- (-346.414) (-345.241) [-347.191] (-346.084) * (-345.531) (-349.929) (-345.812) [-347.552] -- 0:00:35
Average standard deviation of split frequencies: 0.011406
405500 -- [-346.944] (-346.296) (-346.642) (-347.692) * (-346.770) (-347.055) [-345.774] (-347.831) -- 0:00:35
406000 -- (-345.446) [-349.044] (-346.266) (-351.408) * (-347.070) (-348.075) [-346.169] (-347.147) -- 0:00:35
406500 -- [-345.819] (-346.208) (-347.828) (-347.015) * (-348.609) (-345.413) (-348.940) [-347.133] -- 0:00:35
407000 -- (-348.123) [-345.910] (-346.318) (-349.818) * (-347.152) (-348.527) (-348.376) [-352.006] -- 0:00:34
407500 -- (-353.053) [-345.290] (-348.077) (-347.198) * (-345.741) [-345.616] (-346.341) (-348.375) -- 0:00:34
408000 -- (-350.971) [-345.386] (-345.640) (-350.871) * (-345.583) [-347.154] (-346.135) (-353.445) -- 0:00:34
408500 -- [-350.301] (-349.018) (-349.748) (-347.242) * [-349.127] (-347.447) (-346.969) (-348.713) -- 0:00:34
409000 -- (-354.685) (-345.088) (-346.266) [-353.898] * [-347.973] (-346.148) (-350.236) (-348.191) -- 0:00:34
409500 -- (-345.612) (-348.175) [-345.863] (-352.516) * (-347.139) [-346.192] (-350.510) (-345.599) -- 0:00:34
410000 -- (-346.824) [-347.150] (-347.698) (-349.648) * (-351.684) [-347.286] (-349.210) (-346.921) -- 0:00:34
Average standard deviation of split frequencies: 0.010601
410500 -- (-345.636) (-349.304) [-347.702] (-350.212) * (-347.918) (-346.060) (-350.987) [-347.661] -- 0:00:34
411000 -- (-349.077) (-349.288) (-347.597) [-346.925] * (-348.728) (-349.199) (-347.273) [-346.257] -- 0:00:34
411500 -- (-346.602) (-349.750) (-346.963) [-348.073] * (-345.924) (-346.452) (-347.371) [-346.162] -- 0:00:34
412000 -- [-346.627] (-345.459) (-347.896) (-347.212) * (-346.159) (-348.740) [-348.083] (-347.692) -- 0:00:34
412500 -- (-346.232) (-345.428) [-346.386] (-348.026) * (-349.994) (-345.762) (-345.784) [-345.177] -- 0:00:35
413000 -- (-346.471) [-345.666] (-351.441) (-348.345) * (-346.023) [-346.455] (-352.223) (-347.070) -- 0:00:35
413500 -- (-350.758) [-345.551] (-351.025) (-345.101) * (-346.718) (-346.511) [-346.200] (-349.235) -- 0:00:35
414000 -- [-345.707] (-347.062) (-348.520) (-346.151) * (-348.090) [-345.710] (-346.817) (-351.034) -- 0:00:35
414500 -- (-345.756) (-348.611) (-351.527) [-346.655] * [-346.482] (-347.083) (-344.990) (-347.019) -- 0:00:35
415000 -- [-347.784] (-350.834) (-348.665) (-347.165) * [-348.393] (-345.821) (-345.627) (-345.815) -- 0:00:35
Average standard deviation of split frequencies: 0.010199
415500 -- [-346.965] (-345.358) (-349.503) (-346.416) * (-348.953) (-346.427) (-345.238) [-345.147] -- 0:00:35
416000 -- (-345.368) (-346.225) (-345.517) [-348.793] * [-347.655] (-345.752) (-346.328) (-346.489) -- 0:00:35
416500 -- (-346.139) [-346.305] (-345.440) (-347.186) * (-345.760) [-347.221] (-349.327) (-348.537) -- 0:00:35
417000 -- [-345.788] (-348.495) (-346.403) (-349.157) * [-349.651] (-347.785) (-347.292) (-345.853) -- 0:00:34
417500 -- (-345.928) (-344.740) (-344.881) [-347.543] * [-346.991] (-347.647) (-347.472) (-347.392) -- 0:00:34
418000 -- (-345.202) (-346.302) (-345.482) [-346.110] * (-348.988) (-350.604) (-347.453) [-346.512] -- 0:00:34
418500 -- (-346.044) (-353.942) (-347.615) [-348.268] * (-346.876) [-347.730] (-349.093) (-346.958) -- 0:00:34
419000 -- (-348.016) (-351.321) [-345.272] (-344.918) * (-348.025) [-347.890] (-347.216) (-345.438) -- 0:00:34
419500 -- (-346.671) (-349.954) (-345.171) [-345.587] * (-346.382) [-348.003] (-348.271) (-355.129) -- 0:00:34
420000 -- (-347.127) (-347.043) [-347.546] (-346.065) * (-346.381) (-346.684) (-346.791) [-348.349] -- 0:00:34
Average standard deviation of split frequencies: 0.009805
420500 -- (-346.021) [-346.376] (-345.600) (-349.420) * (-348.717) (-351.581) [-345.608] (-349.952) -- 0:00:34
421000 -- (-347.833) (-344.855) [-348.141] (-346.089) * (-347.223) [-346.459] (-349.106) (-345.684) -- 0:00:34
421500 -- [-347.504] (-347.208) (-345.526) (-347.123) * (-349.348) (-346.556) (-347.680) [-345.567] -- 0:00:34
422000 -- (-346.988) (-346.943) (-345.539) [-345.240] * (-347.161) (-346.544) [-345.315] (-346.687) -- 0:00:34
422500 -- (-346.607) [-345.749] (-345.138) (-345.400) * (-346.770) [-347.622] (-348.492) (-348.003) -- 0:00:34
423000 -- (-346.280) (-346.588) (-345.595) [-345.671] * [-351.152] (-347.340) (-345.693) (-348.001) -- 0:00:34
423500 -- (-348.702) [-347.388] (-346.637) (-346.258) * (-346.191) (-348.539) (-345.712) [-347.301] -- 0:00:34
424000 -- (-354.975) [-348.000] (-346.415) (-345.654) * (-345.591) (-347.138) [-345.195] (-347.114) -- 0:00:33
424500 -- [-349.912] (-345.493) (-348.786) (-346.096) * (-350.291) (-348.137) (-348.644) [-348.318] -- 0:00:33
425000 -- (-347.997) (-345.682) [-349.335] (-347.899) * (-346.743) [-347.718] (-347.396) (-347.363) -- 0:00:33
Average standard deviation of split frequencies: 0.009890
425500 -- [-350.107] (-348.308) (-348.001) (-346.932) * (-347.851) [-346.505] (-347.994) (-346.653) -- 0:00:33
426000 -- (-348.746) (-348.730) (-346.667) [-347.639] * (-347.299) (-352.116) [-345.471] (-345.470) -- 0:00:33
426500 -- (-346.887) [-347.925] (-345.452) (-345.420) * (-351.053) (-351.447) (-345.447) [-347.410] -- 0:00:33
427000 -- (-346.366) (-345.361) [-346.023] (-346.346) * (-349.135) (-347.727) [-345.794] (-348.869) -- 0:00:33
427500 -- (-345.873) [-347.007] (-347.019) (-345.536) * (-349.616) (-348.166) (-349.198) [-346.621] -- 0:00:33
428000 -- (-345.107) [-345.944] (-346.922) (-345.775) * (-346.487) [-350.275] (-346.607) (-348.607) -- 0:00:33
428500 -- (-345.691) (-347.517) [-348.682] (-347.956) * (-349.921) [-345.770] (-353.024) (-346.742) -- 0:00:33
429000 -- (-347.420) (-345.513) (-347.030) [-345.901] * (-347.364) (-349.762) (-347.016) [-345.980] -- 0:00:33
429500 -- (-349.707) (-345.426) (-348.054) [-346.909] * (-345.465) (-346.755) [-346.412] (-347.528) -- 0:00:34
430000 -- [-346.400] (-350.932) (-349.313) (-345.902) * (-346.359) (-353.283) [-347.380] (-347.728) -- 0:00:34
Average standard deviation of split frequencies: 0.009715
430500 -- [-346.621] (-350.094) (-348.015) (-348.196) * (-348.283) (-346.935) [-345.023] (-348.241) -- 0:00:34
431000 -- (-346.072) [-345.248] (-354.314) (-348.312) * [-346.348] (-345.944) (-349.224) (-350.273) -- 0:00:34
431500 -- (-345.501) [-348.886] (-346.727) (-346.105) * (-347.896) (-348.879) [-346.590] (-347.265) -- 0:00:34
432000 -- (-346.769) [-346.091] (-345.206) (-345.391) * (-346.329) [-345.592] (-346.068) (-347.823) -- 0:00:34
432500 -- [-347.038] (-346.608) (-347.984) (-348.479) * (-345.613) (-351.933) (-347.064) [-347.389] -- 0:00:34
433000 -- (-349.837) [-346.616] (-344.870) (-351.074) * (-346.663) (-346.667) [-345.570] (-347.195) -- 0:00:34
433500 -- [-346.577] (-345.899) (-347.028) (-345.261) * (-345.801) (-349.431) (-349.464) [-348.332] -- 0:00:33
434000 -- (-353.018) [-346.757] (-348.839) (-345.725) * (-351.155) (-346.583) (-349.157) [-345.727] -- 0:00:33
434500 -- (-349.588) [-345.968] (-347.352) (-346.659) * (-351.540) (-349.898) (-349.927) [-350.563] -- 0:00:33
435000 -- (-348.544) (-348.277) (-347.125) [-347.203] * (-349.473) (-353.146) (-351.738) [-346.091] -- 0:00:33
Average standard deviation of split frequencies: 0.009596
435500 -- (-346.382) [-347.513] (-345.511) (-349.398) * (-347.071) (-349.218) [-352.392] (-351.423) -- 0:00:33
436000 -- (-346.241) (-346.047) (-346.103) [-345.621] * [-348.069] (-352.418) (-352.783) (-346.787) -- 0:00:33
436500 -- (-345.676) (-347.009) [-345.287] (-345.602) * [-347.684] (-349.356) (-346.301) (-347.743) -- 0:00:33
437000 -- (-347.309) [-346.628] (-345.289) (-345.153) * (-346.694) [-347.265] (-347.415) (-345.550) -- 0:00:33
437500 -- (-346.542) (-345.761) [-350.464] (-350.901) * [-345.568] (-350.478) (-352.604) (-345.431) -- 0:00:33
438000 -- [-348.037] (-346.429) (-347.284) (-348.504) * [-344.801] (-350.430) (-346.679) (-346.326) -- 0:00:33
438500 -- (-345.361) [-348.481] (-345.103) (-349.818) * (-345.937) (-350.713) (-345.090) [-347.674] -- 0:00:33
439000 -- (-346.506) (-346.523) (-346.938) [-346.320] * (-346.917) [-345.241] (-345.528) (-347.683) -- 0:00:33
439500 -- (-347.976) (-344.736) (-345.283) [-347.710] * (-347.839) (-348.182) (-346.666) [-350.588] -- 0:00:33
440000 -- (-347.409) (-349.549) (-347.866) [-349.017] * (-346.100) [-348.780] (-348.192) (-346.711) -- 0:00:33
Average standard deviation of split frequencies: 0.008759
440500 -- (-347.139) (-354.919) [-346.359] (-349.990) * (-345.317) (-348.220) (-351.076) [-345.569] -- 0:00:33
441000 -- (-349.156) (-349.141) [-347.021] (-347.172) * (-345.770) (-346.194) (-347.400) [-347.805] -- 0:00:32
441500 -- (-348.710) [-346.528] (-346.595) (-346.370) * (-345.699) (-347.796) (-348.079) [-347.823] -- 0:00:32
442000 -- (-347.547) (-347.291) [-346.684] (-346.840) * (-346.816) (-348.335) [-345.559] (-346.817) -- 0:00:32
442500 -- (-350.166) (-346.736) (-353.364) [-345.464] * (-351.289) (-349.970) [-347.636] (-346.191) -- 0:00:32
443000 -- (-348.722) (-346.410) (-348.285) [-347.271] * (-347.200) (-346.165) [-345.004] (-347.228) -- 0:00:32
443500 -- (-349.847) [-345.950] (-348.478) (-347.150) * (-347.103) (-347.142) (-345.966) [-346.603] -- 0:00:32
444000 -- (-347.911) (-347.105) (-346.656) [-347.723] * (-348.645) (-349.073) [-345.737] (-350.212) -- 0:00:32
444500 -- [-347.777] (-346.284) (-346.611) (-348.172) * (-349.585) [-345.834] (-345.825) (-346.618) -- 0:00:32
445000 -- (-349.858) [-346.665] (-350.331) (-347.932) * (-346.243) (-350.100) [-346.759] (-348.693) -- 0:00:32
Average standard deviation of split frequencies: 0.008852
445500 -- (-348.298) (-346.081) (-345.913) [-345.147] * (-349.277) (-346.655) (-348.342) [-345.850] -- 0:00:32
446000 -- (-347.469) (-346.595) (-347.791) [-345.580] * (-346.161) (-347.512) (-346.120) [-346.353] -- 0:00:32
446500 -- (-346.698) (-348.092) [-347.237] (-344.880) * (-346.246) (-349.759) (-348.233) [-345.123] -- 0:00:32
447000 -- [-348.094] (-345.950) (-347.449) (-346.070) * [-348.804] (-347.992) (-346.505) (-345.556) -- 0:00:33
447500 -- [-348.290] (-345.350) (-347.589) (-349.688) * [-350.609] (-348.585) (-349.003) (-345.362) -- 0:00:33
448000 -- (-346.754) (-346.937) (-346.446) [-355.441] * (-347.641) (-347.705) (-352.852) [-345.842] -- 0:00:33
448500 -- (-348.304) (-349.260) [-346.476] (-348.382) * (-348.589) [-345.759] (-345.982) (-349.804) -- 0:00:33
449000 -- [-345.856] (-346.341) (-346.983) (-347.534) * [-346.322] (-352.353) (-347.735) (-354.717) -- 0:00:33
449500 -- (-346.136) (-344.926) (-348.469) [-349.585] * (-347.322) (-348.397) [-346.481] (-353.613) -- 0:00:33
450000 -- (-347.978) (-346.062) [-348.231] (-349.209) * (-346.445) (-346.437) (-353.355) [-347.074] -- 0:00:33
Average standard deviation of split frequencies: 0.008041
450500 -- [-346.169] (-344.968) (-350.282) (-348.620) * [-348.270] (-348.497) (-347.415) (-348.933) -- 0:00:32
451000 -- (-346.326) [-346.966] (-347.057) (-349.950) * (-347.525) [-347.735] (-347.372) (-347.183) -- 0:00:32
451500 -- (-345.641) (-345.532) (-350.506) [-347.001] * [-346.648] (-348.264) (-351.876) (-347.752) -- 0:00:32
452000 -- [-346.413] (-346.276) (-349.159) (-349.104) * (-346.662) (-347.298) (-350.163) [-347.508] -- 0:00:32
452500 -- [-347.759] (-346.344) (-347.976) (-350.101) * (-344.987) [-347.976] (-347.325) (-346.332) -- 0:00:32
453000 -- (-346.202) [-347.229] (-347.579) (-346.078) * (-345.459) [-345.324] (-347.205) (-349.353) -- 0:00:32
453500 -- (-346.638) (-345.813) (-349.458) [-346.250] * (-346.419) (-346.209) [-346.802] (-346.230) -- 0:00:32
454000 -- [-346.342] (-350.455) (-349.142) (-348.578) * (-349.891) (-347.301) (-352.531) [-346.083] -- 0:00:32
454500 -- (-347.375) (-346.451) [-346.552] (-350.184) * (-348.232) (-345.567) [-349.260] (-347.266) -- 0:00:32
455000 -- (-350.960) (-346.708) [-347.054] (-346.963) * (-345.284) (-348.570) [-349.495] (-348.029) -- 0:00:32
Average standard deviation of split frequencies: 0.008399
455500 -- (-347.933) (-349.429) (-344.882) [-349.162] * (-345.409) (-348.139) (-348.299) [-350.436] -- 0:00:32
456000 -- [-346.134] (-346.432) (-347.677) (-348.401) * (-346.824) (-346.607) [-347.594] (-345.336) -- 0:00:32
456500 -- (-347.281) [-347.471] (-348.398) (-348.089) * (-348.521) [-347.781] (-346.938) (-345.561) -- 0:00:32
457000 -- (-345.660) (-347.736) (-349.115) [-348.159] * (-345.484) (-346.856) [-347.657] (-347.757) -- 0:00:32
457500 -- (-347.143) (-346.251) [-346.519] (-349.559) * [-347.412] (-346.425) (-346.411) (-346.651) -- 0:00:32
458000 -- [-345.757] (-347.291) (-353.113) (-350.070) * [-348.324] (-347.938) (-345.235) (-351.091) -- 0:00:31
458500 -- [-346.780] (-346.394) (-347.789) (-352.921) * [-346.983] (-348.716) (-347.281) (-347.408) -- 0:00:31
459000 -- (-346.537) (-347.736) (-348.512) [-345.926] * (-354.903) [-346.553] (-351.201) (-345.071) -- 0:00:31
459500 -- (-345.169) (-345.000) (-348.540) [-348.386] * [-346.084] (-346.075) (-347.653) (-347.103) -- 0:00:31
460000 -- (-346.631) (-346.605) [-346.323] (-347.473) * (-347.089) [-345.415] (-346.623) (-349.596) -- 0:00:31
Average standard deviation of split frequencies: 0.007867
460500 -- (-345.940) [-350.730] (-345.364) (-346.588) * (-352.372) [-347.499] (-345.923) (-345.897) -- 0:00:31
461000 -- (-346.861) [-348.562] (-347.369) (-349.613) * (-347.324) (-345.251) [-347.664] (-348.410) -- 0:00:31
461500 -- [-348.511] (-348.086) (-349.195) (-344.929) * (-350.747) [-346.491] (-346.838) (-348.203) -- 0:00:31
462000 -- (-347.126) (-345.800) (-345.239) [-346.915] * (-346.535) (-346.162) [-345.981] (-347.250) -- 0:00:31
462500 -- [-346.714] (-347.372) (-350.213) (-345.730) * (-346.659) [-348.222] (-347.840) (-345.874) -- 0:00:31
463000 -- (-347.052) [-349.808] (-357.631) (-349.348) * (-345.947) (-348.471) [-346.163] (-345.186) -- 0:00:31
463500 -- (-346.422) (-348.843) (-351.121) [-350.437] * [-346.714] (-348.589) (-348.374) (-345.900) -- 0:00:31
464000 -- (-347.292) [-346.805] (-345.044) (-349.704) * (-345.731) [-346.351] (-347.236) (-347.823) -- 0:00:32
464500 -- (-346.452) (-351.602) [-351.225] (-347.645) * (-347.872) (-348.839) [-345.087] (-347.729) -- 0:00:32
465000 -- (-347.717) (-351.202) [-347.253] (-345.075) * (-349.725) [-347.093] (-354.426) (-350.821) -- 0:00:32
Average standard deviation of split frequencies: 0.007397
465500 -- (-348.163) [-347.128] (-347.864) (-346.315) * (-348.430) [-347.327] (-347.167) (-345.990) -- 0:00:32
466000 -- [-346.193] (-347.058) (-350.304) (-348.863) * (-348.458) (-347.827) (-345.283) [-346.779] -- 0:00:32
466500 -- (-348.186) (-346.470) (-348.348) [-344.939] * (-346.491) (-350.409) [-347.687] (-345.829) -- 0:00:32
467000 -- (-345.578) (-344.937) (-347.604) [-349.655] * [-346.291] (-346.207) (-347.966) (-346.366) -- 0:00:31
467500 -- (-349.099) [-345.335] (-347.198) (-348.092) * (-349.244) (-349.132) [-346.543] (-346.507) -- 0:00:31
468000 -- (-344.920) [-346.278] (-346.139) (-346.978) * (-345.395) [-347.030] (-346.759) (-348.775) -- 0:00:31
468500 -- (-349.263) (-345.533) (-348.138) [-348.742] * [-345.217] (-345.164) (-347.031) (-345.785) -- 0:00:31
469000 -- (-350.879) (-346.727) (-345.945) [-349.466] * [-345.762] (-348.438) (-346.215) (-346.144) -- 0:00:31
469500 -- [-346.370] (-349.021) (-347.089) (-347.828) * (-346.280) (-346.048) (-345.437) [-345.476] -- 0:00:31
470000 -- [-345.546] (-346.908) (-350.676) (-346.344) * [-347.523] (-347.293) (-351.685) (-347.017) -- 0:00:31
Average standard deviation of split frequencies: 0.006635
470500 -- [-345.131] (-348.139) (-346.146) (-348.252) * (-347.601) [-345.187] (-347.149) (-347.921) -- 0:00:31
471000 -- [-346.189] (-346.245) (-346.538) (-346.085) * (-350.613) (-346.708) [-346.914] (-350.339) -- 0:00:31
471500 -- (-345.941) [-348.074] (-348.028) (-347.072) * (-348.141) (-347.122) [-346.358] (-346.212) -- 0:00:31
472000 -- (-347.882) (-346.723) (-348.081) [-345.614] * [-354.009] (-350.885) (-347.908) (-349.909) -- 0:00:31
472500 -- [-346.146] (-347.804) (-348.085) (-346.007) * (-352.372) [-349.552] (-350.190) (-347.760) -- 0:00:31
473000 -- (-345.793) (-346.373) (-346.125) [-349.944] * (-345.868) (-348.303) [-346.109] (-346.020) -- 0:00:31
473500 -- (-345.251) (-346.934) [-344.834] (-350.294) * (-348.095) (-345.737) (-348.615) [-351.752] -- 0:00:31
474000 -- [-345.464] (-347.720) (-346.282) (-345.592) * (-346.311) [-346.420] (-347.947) (-348.451) -- 0:00:31
474500 -- (-346.023) (-351.389) [-344.916] (-345.150) * [-346.712] (-346.774) (-345.507) (-349.015) -- 0:00:31
475000 -- (-345.247) (-347.196) (-350.330) [-345.698] * (-348.761) (-347.309) (-347.646) [-345.637] -- 0:00:30
Average standard deviation of split frequencies: 0.006252
475500 -- (-346.436) [-344.908] (-348.875) (-346.980) * [-348.108] (-346.665) (-347.942) (-346.831) -- 0:00:30
476000 -- [-345.391] (-344.849) (-346.020) (-354.499) * (-348.418) (-348.732) [-344.880] (-346.062) -- 0:00:30
476500 -- [-346.264] (-347.104) (-349.680) (-347.316) * (-346.805) (-346.800) (-346.410) [-347.180] -- 0:00:30
477000 -- (-348.679) [-345.013] (-346.578) (-346.643) * (-346.752) [-346.766] (-346.484) (-353.669) -- 0:00:30
477500 -- (-353.884) (-348.341) [-348.077] (-346.688) * (-347.761) (-345.850) [-346.856] (-348.017) -- 0:00:30
478000 -- (-356.175) [-344.928] (-348.861) (-345.875) * (-345.788) (-348.556) [-346.905] (-349.516) -- 0:00:30
478500 -- (-346.681) (-345.506) [-353.997] (-349.272) * (-345.846) (-349.489) (-347.280) [-345.386] -- 0:00:30
479000 -- (-349.736) (-347.771) (-347.902) [-346.967] * [-345.833] (-346.102) (-348.871) (-345.557) -- 0:00:30
479500 -- (-346.971) (-347.842) (-349.046) [-347.020] * [-346.823] (-345.557) (-347.912) (-346.691) -- 0:00:30
480000 -- (-347.547) (-350.521) (-346.881) [-346.210] * (-347.367) [-345.877] (-346.815) (-346.795) -- 0:00:30
Average standard deviation of split frequencies: 0.005623
480500 -- (-347.931) (-348.152) [-345.761] (-347.524) * (-348.385) [-349.428] (-347.631) (-348.372) -- 0:00:30
481000 -- (-347.056) (-346.366) [-348.533] (-347.074) * (-348.052) (-345.158) (-345.831) [-347.590] -- 0:00:30
481500 -- [-348.810] (-348.998) (-347.517) (-345.426) * (-346.416) (-346.867) [-348.475] (-348.415) -- 0:00:31
482000 -- (-348.212) [-345.272] (-348.901) (-344.824) * (-347.879) (-347.569) [-349.098] (-345.218) -- 0:00:31
482500 -- (-346.293) (-345.558) [-345.854] (-344.749) * (-345.791) [-345.426] (-348.014) (-345.978) -- 0:00:31
483000 -- (-346.386) [-346.051] (-347.297) (-346.876) * (-347.622) [-354.509] (-346.972) (-350.864) -- 0:00:31
483500 -- (-346.476) [-346.374] (-347.724) (-348.049) * (-349.725) [-349.882] (-348.727) (-347.866) -- 0:00:30
484000 -- (-351.145) (-345.742) [-345.875] (-345.821) * (-346.776) (-346.747) (-350.569) [-345.561] -- 0:00:30
484500 -- (-350.552) (-346.380) (-348.880) [-347.229] * [-346.897] (-347.008) (-353.399) (-351.780) -- 0:00:30
485000 -- [-351.200] (-346.939) (-348.375) (-346.882) * [-346.964] (-345.190) (-349.613) (-351.489) -- 0:00:30
Average standard deviation of split frequencies: 0.006504
485500 -- (-352.656) (-348.897) [-346.569] (-346.414) * (-347.333) (-346.918) (-351.296) [-346.942] -- 0:00:30
486000 -- (-349.364) (-349.073) [-349.015] (-349.526) * (-346.703) [-348.133] (-345.850) (-346.682) -- 0:00:30
486500 -- (-351.949) (-352.989) (-351.758) [-346.332] * (-348.723) (-348.973) [-345.440] (-346.333) -- 0:00:30
487000 -- (-347.323) (-346.097) [-346.238] (-352.721) * (-347.356) (-347.870) [-346.867] (-347.520) -- 0:00:30
487500 -- [-347.531] (-347.455) (-346.562) (-345.351) * (-346.603) (-346.756) [-346.728] (-348.621) -- 0:00:30
488000 -- (-345.756) [-345.786] (-352.801) (-345.359) * [-348.924] (-346.048) (-346.343) (-345.789) -- 0:00:30
488500 -- [-345.975] (-346.058) (-351.589) (-345.738) * (-347.542) (-347.278) [-346.234] (-346.248) -- 0:00:30
489000 -- (-347.424) (-347.283) (-351.543) [-345.935] * [-347.066] (-346.684) (-345.762) (-349.140) -- 0:00:30
489500 -- (-350.016) (-348.795) [-346.420] (-346.050) * [-345.476] (-346.164) (-346.749) (-345.928) -- 0:00:30
490000 -- (-348.627) (-353.136) [-346.163] (-347.597) * (-346.297) [-349.178] (-350.096) (-347.657) -- 0:00:30
Average standard deviation of split frequencies: 0.005945
490500 -- (-348.132) [-348.750] (-348.166) (-346.169) * (-347.336) (-347.094) [-345.275] (-345.248) -- 0:00:30
491000 -- [-348.405] (-347.961) (-348.058) (-346.800) * (-351.099) (-347.354) (-346.873) [-352.526] -- 0:00:30
491500 -- [-345.146] (-347.989) (-347.033) (-346.023) * (-346.181) (-345.486) [-347.597] (-346.786) -- 0:00:30
492000 -- [-347.925] (-346.798) (-346.458) (-346.226) * [-348.220] (-347.946) (-347.991) (-346.264) -- 0:00:29
492500 -- (-348.987) (-345.193) (-347.870) [-348.407] * (-345.844) (-347.865) [-349.080] (-345.641) -- 0:00:29
493000 -- (-347.204) (-348.210) [-348.777] (-345.068) * (-347.735) (-346.305) [-347.088] (-347.637) -- 0:00:29
493500 -- (-345.284) (-345.631) (-346.496) [-347.471] * (-346.559) [-347.231] (-347.519) (-345.833) -- 0:00:29
494000 -- (-348.505) (-346.393) [-346.079] (-348.811) * (-345.091) (-345.753) [-347.622] (-346.039) -- 0:00:29
494500 -- (-349.157) [-346.250] (-346.884) (-346.274) * (-346.708) [-346.170] (-347.947) (-345.925) -- 0:00:29
495000 -- (-347.568) [-345.723] (-346.512) (-345.864) * (-346.223) [-349.270] (-346.934) (-346.248) -- 0:00:29
Average standard deviation of split frequencies: 0.006262
495500 -- (-345.203) (-346.205) [-346.940] (-348.476) * (-345.601) (-347.085) (-347.938) [-351.300] -- 0:00:29
496000 -- (-348.073) [-346.609] (-345.556) (-346.364) * (-347.075) [-346.316] (-348.045) (-350.351) -- 0:00:29
496500 -- (-347.203) (-348.208) (-346.585) [-349.070] * (-346.547) (-347.510) [-346.751] (-345.575) -- 0:00:29
497000 -- (-348.943) (-347.362) (-347.638) [-346.696] * (-347.065) [-346.918] (-346.779) (-348.449) -- 0:00:29
497500 -- [-348.485] (-347.324) (-350.931) (-348.644) * (-346.345) (-348.750) (-347.577) [-346.264] -- 0:00:29
498000 -- (-347.964) [-345.462] (-347.192) (-347.185) * [-345.777] (-348.717) (-346.892) (-345.988) -- 0:00:29
498500 -- (-348.166) [-345.026] (-350.648) (-350.847) * (-345.796) [-347.084] (-345.796) (-345.407) -- 0:00:29
499000 -- [-347.587] (-346.464) (-346.096) (-345.319) * (-345.093) [-349.741] (-345.566) (-348.291) -- 0:00:30
499500 -- [-345.815] (-347.325) (-348.927) (-345.839) * (-349.997) [-346.403] (-346.513) (-347.181) -- 0:00:30
500000 -- [-345.943] (-346.949) (-345.710) (-347.201) * (-345.929) [-346.381] (-348.138) (-348.327) -- 0:00:30
Average standard deviation of split frequencies: 0.006037
500500 -- (-347.343) (-346.245) [-346.547] (-345.913) * [-348.711] (-346.782) (-346.039) (-349.436) -- 0:00:29
501000 -- [-345.706] (-346.313) (-347.349) (-345.985) * [-346.915] (-346.167) (-346.514) (-347.231) -- 0:00:29
501500 -- (-346.522) [-346.057] (-346.422) (-346.847) * (-351.245) (-351.913) [-345.671] (-348.031) -- 0:00:29
502000 -- [-346.422] (-348.576) (-345.973) (-345.587) * (-349.885) (-348.830) [-347.624] (-345.103) -- 0:00:29
502500 -- [-348.642] (-348.272) (-345.824) (-345.240) * (-346.878) (-352.209) [-346.676] (-350.913) -- 0:00:29
503000 -- [-348.101] (-346.694) (-348.885) (-347.786) * [-346.481] (-345.949) (-346.108) (-345.849) -- 0:00:29
503500 -- (-348.689) (-346.067) (-346.489) [-345.644] * [-346.131] (-350.840) (-348.713) (-348.479) -- 0:00:29
504000 -- (-348.456) (-347.083) [-346.354] (-348.963) * [-347.867] (-348.231) (-349.353) (-349.709) -- 0:00:29
504500 -- [-347.666] (-346.730) (-348.572) (-346.020) * (-348.595) [-347.102] (-347.090) (-346.652) -- 0:00:29
505000 -- (-345.742) [-347.912] (-346.316) (-346.221) * (-347.465) [-348.710] (-346.041) (-348.527) -- 0:00:29
Average standard deviation of split frequencies: 0.006263
505500 -- (-346.844) (-346.222) (-349.978) [-346.404] * (-348.738) [-346.560] (-346.219) (-348.001) -- 0:00:29
506000 -- (-346.398) [-345.739] (-346.132) (-346.261) * (-347.497) (-346.824) [-345.879] (-348.897) -- 0:00:29
506500 -- [-348.165] (-348.006) (-351.276) (-349.860) * (-348.218) [-346.836] (-348.333) (-348.221) -- 0:00:29
507000 -- [-346.774] (-348.780) (-348.878) (-350.948) * (-350.496) (-347.736) (-344.849) [-345.888] -- 0:00:29
507500 -- (-345.930) (-345.070) (-348.371) [-352.016] * (-347.529) (-347.036) (-348.230) [-345.520] -- 0:00:29
508000 -- (-347.241) (-345.587) [-346.605] (-349.193) * [-347.648] (-350.764) (-346.300) (-347.594) -- 0:00:29
508500 -- [-345.942] (-346.967) (-348.784) (-352.516) * (-345.833) (-348.797) [-347.631] (-347.062) -- 0:00:28
509000 -- (-347.294) (-346.974) (-348.789) [-347.324] * [-345.455] (-346.561) (-345.202) (-350.300) -- 0:00:28
509500 -- (-345.672) (-350.510) (-351.044) [-347.145] * (-345.934) (-347.809) [-346.554] (-350.953) -- 0:00:28
510000 -- (-346.165) [-347.365] (-354.213) (-348.389) * [-347.630] (-347.637) (-347.879) (-346.787) -- 0:00:28
Average standard deviation of split frequencies: 0.005810
510500 -- [-348.223] (-345.741) (-350.669) (-347.497) * (-348.699) (-347.908) [-348.855] (-344.926) -- 0:00:28
511000 -- (-348.227) (-345.345) [-347.416] (-350.308) * (-348.348) [-347.072] (-346.983) (-346.761) -- 0:00:28
511500 -- [-346.088] (-349.243) (-346.723) (-350.719) * (-348.779) (-348.142) [-346.027] (-345.100) -- 0:00:28
512000 -- (-347.339) (-345.403) [-346.826] (-347.681) * (-346.568) (-344.930) [-346.366] (-348.362) -- 0:00:28
512500 -- (-349.827) (-346.555) [-346.421] (-345.842) * (-348.226) (-346.718) [-345.467] (-348.920) -- 0:00:28
513000 -- (-348.451) (-348.875) [-347.700] (-346.939) * [-349.071] (-350.028) (-344.971) (-352.151) -- 0:00:28
513500 -- (-347.533) [-347.587] (-345.388) (-348.791) * (-346.621) [-350.937] (-345.130) (-350.417) -- 0:00:28
514000 -- [-345.206] (-349.665) (-347.143) (-345.541) * (-349.135) [-350.570] (-345.348) (-349.361) -- 0:00:28
514500 -- (-349.180) (-349.100) (-345.081) [-349.417] * (-347.025) [-346.885] (-347.891) (-347.779) -- 0:00:28
515000 -- (-347.719) (-345.160) [-347.818] (-350.246) * (-346.833) (-349.771) [-345.790] (-347.220) -- 0:00:28
Average standard deviation of split frequencies: 0.006395
515500 -- (-348.202) [-347.105] (-346.203) (-349.558) * [-346.156] (-347.756) (-353.362) (-352.091) -- 0:00:28
516000 -- (-347.029) (-346.200) (-348.239) [-345.083] * (-349.915) (-346.510) [-345.711] (-349.017) -- 0:00:29
516500 -- (-345.612) (-348.646) [-346.731] (-347.306) * (-348.241) (-345.691) (-346.762) [-345.765] -- 0:00:29
517000 -- (-345.062) (-347.064) [-346.147] (-345.595) * (-347.911) (-347.922) (-349.076) [-347.159] -- 0:00:28
517500 -- [-345.903] (-347.082) (-346.085) (-345.960) * (-346.759) (-347.759) [-348.551] (-351.958) -- 0:00:28
518000 -- (-346.874) (-347.008) [-345.205] (-347.789) * (-347.671) (-346.103) [-351.301] (-351.139) -- 0:00:28
518500 -- (-349.234) (-349.705) [-346.142] (-346.600) * (-345.361) (-345.914) (-349.570) [-346.555] -- 0:00:28
519000 -- (-349.661) (-348.479) (-346.204) [-345.940] * [-348.003] (-346.101) (-345.851) (-349.803) -- 0:00:28
519500 -- (-348.225) [-349.523] (-347.233) (-348.568) * (-347.787) (-346.549) (-348.222) [-345.770] -- 0:00:28
520000 -- (-348.698) (-355.976) (-345.482) [-346.200] * (-350.656) (-349.984) [-345.706] (-347.473) -- 0:00:28
Average standard deviation of split frequencies: 0.004949
520500 -- (-346.521) [-352.106] (-349.520) (-348.952) * [-345.539] (-346.189) (-346.508) (-348.338) -- 0:00:28
521000 -- (-348.529) (-347.941) [-352.836] (-350.624) * (-345.726) (-353.897) [-346.028] (-347.393) -- 0:00:28
521500 -- (-345.559) (-345.231) (-351.435) [-350.110] * (-346.376) (-351.439) (-350.234) [-349.841] -- 0:00:28
522000 -- (-347.234) (-345.961) [-351.553] (-346.946) * (-345.257) (-346.124) [-351.889] (-346.413) -- 0:00:28
522500 -- (-350.956) [-345.225] (-348.596) (-346.145) * (-352.306) [-347.800] (-346.461) (-347.818) -- 0:00:28
523000 -- [-349.709] (-344.849) (-348.940) (-348.450) * [-347.676] (-345.932) (-352.265) (-347.114) -- 0:00:28
523500 -- [-348.087] (-351.415) (-347.591) (-348.424) * (-347.113) (-346.608) (-345.762) [-347.515] -- 0:00:28
524000 -- (-346.368) (-347.197) (-346.468) [-349.871] * (-348.476) (-346.111) [-346.941] (-350.257) -- 0:00:28
524500 -- (-347.699) [-345.843] (-351.318) (-347.752) * (-346.744) (-349.632) (-347.374) [-346.090] -- 0:00:28
525000 -- (-345.366) [-345.975] (-345.783) (-350.043) * [-345.777] (-350.164) (-346.800) (-346.412) -- 0:00:28
Average standard deviation of split frequencies: 0.005317
525500 -- (-345.221) (-346.879) (-347.654) [-350.074] * (-346.480) (-349.333) (-345.978) [-346.551] -- 0:00:27
526000 -- (-350.660) (-346.442) (-346.978) [-347.133] * (-350.340) [-346.159] (-347.448) (-346.532) -- 0:00:27
526500 -- (-348.771) (-347.038) [-349.126] (-349.091) * (-351.060) [-345.914] (-347.500) (-346.180) -- 0:00:27
527000 -- (-348.147) (-348.387) (-349.123) [-347.341] * (-347.198) [-347.277] (-349.305) (-348.089) -- 0:00:27
527500 -- (-347.156) (-346.869) (-351.325) [-348.712] * (-348.882) (-345.570) (-347.691) [-346.676] -- 0:00:27
528000 -- (-346.666) (-350.769) (-352.757) [-346.567] * [-346.052] (-348.320) (-347.071) (-348.836) -- 0:00:27
528500 -- (-347.997) (-348.777) (-350.932) [-345.950] * (-346.011) [-345.555] (-345.953) (-350.122) -- 0:00:27
529000 -- (-348.904) (-351.282) (-347.078) [-347.427] * (-350.033) [-346.659] (-346.171) (-347.406) -- 0:00:27
529500 -- (-346.615) [-348.266] (-349.662) (-345.987) * [-346.733] (-346.102) (-345.815) (-346.402) -- 0:00:27
530000 -- (-346.059) (-348.533) (-347.820) [-348.283] * (-350.014) (-351.839) (-353.182) [-352.537] -- 0:00:27
Average standard deviation of split frequencies: 0.005330
530500 -- [-349.022] (-345.742) (-350.817) (-346.370) * (-349.592) (-348.384) [-346.768] (-345.711) -- 0:00:27
531000 -- (-348.580) (-346.187) (-347.382) [-346.213] * (-350.216) [-345.019] (-350.692) (-346.336) -- 0:00:27
531500 -- (-350.394) (-346.769) (-349.108) [-347.978] * (-355.841) (-349.710) (-347.340) [-346.269] -- 0:00:27
532000 -- [-347.883] (-345.721) (-346.021) (-351.370) * (-349.032) (-350.300) [-344.953] (-345.377) -- 0:00:27
532500 -- (-346.986) (-347.673) [-345.389] (-348.842) * (-349.192) (-345.852) [-344.928] (-346.045) -- 0:00:27
533000 -- (-351.501) (-345.999) [-345.981] (-346.629) * (-347.149) [-345.095] (-347.668) (-346.999) -- 0:00:27
533500 -- [-348.993] (-348.705) (-349.656) (-348.554) * (-345.946) (-347.384) [-348.795] (-348.539) -- 0:00:27
534000 -- (-348.224) (-350.725) [-346.116] (-347.150) * (-344.777) (-347.479) (-347.558) [-351.439] -- 0:00:27
534500 -- (-346.498) (-346.826) [-347.176] (-346.689) * [-349.660] (-346.910) (-350.101) (-349.236) -- 0:00:27
535000 -- [-348.476] (-345.833) (-347.869) (-348.762) * (-345.973) [-345.581] (-347.560) (-348.286) -- 0:00:27
Average standard deviation of split frequencies: 0.005687
535500 -- (-350.041) [-347.996] (-345.489) (-349.539) * (-346.545) [-347.980] (-346.431) (-346.519) -- 0:00:27
536000 -- (-347.157) (-347.583) [-345.335] (-351.219) * (-353.349) [-348.397] (-347.350) (-347.480) -- 0:00:27
536500 -- (-350.173) [-346.022] (-346.952) (-349.573) * [-347.128] (-347.891) (-345.895) (-347.382) -- 0:00:27
537000 -- (-348.196) (-345.888) [-345.703] (-346.262) * [-346.186] (-346.115) (-347.919) (-347.851) -- 0:00:27
537500 -- (-348.776) (-344.985) (-349.394) [-347.964] * [-346.779] (-347.091) (-345.994) (-346.051) -- 0:00:27
538000 -- (-347.936) [-346.229] (-347.725) (-349.754) * (-345.859) (-348.826) [-345.925] (-346.797) -- 0:00:27
538500 -- (-347.319) (-349.995) [-349.435] (-346.988) * (-351.392) (-347.808) (-348.811) [-345.572] -- 0:00:27
539000 -- (-346.824) [-347.795] (-354.478) (-344.968) * [-350.385] (-345.934) (-346.763) (-349.772) -- 0:00:27
539500 -- (-347.669) (-346.601) [-347.656] (-345.999) * (-347.957) [-345.869] (-348.082) (-347.552) -- 0:00:27
540000 -- (-345.862) [-348.436] (-347.043) (-352.910) * (-348.839) (-345.738) [-347.661] (-347.457) -- 0:00:27
Average standard deviation of split frequencies: 0.005987
540500 -- [-349.088] (-349.936) (-350.150) (-349.729) * (-363.378) (-347.657) [-350.622] (-346.803) -- 0:00:27
541000 -- [-346.147] (-346.629) (-347.551) (-349.581) * (-349.286) (-345.757) [-349.559] (-348.690) -- 0:00:27
541500 -- (-347.317) [-345.916] (-346.576) (-351.962) * (-348.554) (-345.512) (-349.549) [-345.456] -- 0:00:27
542000 -- (-345.164) (-350.980) [-346.132] (-346.324) * (-345.641) [-347.952] (-346.693) (-350.187) -- 0:00:27
542500 -- (-345.651) [-350.597] (-346.380) (-345.608) * (-348.242) (-347.320) (-353.972) [-347.448] -- 0:00:26
543000 -- (-348.186) [-348.422] (-349.627) (-347.349) * [-348.553] (-349.537) (-344.860) (-349.108) -- 0:00:26
543500 -- [-345.131] (-353.261) (-350.453) (-348.618) * (-348.704) [-348.092] (-345.011) (-348.419) -- 0:00:26
544000 -- (-348.471) (-347.118) [-345.227] (-346.657) * (-350.175) (-344.894) (-345.006) [-346.030] -- 0:00:26
544500 -- (-346.774) (-354.949) (-349.585) [-346.315] * (-345.285) [-345.503] (-345.412) (-346.342) -- 0:00:26
545000 -- (-347.687) [-347.185] (-351.641) (-346.763) * (-350.645) (-346.291) [-347.400] (-348.787) -- 0:00:26
Average standard deviation of split frequencies: 0.006331
545500 -- [-347.629] (-351.127) (-350.592) (-346.283) * (-348.025) [-346.173] (-346.832) (-345.576) -- 0:00:26
546000 -- [-345.608] (-348.655) (-349.555) (-346.979) * (-348.171) (-346.431) (-348.113) [-346.222] -- 0:00:26
546500 -- [-347.119] (-346.418) (-348.379) (-345.735) * (-348.299) (-347.913) [-346.742] (-351.654) -- 0:00:26
547000 -- (-346.809) (-347.021) [-345.902] (-348.879) * [-348.502] (-346.459) (-347.143) (-346.805) -- 0:00:26
547500 -- [-346.571] (-348.882) (-346.994) (-351.277) * (-351.440) [-345.877] (-346.693) (-348.225) -- 0:00:26
548000 -- (-346.107) (-349.927) [-344.945] (-345.754) * (-348.335) [-346.897] (-346.891) (-347.868) -- 0:00:26
548500 -- (-345.733) [-345.562] (-345.084) (-348.673) * (-349.478) [-347.515] (-346.721) (-348.131) -- 0:00:26
549000 -- (-344.817) (-347.451) [-348.057] (-349.901) * (-347.135) [-349.503] (-347.274) (-346.461) -- 0:00:26
549500 -- (-345.852) (-348.251) [-347.658] (-349.254) * (-345.495) (-350.250) (-348.268) [-345.554] -- 0:00:26
550000 -- [-346.856] (-348.167) (-345.915) (-348.750) * (-346.993) [-350.285] (-349.148) (-345.362) -- 0:00:26
Average standard deviation of split frequencies: 0.005992
550500 -- [-346.938] (-349.018) (-344.960) (-345.269) * (-347.148) (-345.163) (-348.306) [-348.822] -- 0:00:26
551000 -- (-345.996) (-349.688) (-345.621) [-346.977] * (-346.149) (-348.012) (-345.052) [-344.675] -- 0:00:26
551500 -- (-347.814) (-346.156) [-350.214] (-344.895) * (-347.460) (-349.556) (-347.229) [-348.158] -- 0:00:26
552000 -- (-347.264) (-348.908) (-346.392) [-346.440] * (-346.849) (-347.872) [-345.336] (-347.386) -- 0:00:26
552500 -- (-353.004) (-347.032) (-347.422) [-348.489] * (-345.964) (-350.318) [-345.780] (-345.718) -- 0:00:26
553000 -- (-352.117) (-347.485) [-348.394] (-345.911) * [-345.230] (-347.643) (-345.832) (-347.918) -- 0:00:26
553500 -- (-352.471) (-346.801) (-346.507) [-345.471] * (-347.529) (-350.038) [-349.032] (-347.699) -- 0:00:26
554000 -- (-346.957) (-346.210) [-347.661] (-350.612) * (-348.563) (-350.286) [-348.660] (-352.452) -- 0:00:26
554500 -- (-347.801) (-351.262) [-347.118] (-349.165) * [-347.137] (-347.271) (-346.688) (-348.096) -- 0:00:26
555000 -- [-345.706] (-346.162) (-348.061) (-348.819) * (-346.127) [-345.723] (-348.999) (-348.644) -- 0:00:26
Average standard deviation of split frequencies: 0.006161
555500 -- (-348.502) (-346.668) [-345.715] (-349.384) * [-346.757] (-345.285) (-346.918) (-350.197) -- 0:00:26
556000 -- [-348.801] (-345.213) (-353.480) (-347.057) * (-350.042) [-347.213] (-346.536) (-348.685) -- 0:00:26
556500 -- (-349.904) [-346.185] (-349.590) (-346.653) * (-347.857) (-345.462) (-347.358) [-346.190] -- 0:00:26
557000 -- (-346.014) [-346.970] (-350.896) (-349.015) * (-348.943) (-347.809) (-345.550) [-345.926] -- 0:00:26
557500 -- (-348.650) (-346.542) [-346.911] (-350.614) * (-350.249) [-347.014] (-345.436) (-345.877) -- 0:00:26
558000 -- (-346.918) (-348.416) (-349.043) [-349.659] * (-345.783) (-346.445) [-347.620] (-349.824) -- 0:00:26
558500 -- (-350.467) (-346.789) [-347.244] (-353.201) * (-347.057) (-346.341) (-347.010) [-346.623] -- 0:00:26
559000 -- [-345.726] (-346.901) (-351.952) (-346.804) * [-346.117] (-348.242) (-348.785) (-349.314) -- 0:00:26
559500 -- [-347.491] (-345.389) (-345.965) (-347.373) * [-346.692] (-349.389) (-347.742) (-349.169) -- 0:00:25
560000 -- (-347.459) (-347.080) (-351.960) [-345.045] * [-345.633] (-347.039) (-346.959) (-353.567) -- 0:00:25
Average standard deviation of split frequencies: 0.005661
560500 -- (-347.697) (-346.487) [-349.756] (-347.586) * [-346.494] (-345.932) (-345.965) (-349.343) -- 0:00:25
561000 -- (-350.949) [-348.606] (-348.592) (-348.370) * [-345.869] (-346.933) (-345.907) (-347.889) -- 0:00:25
561500 -- (-347.777) (-346.741) [-345.849] (-349.302) * [-347.027] (-349.523) (-348.769) (-347.476) -- 0:00:25
562000 -- (-346.752) (-347.009) (-346.054) [-345.641] * (-348.416) (-348.254) (-347.607) [-345.116] -- 0:00:25
562500 -- (-347.061) (-347.032) [-347.304] (-347.055) * (-346.417) [-349.665] (-347.474) (-349.563) -- 0:00:25
563000 -- (-347.936) (-347.175) [-347.205] (-347.141) * (-346.295) (-349.776) (-345.892) [-345.097] -- 0:00:25
563500 -- (-347.684) (-347.076) [-347.559] (-349.375) * [-348.188] (-350.765) (-347.225) (-345.057) -- 0:00:25
564000 -- (-345.150) (-347.958) (-345.300) [-346.926] * [-348.804] (-351.328) (-347.678) (-346.307) -- 0:00:25
564500 -- (-349.636) (-349.241) (-348.796) [-347.753] * (-346.802) [-345.465] (-345.814) (-350.003) -- 0:00:25
565000 -- [-348.227] (-348.046) (-345.342) (-348.531) * (-346.120) (-345.670) (-347.165) [-348.476] -- 0:00:25
Average standard deviation of split frequencies: 0.005664
565500 -- [-351.653] (-346.863) (-347.276) (-346.533) * (-349.975) (-351.744) (-347.604) [-347.828] -- 0:00:25
566000 -- (-347.867) [-346.478] (-346.942) (-345.417) * (-345.711) (-350.810) [-347.898] (-345.071) -- 0:00:25
566500 -- (-347.565) (-348.126) (-346.847) [-347.448] * (-348.285) (-347.083) (-345.699) [-346.795] -- 0:00:25
567000 -- (-347.462) (-347.298) [-347.677] (-348.037) * (-350.008) [-349.404] (-347.243) (-345.679) -- 0:00:25
567500 -- (-348.668) (-346.859) [-346.514] (-349.915) * (-346.241) (-346.472) (-349.175) [-346.247] -- 0:00:25
568000 -- (-350.532) (-346.575) [-348.572] (-350.682) * (-346.004) (-346.160) [-347.176] (-349.308) -- 0:00:25
568500 -- (-347.686) [-346.965] (-346.124) (-345.861) * (-347.536) (-347.441) [-346.586] (-345.925) -- 0:00:25
569000 -- [-345.593] (-347.959) (-347.076) (-348.181) * (-345.807) [-350.350] (-348.383) (-348.333) -- 0:00:25
569500 -- [-346.714] (-345.181) (-346.335) (-350.266) * (-349.139) (-346.624) [-345.235] (-346.605) -- 0:00:25
570000 -- (-347.921) (-345.134) [-348.635] (-347.810) * (-351.174) (-345.995) [-346.553] (-345.758) -- 0:00:25
Average standard deviation of split frequencies: 0.005893
570500 -- [-347.887] (-347.843) (-348.815) (-346.871) * [-349.585] (-348.961) (-346.140) (-348.474) -- 0:00:25
571000 -- (-349.148) [-346.102] (-348.923) (-347.422) * (-347.193) [-347.959] (-349.501) (-347.143) -- 0:00:25
571500 -- (-348.032) (-346.325) (-354.337) [-345.514] * (-351.954) (-350.680) [-349.766] (-346.707) -- 0:00:25
572000 -- (-346.661) [-346.788] (-348.395) (-348.134) * (-345.897) (-351.251) (-346.011) [-346.347] -- 0:00:25
572500 -- (-346.492) (-347.495) [-345.882] (-349.769) * [-347.100] (-354.440) (-346.026) (-351.291) -- 0:00:25
573000 -- (-345.637) (-349.183) [-347.601] (-347.227) * (-351.603) (-352.099) [-346.413] (-347.318) -- 0:00:25
573500 -- (-345.980) [-349.016] (-350.425) (-347.575) * [-346.401] (-353.687) (-347.718) (-347.867) -- 0:00:25
574000 -- (-345.947) (-345.039) (-350.138) [-348.051] * (-346.338) [-346.659] (-345.904) (-347.705) -- 0:00:25
574500 -- (-347.179) (-345.967) (-347.941) [-345.922] * (-346.076) (-346.607) (-345.571) [-345.688] -- 0:00:25
575000 -- (-348.195) (-346.362) [-345.292] (-345.902) * (-350.626) (-345.521) [-345.465] (-351.680) -- 0:00:25
Average standard deviation of split frequencies: 0.006002
575500 -- (-348.825) (-345.465) [-345.326] (-351.333) * (-351.322) (-349.845) [-346.855] (-347.719) -- 0:00:25
576000 -- [-346.690] (-346.172) (-345.409) (-348.719) * (-348.550) (-345.875) [-346.933] (-346.321) -- 0:00:25
576500 -- [-348.230] (-345.975) (-348.869) (-348.650) * (-352.191) (-347.409) [-345.861] (-347.219) -- 0:00:24
577000 -- (-348.474) (-345.728) [-348.443] (-348.191) * [-347.627] (-346.996) (-347.732) (-346.237) -- 0:00:24
577500 -- (-351.605) (-349.063) (-346.820) [-347.308] * (-349.763) (-346.083) [-350.725] (-347.834) -- 0:00:24
578000 -- [-346.535] (-348.407) (-350.084) (-349.680) * (-349.541) (-347.735) [-348.095] (-345.813) -- 0:00:24
578500 -- [-348.020] (-347.177) (-348.487) (-347.838) * [-346.057] (-349.842) (-345.800) (-346.546) -- 0:00:24
579000 -- (-350.172) (-345.226) [-345.889] (-345.043) * (-346.921) (-346.586) (-345.312) [-346.149] -- 0:00:24
579500 -- (-347.464) (-345.432) (-346.256) [-346.855] * (-346.797) (-346.162) (-352.510) [-346.636] -- 0:00:24
580000 -- [-348.879] (-345.525) (-345.885) (-345.945) * (-346.770) [-346.589] (-345.715) (-346.428) -- 0:00:24
Average standard deviation of split frequencies: 0.006444
580500 -- [-347.726] (-351.198) (-346.891) (-349.587) * [-346.557] (-350.487) (-345.767) (-352.856) -- 0:00:24
581000 -- [-347.142] (-345.549) (-347.135) (-346.087) * [-348.901] (-345.993) (-345.823) (-349.448) -- 0:00:24
581500 -- [-347.609] (-347.030) (-347.870) (-346.016) * [-347.488] (-348.848) (-347.298) (-347.418) -- 0:00:24
582000 -- (-349.316) (-349.675) [-347.328] (-348.333) * (-347.052) (-351.026) [-345.407] (-347.699) -- 0:00:24
582500 -- [-345.986] (-347.352) (-348.134) (-351.253) * (-346.714) [-349.727] (-346.474) (-349.489) -- 0:00:24
583000 -- (-348.544) (-350.522) (-345.316) [-350.648] * (-346.744) (-349.463) [-347.958] (-346.103) -- 0:00:24
583500 -- (-345.601) (-346.664) (-346.165) [-346.324] * [-348.093] (-346.911) (-347.911) (-347.308) -- 0:00:24
584000 -- (-346.261) (-350.020) [-347.585] (-345.792) * (-346.412) (-350.480) (-347.685) [-346.988] -- 0:00:24
584500 -- [-345.722] (-348.301) (-350.565) (-347.524) * (-350.551) (-350.700) [-349.257] (-349.151) -- 0:00:24
585000 -- [-346.279] (-346.510) (-347.733) (-346.208) * (-345.521) (-350.630) (-347.018) [-346.714] -- 0:00:24
Average standard deviation of split frequencies: 0.006530
585500 -- (-348.865) (-346.770) [-345.918] (-347.378) * [-344.943] (-347.941) (-348.842) (-346.354) -- 0:00:24
586000 -- [-348.813] (-346.803) (-347.424) (-348.612) * (-345.316) (-350.051) (-346.110) [-345.508] -- 0:00:24
586500 -- (-346.667) [-346.808] (-345.600) (-347.316) * [-347.427] (-348.709) (-349.927) (-347.570) -- 0:00:24
587000 -- (-347.981) (-348.180) (-346.179) [-345.384] * (-349.867) (-346.475) (-345.356) [-347.837] -- 0:00:24
587500 -- (-349.525) [-347.224] (-345.767) (-352.536) * [-346.778] (-350.839) (-349.970) (-347.819) -- 0:00:24
588000 -- (-347.375) (-347.445) [-347.175] (-350.531) * (-345.459) (-346.195) [-348.815] (-348.314) -- 0:00:24
588500 -- [-345.849] (-345.920) (-346.369) (-346.578) * [-351.138] (-346.929) (-345.398) (-348.971) -- 0:00:24
589000 -- [-345.532] (-347.827) (-347.089) (-345.518) * [-346.262] (-350.535) (-350.309) (-349.254) -- 0:00:24
589500 -- (-345.331) (-349.986) [-345.290] (-345.223) * [-347.874] (-345.836) (-346.636) (-346.430) -- 0:00:24
590000 -- [-345.668] (-350.452) (-348.826) (-351.884) * (-346.795) (-347.120) (-347.699) [-350.760] -- 0:00:24
Average standard deviation of split frequencies: 0.005821
590500 -- (-347.590) [-345.096] (-352.941) (-346.325) * [-346.683] (-347.318) (-346.058) (-345.953) -- 0:00:24
591000 -- (-348.644) (-349.441) (-349.036) [-350.045] * [-346.434] (-348.403) (-347.288) (-345.274) -- 0:00:24
591500 -- (-349.337) (-346.637) (-347.662) [-349.273] * [-346.213] (-348.148) (-347.126) (-345.981) -- 0:00:24
592000 -- (-346.225) (-348.824) (-347.541) [-345.841] * (-345.885) [-346.508] (-345.958) (-345.927) -- 0:00:24
592500 -- (-347.323) (-347.803) (-347.163) [-348.594] * (-346.121) (-348.192) (-346.460) [-347.790] -- 0:00:24
593000 -- [-346.332] (-347.561) (-346.681) (-348.265) * (-348.336) (-353.253) (-346.027) [-353.410] -- 0:00:24
593500 -- (-345.984) (-347.072) (-346.663) [-349.984] * [-346.439] (-348.640) (-352.141) (-345.747) -- 0:00:23
594000 -- (-345.165) [-347.933] (-349.988) (-346.363) * (-345.074) [-345.978] (-348.126) (-346.046) -- 0:00:23
594500 -- (-345.216) (-345.480) (-350.311) [-345.901] * [-345.772] (-345.616) (-351.695) (-348.959) -- 0:00:23
595000 -- [-345.821] (-346.221) (-348.942) (-346.861) * (-347.311) (-346.402) (-346.040) [-347.168] -- 0:00:23
Average standard deviation of split frequencies: 0.005438
595500 -- (-347.285) [-345.344] (-345.981) (-345.563) * (-347.523) (-350.173) (-347.780) [-346.935] -- 0:00:23
596000 -- (-346.208) [-346.255] (-346.044) (-346.214) * [-347.523] (-353.293) (-346.456) (-350.856) -- 0:00:23
596500 -- [-345.907] (-347.462) (-348.121) (-345.897) * (-346.936) [-348.568] (-346.943) (-353.222) -- 0:00:23
597000 -- (-347.227) (-345.901) [-350.393] (-352.313) * (-349.990) (-346.517) [-347.294] (-350.915) -- 0:00:23
597500 -- (-347.055) (-346.997) [-346.427] (-347.453) * (-350.206) (-347.402) (-346.807) [-345.459] -- 0:00:23
598000 -- [-347.496] (-345.713) (-348.001) (-345.780) * [-347.325] (-346.995) (-349.254) (-347.478) -- 0:00:23
598500 -- [-345.887] (-346.362) (-345.555) (-345.638) * (-345.491) [-345.115] (-351.394) (-347.912) -- 0:00:23
599000 -- (-351.666) (-345.538) (-345.818) [-347.293] * [-345.371] (-345.814) (-347.525) (-345.931) -- 0:00:23
599500 -- (-346.199) [-346.195] (-345.565) (-347.782) * (-345.439) (-345.841) (-347.098) [-345.538] -- 0:00:23
600000 -- (-346.985) [-345.841] (-349.029) (-346.948) * (-346.479) [-345.595] (-347.704) (-347.822) -- 0:00:23
Average standard deviation of split frequencies: 0.005632
600500 -- (-347.542) [-346.445] (-347.031) (-350.137) * (-347.234) [-344.895] (-349.465) (-345.913) -- 0:00:23
601000 -- [-349.485] (-347.946) (-345.204) (-350.162) * (-347.462) (-348.554) [-348.838] (-345.721) -- 0:00:23
601500 -- (-349.604) (-346.838) [-346.873] (-347.648) * (-345.791) (-346.918) (-348.832) [-347.020] -- 0:00:23
602000 -- (-346.985) (-346.746) [-345.633] (-347.186) * [-347.659] (-347.468) (-347.508) (-348.612) -- 0:00:23
602500 -- (-346.635) [-348.723] (-347.273) (-346.441) * [-347.719] (-347.860) (-352.956) (-353.312) -- 0:00:23
603000 -- [-348.250] (-347.927) (-348.225) (-346.361) * (-347.400) (-350.169) (-344.934) [-346.374] -- 0:00:23
603500 -- (-346.595) [-349.040] (-345.842) (-348.553) * [-350.565] (-346.756) (-347.386) (-345.230) -- 0:00:23
604000 -- (-348.874) (-346.795) [-347.586] (-348.231) * (-349.213) (-350.813) (-348.227) [-346.990] -- 0:00:23
604500 -- [-348.528] (-346.459) (-349.697) (-348.953) * [-346.909] (-348.120) (-347.412) (-346.974) -- 0:00:23
605000 -- (-345.573) [-345.872] (-349.724) (-353.317) * [-347.920] (-346.461) (-347.634) (-345.305) -- 0:00:23
Average standard deviation of split frequencies: 0.006050
605500 -- (-350.352) [-346.328] (-346.749) (-347.328) * (-347.661) (-346.749) [-347.411] (-346.788) -- 0:00:23
606000 -- (-347.974) (-346.754) (-349.063) [-347.376] * [-346.473] (-346.576) (-347.020) (-346.500) -- 0:00:23
606500 -- (-348.465) (-345.744) (-346.914) [-351.326] * [-348.204] (-347.106) (-346.221) (-350.045) -- 0:00:23
607000 -- (-347.426) (-348.306) [-345.275] (-350.212) * (-349.739) (-346.471) [-346.493] (-348.945) -- 0:00:23
607500 -- [-346.101] (-347.496) (-347.500) (-348.755) * (-346.548) [-350.262] (-346.440) (-347.258) -- 0:00:23
608000 -- (-347.249) [-346.875] (-346.768) (-345.711) * (-351.452) [-345.672] (-349.751) (-345.225) -- 0:00:23
608500 -- (-347.330) [-345.227] (-346.592) (-345.772) * (-345.012) [-346.934] (-345.797) (-348.124) -- 0:00:23
609000 -- (-345.914) [-345.409] (-348.594) (-345.912) * (-345.209) [-347.162] (-347.829) (-351.074) -- 0:00:23
609500 -- [-347.806] (-349.086) (-347.626) (-347.505) * (-346.104) (-346.654) [-346.507] (-350.543) -- 0:00:23
610000 -- (-346.228) (-347.102) (-347.498) [-348.785] * [-348.104] (-350.675) (-347.676) (-350.327) -- 0:00:23
Average standard deviation of split frequencies: 0.006176
610500 -- (-347.491) (-347.841) [-346.415] (-348.095) * (-347.819) (-348.501) (-347.265) [-347.086] -- 0:00:22
611000 -- [-346.965] (-346.277) (-346.556) (-345.812) * (-349.826) [-347.537] (-346.548) (-346.184) -- 0:00:22
611500 -- (-347.784) (-347.303) (-347.802) [-347.463] * [-345.749] (-348.252) (-348.740) (-345.964) -- 0:00:22
612000 -- (-346.061) (-348.687) [-347.825] (-350.621) * (-345.443) (-353.772) (-348.935) [-346.419] -- 0:00:22
612500 -- (-349.532) (-347.243) [-346.619] (-347.365) * (-347.225) (-349.815) [-350.895] (-348.523) -- 0:00:22
613000 -- (-345.226) (-348.685) (-346.616) [-349.691] * [-345.611] (-347.572) (-350.151) (-348.532) -- 0:00:22
613500 -- (-349.433) (-349.980) [-347.074] (-346.003) * (-348.681) (-347.934) [-348.000] (-349.089) -- 0:00:22
614000 -- (-349.625) [-347.046] (-347.831) (-346.615) * [-346.689] (-346.803) (-351.316) (-347.232) -- 0:00:22
614500 -- (-349.929) [-346.787] (-348.884) (-348.862) * [-346.969] (-351.656) (-346.173) (-351.019) -- 0:00:22
615000 -- (-346.593) (-345.917) [-348.487] (-348.792) * (-348.499) (-348.019) (-345.148) [-354.296] -- 0:00:22
Average standard deviation of split frequencies: 0.005762
615500 -- (-345.713) (-345.824) (-347.797) [-347.054] * (-346.665) (-347.984) [-346.996] (-349.217) -- 0:00:22
616000 -- (-347.146) [-345.949] (-349.698) (-346.118) * (-352.054) (-346.355) (-346.695) [-346.008] -- 0:00:22
616500 -- [-347.988] (-346.706) (-350.640) (-345.801) * (-348.097) (-348.541) (-349.965) [-345.033] -- 0:00:22
617000 -- (-350.173) [-346.589] (-349.704) (-347.041) * (-349.407) (-346.851) (-355.439) [-346.425] -- 0:00:22
617500 -- (-348.222) [-348.664] (-349.340) (-347.445) * (-346.987) (-348.563) (-349.252) [-347.037] -- 0:00:22
618000 -- (-346.602) (-349.375) (-347.147) [-346.453] * (-345.999) (-345.692) [-346.147] (-345.156) -- 0:00:22
618500 -- (-348.580) (-349.496) (-346.460) [-349.106] * [-346.477] (-348.850) (-347.557) (-347.102) -- 0:00:22
619000 -- (-347.851) (-349.224) [-352.464] (-347.123) * (-346.632) [-348.264] (-349.559) (-347.853) -- 0:00:22
619500 -- (-349.766) [-346.905] (-351.502) (-347.661) * (-347.598) (-346.067) [-347.245] (-353.792) -- 0:00:22
620000 -- (-349.492) (-348.624) [-349.686] (-347.836) * (-348.044) (-346.246) [-346.267] (-346.308) -- 0:00:22
Average standard deviation of split frequencies: 0.006121
620500 -- [-345.486] (-345.873) (-347.982) (-346.143) * (-349.903) (-350.797) [-345.052] (-351.314) -- 0:00:22
621000 -- (-347.983) (-347.034) (-347.702) [-346.568] * (-346.927) (-347.046) [-348.554] (-348.706) -- 0:00:22
621500 -- [-345.918] (-347.572) (-348.055) (-347.746) * (-346.928) (-346.895) (-347.572) [-347.520] -- 0:00:22
622000 -- [-346.194] (-347.328) (-345.097) (-349.866) * (-348.905) (-345.730) (-350.682) [-346.177] -- 0:00:22
622500 -- (-346.286) [-345.228] (-347.009) (-345.342) * (-347.239) (-346.867) (-348.067) [-344.935] -- 0:00:22
623000 -- (-347.463) (-348.551) [-345.113] (-345.823) * (-348.148) (-347.363) (-347.276) [-346.458] -- 0:00:22
623500 -- [-348.916] (-353.570) (-346.605) (-346.815) * [-346.032] (-345.587) (-346.977) (-347.467) -- 0:00:22
624000 -- (-344.803) [-347.190] (-345.970) (-350.708) * (-347.110) [-346.428] (-349.153) (-349.351) -- 0:00:22
624500 -- [-345.769] (-345.667) (-345.116) (-347.153) * (-347.216) (-347.033) [-345.234] (-346.172) -- 0:00:22
625000 -- [-345.337] (-346.288) (-346.051) (-345.835) * (-346.850) [-346.476] (-351.400) (-346.788) -- 0:00:22
Average standard deviation of split frequencies: 0.006202
625500 -- (-346.118) (-347.363) (-345.645) [-345.527] * (-352.148) (-344.982) (-349.753) [-346.797] -- 0:00:22
626000 -- [-345.574] (-347.700) (-347.708) (-346.599) * (-351.377) (-347.118) (-349.664) [-345.661] -- 0:00:22
626500 -- (-349.471) [-346.427] (-347.937) (-347.762) * [-348.720] (-346.183) (-350.441) (-347.748) -- 0:00:22
627000 -- [-346.755] (-351.345) (-349.894) (-346.569) * (-346.145) [-348.367] (-346.672) (-346.310) -- 0:00:22
627500 -- [-349.843] (-348.537) (-346.271) (-345.702) * (-345.833) (-346.415) [-346.257] (-349.348) -- 0:00:21
628000 -- (-347.166) (-348.720) [-345.664] (-348.385) * (-350.022) (-348.815) (-347.294) [-345.874] -- 0:00:21
628500 -- (-349.125) (-348.578) [-346.448] (-348.252) * (-351.013) (-354.916) [-346.323] (-347.916) -- 0:00:21
629000 -- (-345.315) (-351.452) (-345.592) [-346.204] * (-348.178) (-350.550) [-348.938] (-349.703) -- 0:00:21
629500 -- (-346.227) (-354.998) (-346.147) [-346.511] * (-345.548) [-347.570] (-347.319) (-346.254) -- 0:00:21
630000 -- (-349.432) (-347.008) (-346.070) [-349.058] * (-345.492) [-345.106] (-345.927) (-347.379) -- 0:00:21
Average standard deviation of split frequencies: 0.005793
630500 -- (-345.729) (-346.611) [-345.711] (-348.805) * (-345.842) (-345.846) (-348.260) [-345.944] -- 0:00:21
631000 -- (-347.999) (-351.860) [-348.740] (-347.040) * (-347.060) (-346.187) (-345.660) [-347.914] -- 0:00:21
631500 -- (-350.676) (-349.048) [-348.050] (-347.281) * (-348.476) [-345.941] (-347.935) (-345.459) -- 0:00:21
632000 -- [-346.974] (-347.692) (-351.722) (-348.951) * (-351.724) (-345.382) [-346.236] (-345.963) -- 0:00:21
632500 -- (-347.956) (-345.694) [-345.042] (-350.060) * [-353.846] (-346.071) (-352.018) (-345.632) -- 0:00:21
633000 -- (-346.483) [-346.955] (-350.630) (-347.518) * (-347.316) (-347.154) [-349.593] (-347.182) -- 0:00:21
633500 -- (-346.012) (-345.290) [-347.243] (-349.153) * [-351.841] (-350.292) (-347.243) (-347.853) -- 0:00:21
634000 -- [-346.869] (-346.666) (-349.910) (-345.974) * [-346.160] (-351.025) (-348.084) (-350.875) -- 0:00:21
634500 -- (-347.484) [-352.094] (-349.201) (-347.815) * (-349.000) (-348.639) [-346.626] (-347.804) -- 0:00:21
635000 -- (-346.858) (-346.363) [-347.775] (-346.171) * (-347.233) (-348.032) (-347.177) [-345.863] -- 0:00:21
Average standard deviation of split frequencies: 0.006161
635500 -- (-348.140) (-349.696) (-348.673) [-346.637] * [-345.708] (-349.892) (-348.737) (-346.020) -- 0:00:21
636000 -- (-346.682) [-351.385] (-349.821) (-345.301) * [-345.770] (-348.450) (-349.155) (-349.729) -- 0:00:21
636500 -- (-345.176) [-350.780] (-346.413) (-348.500) * (-349.022) (-347.445) (-346.482) [-347.506] -- 0:00:21
637000 -- (-346.225) [-348.301] (-347.353) (-347.612) * (-345.350) (-353.510) (-348.381) [-347.078] -- 0:00:21
637500 -- (-346.836) (-347.166) [-346.737] (-354.115) * (-346.702) (-345.574) [-351.008] (-348.454) -- 0:00:21
638000 -- (-345.892) [-347.613] (-346.593) (-354.074) * (-345.467) (-347.275) (-346.163) [-347.232] -- 0:00:21
638500 -- (-346.752) (-348.456) [-346.540] (-349.541) * (-351.849) [-347.865] (-346.641) (-346.576) -- 0:00:21
639000 -- (-348.368) (-345.727) [-345.693] (-346.712) * (-347.536) (-347.730) [-345.386] (-346.883) -- 0:00:21
639500 -- (-350.371) (-348.714) (-347.962) [-346.569] * [-353.633] (-347.610) (-354.221) (-347.954) -- 0:00:21
640000 -- (-347.463) (-346.997) (-347.785) [-345.376] * [-350.190] (-349.172) (-348.940) (-347.749) -- 0:00:21
Average standard deviation of split frequencies: 0.006116
640500 -- (-351.514) [-348.104] (-346.797) (-345.182) * (-348.729) [-346.861] (-352.935) (-346.370) -- 0:00:21
641000 -- (-349.636) [-345.352] (-351.791) (-347.689) * (-347.706) (-352.909) (-348.825) [-347.351] -- 0:00:21
641500 -- (-346.461) (-345.930) (-346.678) [-346.424] * [-347.285] (-348.889) (-347.980) (-346.340) -- 0:00:21
642000 -- (-347.632) (-345.200) [-347.677] (-347.973) * [-345.538] (-346.094) (-345.952) (-347.473) -- 0:00:21
642500 -- (-350.344) [-345.634] (-346.203) (-347.279) * (-346.531) (-348.372) [-348.010] (-346.235) -- 0:00:21
643000 -- (-346.574) (-346.596) (-347.565) [-347.150] * (-345.130) [-346.713] (-345.583) (-346.569) -- 0:00:21
643500 -- (-345.444) (-346.582) (-348.479) [-347.109] * (-346.032) (-347.565) [-347.105] (-345.329) -- 0:00:21
644000 -- (-346.064) [-346.234] (-349.868) (-345.539) * [-347.464] (-348.483) (-347.222) (-345.518) -- 0:00:21
644500 -- [-353.112] (-345.321) (-347.229) (-345.995) * (-352.141) [-345.172] (-349.184) (-347.623) -- 0:00:20
645000 -- (-347.936) [-347.719] (-354.421) (-345.394) * (-352.147) (-351.801) [-348.064] (-346.760) -- 0:00:20
Average standard deviation of split frequencies: 0.005975
645500 -- (-348.231) (-347.189) (-346.401) [-346.041] * (-344.970) (-348.767) [-347.372] (-349.143) -- 0:00:20
646000 -- (-346.735) (-348.947) [-351.225] (-346.383) * (-346.175) [-346.421] (-345.831) (-352.491) -- 0:00:20
646500 -- (-347.706) (-349.404) (-347.030) [-345.636] * (-346.473) (-346.804) (-346.284) [-345.875] -- 0:00:20
647000 -- [-350.608] (-347.259) (-346.185) (-347.184) * (-347.510) (-346.842) [-349.232] (-346.602) -- 0:00:20
647500 -- (-346.546) (-345.121) [-344.947] (-346.298) * (-346.457) [-346.357] (-351.926) (-347.954) -- 0:00:20
648000 -- (-349.745) (-345.614) (-346.457) [-345.883] * (-347.446) (-346.850) (-349.785) [-351.219] -- 0:00:20
648500 -- (-348.314) (-346.059) [-346.595] (-346.835) * [-346.097] (-346.911) (-349.466) (-349.051) -- 0:00:20
649000 -- (-351.021) (-345.713) (-346.722) [-346.286] * [-345.165] (-345.594) (-347.722) (-349.649) -- 0:00:20
649500 -- (-348.370) [-346.836] (-346.399) (-345.967) * [-348.533] (-347.692) (-346.137) (-348.245) -- 0:00:20
650000 -- [-349.875] (-349.169) (-345.671) (-346.839) * [-348.274] (-348.748) (-347.073) (-347.069) -- 0:00:20
Average standard deviation of split frequencies: 0.005796
650500 -- (-346.380) (-351.126) [-347.096] (-347.509) * (-348.096) (-345.304) [-347.868] (-346.520) -- 0:00:20
651000 -- (-345.017) (-346.675) [-347.214] (-346.092) * (-348.112) (-346.515) [-345.889] (-345.290) -- 0:00:20
651500 -- (-347.895) (-347.319) [-345.429] (-346.427) * [-347.363] (-348.174) (-346.273) (-349.660) -- 0:00:20
652000 -- (-347.053) (-349.710) (-346.681) [-345.453] * [-345.270] (-345.475) (-347.737) (-347.873) -- 0:00:20
652500 -- (-346.558) (-347.835) (-346.137) [-345.231] * (-349.363) [-347.326] (-348.586) (-350.860) -- 0:00:20
653000 -- (-347.103) [-346.792] (-345.962) (-346.543) * [-348.942] (-346.820) (-347.462) (-349.162) -- 0:00:20
653500 -- (-347.911) (-346.954) (-346.257) [-345.737] * (-353.557) (-347.131) [-347.416] (-345.711) -- 0:00:20
654000 -- (-346.030) [-344.820] (-347.338) (-348.326) * (-347.240) (-348.314) [-346.049] (-348.548) -- 0:00:20
654500 -- (-345.939) (-345.611) (-346.923) [-348.147] * (-349.959) (-350.706) [-348.093] (-348.158) -- 0:00:20
655000 -- (-346.512) [-348.568] (-346.941) (-347.406) * (-347.769) (-347.809) (-350.915) [-345.551] -- 0:00:20
Average standard deviation of split frequencies: 0.006063
655500 -- (-346.345) (-350.286) [-348.587] (-346.519) * (-348.624) [-346.147] (-347.545) (-348.345) -- 0:00:20
656000 -- (-346.989) (-347.378) (-348.783) [-345.745] * (-348.045) [-349.416] (-348.757) (-347.096) -- 0:00:20
656500 -- [-349.644] (-348.503) (-346.171) (-347.009) * (-345.941) [-346.234] (-347.561) (-346.725) -- 0:00:20
657000 -- (-348.852) (-347.596) (-346.872) [-346.291] * [-345.854] (-348.364) (-348.219) (-349.320) -- 0:00:20
657500 -- (-349.823) (-345.769) [-348.180] (-346.354) * (-347.679) (-350.069) [-348.329] (-345.811) -- 0:00:20
658000 -- (-347.781) [-346.020] (-348.124) (-347.676) * (-351.704) (-346.001) [-346.434] (-347.301) -- 0:00:20
658500 -- (-347.692) (-346.945) (-346.661) [-349.673] * (-347.702) (-347.700) [-347.184] (-345.925) -- 0:00:20
659000 -- (-347.259) [-346.496] (-345.859) (-347.526) * (-348.280) (-345.955) (-346.133) [-346.294] -- 0:00:20
659500 -- [-347.849] (-347.374) (-345.907) (-345.738) * (-351.931) (-349.120) [-345.178] (-346.759) -- 0:00:20
660000 -- (-347.017) (-345.556) [-347.751] (-350.173) * (-347.940) [-347.368] (-345.011) (-348.127) -- 0:00:20
Average standard deviation of split frequencies: 0.006089
660500 -- [-353.145] (-348.244) (-350.261) (-346.473) * [-349.536] (-350.733) (-347.841) (-348.710) -- 0:00:20
661000 -- (-347.342) [-346.819] (-348.998) (-347.805) * [-345.462] (-346.924) (-346.126) (-347.912) -- 0:00:20
661500 -- (-346.847) (-350.486) (-345.167) [-348.058] * (-346.970) [-347.456] (-348.619) (-348.454) -- 0:00:19
662000 -- (-349.295) (-346.016) [-346.073] (-348.439) * (-347.067) (-346.622) (-347.254) [-350.080] -- 0:00:19
662500 -- [-346.350] (-347.279) (-347.282) (-345.683) * (-347.069) [-350.312] (-350.401) (-345.620) -- 0:00:19
663000 -- (-346.436) (-347.128) [-345.994] (-345.546) * (-346.567) (-349.950) (-349.884) [-346.659] -- 0:00:19
663500 -- [-346.620] (-352.267) (-347.403) (-346.077) * (-351.279) (-348.327) [-348.065] (-349.791) -- 0:00:19
664000 -- (-349.815) (-347.464) (-348.087) [-347.243] * [-349.063] (-345.762) (-347.706) (-352.344) -- 0:00:19
664500 -- (-345.631) (-348.169) [-345.752] (-348.661) * [-346.028] (-346.631) (-349.316) (-347.052) -- 0:00:19
665000 -- (-345.051) (-345.747) (-348.182) [-346.065] * [-345.451] (-345.640) (-345.064) (-348.529) -- 0:00:19
Average standard deviation of split frequencies: 0.006990
665500 -- (-348.849) (-347.516) [-348.609] (-348.379) * (-345.629) [-346.442] (-346.457) (-346.608) -- 0:00:19
666000 -- (-347.821) [-345.805] (-349.069) (-347.354) * [-345.542] (-346.417) (-350.563) (-347.210) -- 0:00:19
666500 -- (-348.849) (-348.873) (-348.716) [-349.334] * (-347.029) (-349.870) (-347.995) [-346.660] -- 0:00:19
667000 -- (-349.703) (-347.991) (-346.806) [-354.460] * (-347.743) [-348.797] (-348.194) (-348.805) -- 0:00:19
667500 -- (-348.784) (-345.378) [-346.344] (-348.481) * [-348.182] (-346.417) (-352.957) (-345.893) -- 0:00:19
668000 -- (-347.230) (-347.591) [-346.522] (-345.704) * [-346.215] (-348.389) (-348.411) (-351.162) -- 0:00:19
668500 -- (-346.218) [-349.181] (-345.729) (-346.270) * (-346.540) (-348.263) (-346.210) [-345.311] -- 0:00:19
669000 -- (-348.052) (-356.106) (-346.027) [-345.306] * [-347.731] (-346.016) (-346.296) (-346.106) -- 0:00:19
669500 -- (-345.616) (-357.201) [-345.302] (-347.772) * [-346.397] (-346.992) (-346.037) (-347.201) -- 0:00:19
670000 -- [-345.997] (-346.464) (-346.143) (-346.076) * (-345.897) (-349.365) (-347.067) [-348.464] -- 0:00:19
Average standard deviation of split frequencies: 0.006748
670500 -- (-348.585) (-350.776) (-346.170) [-347.601] * (-348.143) (-349.723) [-345.759] (-345.959) -- 0:00:19
671000 -- (-349.363) (-347.586) (-345.541) [-350.178] * [-346.992] (-347.489) (-344.867) (-346.116) -- 0:00:19
671500 -- [-348.131] (-347.749) (-344.852) (-346.605) * (-346.979) (-347.903) [-346.497] (-348.798) -- 0:00:19
672000 -- (-347.886) (-346.825) (-347.404) [-346.923] * [-347.429] (-349.053) (-346.134) (-347.165) -- 0:00:19
672500 -- [-349.982] (-347.788) (-349.997) (-351.280) * (-346.857) [-348.303] (-346.196) (-347.418) -- 0:00:19
673000 -- [-348.934] (-348.215) (-345.851) (-347.299) * (-346.016) [-346.600] (-347.849) (-350.636) -- 0:00:19
673500 -- (-350.193) [-347.872] (-348.744) (-348.891) * (-349.300) (-348.987) (-347.422) [-346.198] -- 0:00:19
674000 -- (-348.268) (-346.011) (-347.148) [-346.898] * [-348.157] (-347.858) (-347.667) (-346.811) -- 0:00:19
674500 -- [-348.485] (-349.346) (-348.838) (-346.091) * (-347.336) [-348.079] (-347.211) (-346.755) -- 0:00:19
675000 -- (-346.036) (-349.174) (-346.649) [-346.014] * (-348.807) (-347.222) [-346.470] (-347.573) -- 0:00:19
Average standard deviation of split frequencies: 0.006276
675500 -- (-345.659) (-350.228) (-348.338) [-350.046] * (-348.373) (-348.357) (-346.337) [-347.351] -- 0:00:19
676000 -- (-347.564) (-352.257) [-346.188] (-348.359) * (-347.910) (-345.536) (-345.855) [-347.749] -- 0:00:19
676500 -- (-344.873) (-348.472) [-349.027] (-347.322) * (-346.275) (-349.175) (-346.777) [-345.954] -- 0:00:19
677000 -- [-345.089] (-347.987) (-347.397) (-345.681) * (-348.916) (-347.361) [-345.924] (-346.680) -- 0:00:19
677500 -- (-348.230) (-346.541) (-348.188) [-348.306] * [-348.710] (-348.478) (-349.388) (-347.388) -- 0:00:19
678000 -- [-348.754] (-350.288) (-349.354) (-346.268) * (-346.485) [-345.359] (-347.805) (-351.958) -- 0:00:18
678500 -- [-347.905] (-347.941) (-348.371) (-345.871) * (-346.687) [-345.174] (-347.687) (-351.396) -- 0:00:18
679000 -- (-346.532) [-345.835] (-346.530) (-345.459) * (-346.379) [-345.856] (-348.318) (-346.471) -- 0:00:18
679500 -- (-346.292) [-345.973] (-350.529) (-347.245) * (-349.747) [-352.334] (-346.172) (-346.342) -- 0:00:18
680000 -- (-347.849) [-346.170] (-350.473) (-346.513) * (-346.576) (-346.921) (-346.621) [-345.944] -- 0:00:18
Average standard deviation of split frequencies: 0.006787
680500 -- (-345.553) (-346.918) [-351.605] (-345.205) * (-347.457) (-346.984) [-350.639] (-346.968) -- 0:00:18
681000 -- (-345.804) [-346.135] (-349.706) (-347.074) * [-347.241] (-351.436) (-349.989) (-346.563) -- 0:00:18
681500 -- (-345.652) [-344.963] (-351.305) (-351.934) * [-345.106] (-347.325) (-352.345) (-349.033) -- 0:00:18
682000 -- (-346.879) (-345.533) [-347.363] (-347.867) * [-344.958] (-345.850) (-349.814) (-346.752) -- 0:00:18
682500 -- (-346.501) (-345.861) [-346.741] (-345.291) * (-345.549) [-347.262] (-355.640) (-346.615) -- 0:00:18
683000 -- (-347.401) [-345.770] (-347.683) (-348.331) * [-345.685] (-347.314) (-345.741) (-345.862) -- 0:00:18
683500 -- (-350.111) (-346.122) (-345.480) [-350.354] * (-345.864) (-347.663) (-346.523) [-346.940] -- 0:00:18
684000 -- [-353.925] (-345.722) (-346.986) (-349.704) * [-347.512] (-345.753) (-347.063) (-346.088) -- 0:00:18
684500 -- (-352.809) (-346.290) [-346.415] (-347.122) * (-347.504) (-346.443) [-346.819] (-347.392) -- 0:00:18
685000 -- (-352.023) (-349.685) [-346.575] (-345.433) * (-348.844) (-350.266) (-349.174) [-346.594] -- 0:00:18
Average standard deviation of split frequencies: 0.007192
685500 -- (-346.537) (-346.845) (-346.396) [-348.250] * (-345.566) [-347.012] (-348.838) (-349.648) -- 0:00:18
686000 -- (-346.097) (-348.724) (-348.114) [-351.801] * (-349.019) [-349.099] (-351.104) (-348.069) -- 0:00:18
686500 -- (-349.114) (-347.557) [-346.834] (-346.505) * [-348.230] (-346.651) (-346.932) (-344.658) -- 0:00:18
687000 -- (-346.951) (-347.978) (-347.764) [-347.462] * [-346.335] (-346.264) (-345.779) (-347.379) -- 0:00:18
687500 -- (-349.606) [-346.077] (-347.426) (-346.119) * (-349.035) [-345.419] (-346.775) (-346.768) -- 0:00:18
688000 -- [-346.295] (-350.953) (-347.449) (-347.278) * (-349.827) (-345.396) (-345.236) [-345.827] -- 0:00:18
688500 -- (-349.072) [-348.425] (-347.473) (-346.890) * (-353.134) [-345.612] (-346.930) (-346.924) -- 0:00:18
689000 -- (-347.899) [-346.461] (-347.213) (-347.827) * (-350.181) (-346.584) [-347.390] (-351.482) -- 0:00:18
689500 -- (-346.472) [-347.145] (-345.626) (-346.824) * (-348.946) (-349.182) [-347.720] (-347.326) -- 0:00:18
690000 -- (-347.239) (-347.585) [-346.789] (-347.149) * (-347.154) [-346.625] (-347.493) (-353.009) -- 0:00:18
Average standard deviation of split frequencies: 0.007189
690500 -- [-345.933] (-344.992) (-346.625) (-348.490) * (-346.293) (-348.136) [-348.311] (-345.843) -- 0:00:18
691000 -- (-349.742) [-346.298] (-346.272) (-347.447) * (-344.795) (-349.374) (-349.124) [-348.584] -- 0:00:18
691500 -- [-347.868] (-350.012) (-348.151) (-346.007) * (-346.698) [-347.002] (-347.250) (-346.299) -- 0:00:18
692000 -- (-345.556) (-347.711) (-346.188) [-345.796] * (-344.890) [-347.337] (-345.393) (-347.754) -- 0:00:18
692500 -- [-345.756] (-346.112) (-345.920) (-347.396) * [-346.737] (-352.324) (-347.150) (-345.595) -- 0:00:18
693000 -- [-345.774] (-348.514) (-347.530) (-346.349) * (-347.923) [-345.331] (-345.802) (-348.813) -- 0:00:18
693500 -- [-345.606] (-346.915) (-348.293) (-346.832) * (-347.971) (-345.685) (-347.827) [-345.573] -- 0:00:18
694000 -- [-346.041] (-346.434) (-346.852) (-347.374) * [-347.148] (-345.890) (-348.051) (-345.988) -- 0:00:18
694500 -- (-345.636) (-349.767) (-346.588) [-345.919] * [-347.783] (-346.266) (-346.710) (-347.276) -- 0:00:18
695000 -- [-346.128] (-347.839) (-351.342) (-346.019) * (-346.189) (-348.160) [-345.631] (-346.845) -- 0:00:17
Average standard deviation of split frequencies: 0.007662
695500 -- [-348.890] (-357.243) (-346.307) (-345.799) * [-348.808] (-348.088) (-348.630) (-346.370) -- 0:00:17
696000 -- [-345.919] (-356.161) (-346.046) (-345.568) * (-348.228) (-352.275) [-348.115] (-345.303) -- 0:00:17
696500 -- (-346.628) (-348.698) (-346.203) [-345.417] * (-348.131) [-346.522] (-346.516) (-347.960) -- 0:00:17
697000 -- (-346.315) (-345.880) [-345.565] (-347.330) * [-345.779] (-346.517) (-346.735) (-347.563) -- 0:00:17
697500 -- (-345.393) (-346.918) (-349.095) [-348.170] * (-348.759) (-346.098) (-348.756) [-347.235] -- 0:00:17
698000 -- [-346.229] (-346.066) (-346.977) (-346.731) * (-345.879) [-347.173] (-348.618) (-347.559) -- 0:00:17
698500 -- (-347.824) [-347.106] (-347.312) (-346.524) * [-347.028] (-347.416) (-346.792) (-344.923) -- 0:00:17
699000 -- (-345.656) [-350.930] (-346.107) (-345.292) * [-346.919] (-347.629) (-348.975) (-345.296) -- 0:00:17
699500 -- (-344.866) (-345.422) (-346.758) [-347.295] * (-345.140) (-348.663) (-348.497) [-347.995] -- 0:00:17
700000 -- (-347.378) (-346.416) [-346.608] (-347.307) * (-346.356) (-349.597) (-346.543) [-346.560] -- 0:00:17
Average standard deviation of split frequencies: 0.006818
700500 -- (-345.648) (-347.954) (-346.018) [-344.815] * [-346.988] (-348.847) (-347.810) (-349.023) -- 0:00:17
701000 -- (-347.946) (-349.928) [-346.029] (-345.273) * (-348.681) [-347.562] (-346.317) (-347.828) -- 0:00:17
701500 -- (-347.794) (-347.241) [-348.457] (-345.415) * [-346.484] (-345.646) (-347.687) (-345.252) -- 0:00:17
702000 -- (-351.629) (-348.136) [-347.593] (-346.638) * [-347.008] (-345.636) (-350.010) (-348.463) -- 0:00:17
702500 -- (-348.289) [-346.051] (-349.261) (-348.514) * (-346.371) [-346.742] (-345.790) (-347.372) -- 0:00:17
703000 -- (-346.421) (-347.568) [-347.251] (-348.290) * (-345.748) (-352.142) (-346.859) [-346.108] -- 0:00:17
703500 -- [-347.208] (-349.465) (-348.645) (-347.736) * (-346.539) [-347.253] (-346.190) (-346.482) -- 0:00:17
704000 -- (-346.068) [-347.263] (-346.544) (-348.577) * (-346.831) (-345.092) [-349.788] (-350.943) -- 0:00:17
704500 -- (-346.239) [-345.123] (-346.768) (-348.328) * (-347.277) [-347.094] (-347.641) (-349.459) -- 0:00:17
705000 -- (-346.610) (-347.915) [-345.557] (-353.134) * [-348.972] (-348.502) (-350.191) (-350.056) -- 0:00:17
Average standard deviation of split frequencies: 0.006989
705500 -- (-347.373) [-345.142] (-349.864) (-347.034) * (-346.738) (-347.016) (-345.070) [-348.098] -- 0:00:17
706000 -- [-347.687] (-347.266) (-351.545) (-349.030) * (-349.956) (-345.906) (-347.286) [-347.283] -- 0:00:17
706500 -- (-346.381) [-347.524] (-345.902) (-349.872) * (-349.316) [-345.574] (-346.377) (-345.608) -- 0:00:17
707000 -- (-350.134) [-345.161] (-348.495) (-350.259) * (-349.591) [-346.146] (-345.162) (-351.658) -- 0:00:17
707500 -- (-345.186) [-345.680] (-345.002) (-347.217) * [-351.604] (-347.458) (-345.492) (-348.373) -- 0:00:17
708000 -- (-345.296) [-345.036] (-346.777) (-348.053) * (-347.007) [-345.449] (-348.334) (-348.852) -- 0:00:17
708500 -- (-348.094) [-345.368] (-345.170) (-348.095) * [-345.976] (-345.288) (-346.995) (-347.519) -- 0:00:17
709000 -- (-351.820) [-346.282] (-345.770) (-346.152) * (-347.753) (-348.887) [-346.509] (-350.441) -- 0:00:17
709500 -- (-350.750) [-349.106] (-345.148) (-347.377) * (-353.687) (-347.990) (-345.456) [-345.736] -- 0:00:17
710000 -- (-350.403) (-349.509) [-345.697] (-351.792) * (-349.851) [-352.399] (-346.069) (-345.801) -- 0:00:17
Average standard deviation of split frequencies: 0.007031
710500 -- (-347.273) (-351.823) [-347.029] (-346.507) * (-349.460) (-346.541) (-348.939) [-348.817] -- 0:00:17
711000 -- (-346.713) (-347.667) (-346.598) [-346.989] * (-350.355) (-348.038) (-348.272) [-348.275] -- 0:00:17
711500 -- [-345.561] (-346.319) (-347.153) (-345.849) * [-349.795] (-349.238) (-347.985) (-348.814) -- 0:00:17
712000 -- [-345.267] (-346.414) (-350.294) (-346.366) * (-346.722) [-348.005] (-346.144) (-348.415) -- 0:00:16
712500 -- (-346.087) (-348.304) [-347.821] (-348.330) * (-346.171) (-348.450) [-345.168] (-350.236) -- 0:00:16
713000 -- [-345.820] (-346.741) (-348.630) (-346.371) * [-345.531] (-346.498) (-345.854) (-352.283) -- 0:00:16
713500 -- (-346.004) (-346.812) (-346.044) [-346.435] * (-348.846) (-348.323) [-346.429] (-347.409) -- 0:00:16
714000 -- (-345.275) (-349.518) [-345.357] (-346.432) * (-346.319) (-346.908) [-348.358] (-349.077) -- 0:00:16
714500 -- (-347.398) (-349.481) [-347.160] (-350.461) * (-346.465) [-345.009] (-345.621) (-347.439) -- 0:00:16
715000 -- [-346.003] (-346.283) (-346.087) (-348.949) * (-346.518) (-345.138) (-347.189) [-347.156] -- 0:00:16
Average standard deviation of split frequencies: 0.006935
715500 -- (-345.942) [-345.575] (-346.707) (-348.549) * [-346.582] (-346.078) (-345.459) (-345.093) -- 0:00:16
716000 -- [-349.664] (-346.647) (-345.217) (-347.740) * [-346.658] (-346.802) (-347.483) (-347.461) -- 0:00:16
716500 -- (-346.097) (-345.481) [-346.503] (-350.385) * (-346.795) [-350.002] (-346.208) (-347.576) -- 0:00:16
717000 -- (-348.571) (-347.020) [-348.117] (-347.223) * (-350.017) (-349.831) (-346.466) [-346.647] -- 0:00:16
717500 -- (-348.505) [-347.024] (-346.705) (-348.041) * (-347.868) (-351.363) (-346.129) [-346.940] -- 0:00:16
718000 -- (-348.104) [-349.084] (-346.653) (-349.638) * (-348.390) (-348.108) (-345.600) [-348.403] -- 0:00:16
718500 -- (-348.181) [-345.903] (-345.761) (-350.333) * [-346.185] (-352.664) (-345.217) (-345.776) -- 0:00:16
719000 -- (-347.856) (-346.010) [-345.544] (-345.709) * (-345.794) [-348.418] (-345.452) (-347.469) -- 0:00:16
719500 -- (-347.691) (-348.500) [-346.130] (-349.381) * (-345.756) [-347.881] (-346.758) (-345.433) -- 0:00:16
720000 -- (-348.311) (-347.842) (-346.761) [-347.562] * (-347.027) [-348.212] (-348.043) (-345.695) -- 0:00:16
Average standard deviation of split frequencies: 0.006018
720500 -- [-346.188] (-349.639) (-346.564) (-348.418) * (-348.292) [-347.159] (-347.969) (-347.804) -- 0:00:16
721000 -- (-346.963) (-353.962) (-347.604) [-345.701] * (-349.058) (-347.321) [-346.917] (-346.086) -- 0:00:16
721500 -- [-346.689] (-353.046) (-346.432) (-347.044) * (-349.728) [-345.006] (-351.652) (-346.329) -- 0:00:16
722000 -- (-348.319) (-345.378) (-346.691) [-345.234] * [-346.662] (-346.365) (-348.585) (-347.720) -- 0:00:16
722500 -- (-348.066) (-349.115) [-346.796] (-346.209) * (-346.989) (-347.065) [-346.811] (-353.949) -- 0:00:16
723000 -- (-347.283) (-347.481) [-351.094] (-347.018) * (-348.340) [-349.119] (-346.592) (-347.020) -- 0:00:16
723500 -- [-346.280] (-346.913) (-345.385) (-349.191) * (-346.743) (-349.012) (-347.602) [-345.908] -- 0:00:16
724000 -- (-350.520) [-346.283] (-347.278) (-349.306) * [-347.199] (-348.498) (-348.402) (-346.164) -- 0:00:16
724500 -- (-348.127) (-346.506) [-350.075] (-347.409) * (-348.906) [-346.627] (-347.435) (-345.750) -- 0:00:16
725000 -- [-346.367] (-346.018) (-346.532) (-348.802) * (-348.832) [-345.071] (-352.344) (-347.225) -- 0:00:16
Average standard deviation of split frequencies: 0.006250
725500 -- (-346.650) (-346.672) [-347.325] (-345.416) * [-349.234] (-351.274) (-349.033) (-347.676) -- 0:00:16
726000 -- [-347.781] (-347.195) (-351.624) (-345.143) * [-350.390] (-348.737) (-347.419) (-348.911) -- 0:00:16
726500 -- (-347.367) [-344.873] (-348.557) (-346.972) * (-348.068) (-348.227) [-346.113] (-348.559) -- 0:00:16
727000 -- (-346.110) [-348.511] (-347.861) (-348.816) * (-349.085) [-348.912] (-345.389) (-348.745) -- 0:00:16
727500 -- [-346.703] (-348.360) (-345.265) (-345.744) * (-346.151) [-346.640] (-345.165) (-348.383) -- 0:00:16
728000 -- [-346.071] (-346.805) (-345.180) (-345.949) * [-346.288] (-346.265) (-350.440) (-348.606) -- 0:00:16
728500 -- (-350.003) (-347.307) (-346.590) [-347.991] * (-349.556) (-346.666) (-349.470) [-346.872] -- 0:00:16
729000 -- (-345.343) (-347.532) (-346.857) [-345.948] * [-346.052] (-348.850) (-347.696) (-345.967) -- 0:00:15
729500 -- (-347.290) (-347.398) [-347.914] (-346.263) * [-347.477] (-347.303) (-347.793) (-346.755) -- 0:00:15
730000 -- (-346.393) (-352.248) [-347.888] (-347.950) * (-345.798) (-350.006) [-348.210] (-346.254) -- 0:00:15
Average standard deviation of split frequencies: 0.006538
730500 -- (-348.698) (-348.716) [-350.943] (-346.493) * (-346.656) (-349.807) [-346.241] (-347.101) -- 0:00:15
731000 -- (-350.996) (-344.872) [-347.601] (-348.866) * (-346.001) (-348.278) [-346.121] (-348.093) -- 0:00:15
731500 -- (-351.459) [-346.843] (-346.600) (-349.531) * (-347.087) (-350.607) (-350.510) [-346.749] -- 0:00:15
732000 -- [-347.515] (-345.855) (-345.966) (-348.836) * (-348.525) [-347.681] (-355.403) (-345.631) -- 0:00:15
732500 -- (-348.463) (-348.151) (-348.209) [-345.167] * [-346.411] (-346.386) (-347.128) (-348.520) -- 0:00:15
733000 -- [-348.891] (-347.915) (-348.113) (-345.736) * (-347.959) [-347.432] (-348.850) (-348.498) -- 0:00:15
733500 -- (-346.295) (-348.924) [-347.730] (-352.628) * (-346.806) (-350.695) [-351.287] (-346.924) -- 0:00:15
734000 -- (-345.953) (-353.279) [-346.342] (-355.424) * [-349.168] (-346.875) (-347.359) (-349.314) -- 0:00:15
734500 -- (-346.538) (-346.529) [-348.501] (-349.004) * (-348.233) [-345.927] (-345.896) (-351.149) -- 0:00:15
735000 -- (-344.969) (-349.556) [-346.855] (-350.566) * [-347.499] (-346.503) (-347.577) (-348.126) -- 0:00:15
Average standard deviation of split frequencies: 0.006685
735500 -- (-346.284) (-347.376) [-346.677] (-346.992) * [-346.666] (-345.470) (-348.673) (-348.214) -- 0:00:15
736000 -- (-347.170) (-347.741) (-346.383) [-345.423] * (-350.181) [-347.682] (-348.397) (-346.504) -- 0:00:15
736500 -- (-346.353) (-345.984) [-348.467] (-345.070) * (-346.145) (-348.286) [-346.431] (-347.044) -- 0:00:15
737000 -- (-345.538) (-345.983) [-348.021] (-346.350) * (-346.178) [-348.997] (-346.856) (-349.070) -- 0:00:15
737500 -- [-346.091] (-349.453) (-345.810) (-345.174) * (-347.999) (-346.656) (-346.820) [-349.671] -- 0:00:15
738000 -- [-345.721] (-350.563) (-350.507) (-345.923) * (-348.304) [-346.635] (-345.770) (-347.178) -- 0:00:15
738500 -- (-348.653) [-347.991] (-350.340) (-346.282) * [-348.053] (-347.918) (-346.105) (-346.986) -- 0:00:15
739000 -- (-346.506) [-346.376] (-352.285) (-348.408) * (-344.998) (-346.709) (-348.324) [-349.746] -- 0:00:15
739500 -- (-350.474) [-348.971] (-346.476) (-348.331) * (-346.117) (-348.133) [-350.303] (-345.913) -- 0:00:15
740000 -- (-350.442) (-348.224) (-345.768) [-345.523] * (-347.452) (-348.145) [-347.569] (-345.124) -- 0:00:15
Average standard deviation of split frequencies: 0.006404
740500 -- (-348.331) [-348.936] (-345.416) (-349.858) * (-345.730) (-347.709) [-345.488] (-345.659) -- 0:00:15
741000 -- (-350.678) (-348.762) [-344.880] (-345.511) * [-346.151] (-346.202) (-346.885) (-347.712) -- 0:00:15
741500 -- (-345.221) (-349.082) [-347.354] (-347.050) * (-345.982) (-345.179) (-346.294) [-347.347] -- 0:00:15
742000 -- (-347.827) [-350.621] (-347.477) (-350.620) * (-346.720) (-345.237) (-345.922) [-347.286] -- 0:00:15
742500 -- (-348.863) [-346.852] (-349.515) (-347.700) * (-347.238) (-347.699) [-346.965] (-345.878) -- 0:00:15
743000 -- (-348.080) (-347.227) (-349.789) [-345.153] * (-346.084) (-345.310) [-346.382] (-346.202) -- 0:00:15
743500 -- (-347.215) (-346.347) [-348.931] (-346.503) * (-347.955) (-345.810) [-345.463] (-346.636) -- 0:00:15
744000 -- (-344.963) (-347.223) [-347.906] (-346.899) * [-345.322] (-350.528) (-345.221) (-347.144) -- 0:00:15
744500 -- (-347.812) (-345.037) [-348.100] (-345.833) * (-348.071) [-346.361] (-347.273) (-344.987) -- 0:00:15
745000 -- (-345.581) (-347.033) (-350.200) [-349.460] * (-347.182) (-346.810) [-347.995] (-345.486) -- 0:00:15
Average standard deviation of split frequencies: 0.006398
745500 -- (-345.260) (-347.503) (-347.665) [-349.137] * [-345.941] (-347.419) (-346.122) (-347.385) -- 0:00:15
746000 -- (-349.429) (-345.564) [-349.473] (-347.756) * (-346.391) [-347.930] (-347.078) (-346.389) -- 0:00:14
746500 -- (-348.843) (-345.725) [-346.659] (-345.943) * (-347.494) (-347.502) [-347.307] (-347.607) -- 0:00:14
747000 -- [-346.467] (-348.077) (-348.321) (-345.565) * [-354.746] (-347.770) (-346.018) (-348.576) -- 0:00:14
747500 -- (-350.481) (-348.498) [-345.084] (-346.677) * [-356.670] (-345.648) (-345.185) (-347.355) -- 0:00:14
748000 -- (-347.027) (-345.273) (-347.261) [-347.531] * [-346.749] (-347.119) (-344.998) (-348.647) -- 0:00:14
748500 -- [-347.046] (-349.072) (-346.695) (-348.069) * [-345.226] (-351.713) (-345.096) (-348.970) -- 0:00:14
749000 -- (-348.817) [-345.936] (-347.262) (-348.589) * (-345.809) [-346.644] (-345.125) (-345.793) -- 0:00:14
749500 -- (-353.189) (-346.973) (-346.741) [-347.112] * (-346.703) [-345.764] (-349.030) (-345.425) -- 0:00:14
750000 -- (-348.044) [-346.643] (-348.233) (-348.678) * (-347.161) (-347.644) (-347.227) [-346.383] -- 0:00:14
Average standard deviation of split frequencies: 0.006515
750500 -- (-348.430) [-345.558] (-349.679) (-346.668) * [-345.368] (-348.765) (-346.518) (-345.608) -- 0:00:14
751000 -- (-348.617) (-346.158) (-346.053) [-346.323] * (-346.037) [-346.173] (-347.091) (-347.073) -- 0:00:14
751500 -- (-347.981) (-344.773) [-345.599] (-346.836) * (-351.068) [-346.648] (-348.584) (-348.306) -- 0:00:14
752000 -- (-347.591) [-345.435] (-349.489) (-346.706) * (-345.109) [-345.350] (-346.372) (-347.655) -- 0:00:14
752500 -- (-347.805) (-346.945) [-345.970] (-348.681) * (-346.934) [-348.693] (-345.798) (-348.510) -- 0:00:14
753000 -- (-350.242) (-346.558) [-346.958] (-348.559) * (-344.877) (-347.267) [-346.471] (-350.456) -- 0:00:14
753500 -- [-345.587] (-347.777) (-346.132) (-346.534) * (-346.722) [-346.822] (-349.274) (-348.329) -- 0:00:14
754000 -- [-345.483] (-349.160) (-347.218) (-346.125) * [-347.600] (-347.073) (-349.937) (-345.116) -- 0:00:14
754500 -- (-349.176) (-347.765) [-346.814] (-347.724) * [-345.475] (-347.099) (-350.958) (-347.839) -- 0:00:14
755000 -- (-350.309) [-347.396] (-349.758) (-348.858) * (-345.657) [-346.670] (-346.069) (-352.090) -- 0:00:14
Average standard deviation of split frequencies: 0.006319
755500 -- (-348.281) (-346.790) [-347.181] (-354.401) * (-347.262) (-348.184) (-349.478) [-348.311] -- 0:00:14
756000 -- (-347.886) (-347.255) (-344.937) [-347.152] * (-348.683) [-345.891] (-347.110) (-345.386) -- 0:00:14
756500 -- (-347.058) [-350.675] (-345.168) (-350.015) * (-348.490) (-345.859) [-345.665] (-346.133) -- 0:00:14
757000 -- (-349.715) [-352.198] (-345.454) (-349.927) * [-346.940] (-347.009) (-345.439) (-348.259) -- 0:00:14
757500 -- (-347.584) (-350.820) [-344.915] (-348.226) * (-349.867) (-346.695) (-348.673) [-347.780] -- 0:00:14
758000 -- (-348.068) (-346.054) [-346.089] (-347.337) * (-346.457) (-350.063) [-346.758] (-351.291) -- 0:00:14
758500 -- (-347.352) [-345.137] (-348.959) (-348.718) * (-348.414) (-346.656) [-349.669] (-347.307) -- 0:00:14
759000 -- [-351.241] (-350.774) (-347.483) (-348.654) * (-349.456) [-351.634] (-351.407) (-348.083) -- 0:00:14
759500 -- (-345.597) (-351.590) (-347.299) [-346.876] * (-345.702) (-349.657) (-348.262) [-346.796] -- 0:00:14
760000 -- (-345.381) (-353.432) [-347.033] (-346.011) * (-347.919) (-351.652) (-351.077) [-346.442] -- 0:00:14
Average standard deviation of split frequencies: 0.006197
760500 -- (-351.519) [-347.783] (-346.498) (-350.135) * (-346.797) (-347.646) [-346.812] (-346.372) -- 0:00:14
761000 -- (-349.086) (-346.571) (-346.218) [-348.634] * [-348.122] (-347.483) (-348.660) (-351.574) -- 0:00:14
761500 -- [-345.291] (-345.745) (-348.557) (-349.114) * (-348.541) (-345.336) (-353.183) [-350.620] -- 0:00:14
762000 -- [-346.692] (-346.407) (-346.987) (-345.844) * (-349.884) (-348.090) [-346.719] (-345.977) -- 0:00:14
762500 -- (-346.580) (-347.882) [-346.542] (-350.610) * (-347.240) [-348.534] (-347.286) (-346.139) -- 0:00:14
763000 -- [-346.665] (-346.615) (-347.098) (-345.573) * [-346.538] (-347.818) (-345.673) (-345.936) -- 0:00:13
763500 -- (-348.104) (-351.405) [-345.987] (-346.978) * [-347.078] (-346.308) (-347.726) (-351.860) -- 0:00:13
764000 -- (-347.330) [-346.562] (-349.715) (-346.719) * (-349.824) (-346.782) [-349.766] (-350.350) -- 0:00:13
764500 -- (-348.111) (-347.506) [-345.356] (-349.509) * (-346.659) (-346.045) [-345.526] (-349.452) -- 0:00:13
765000 -- [-346.110] (-345.677) (-346.965) (-349.942) * (-347.216) (-346.440) (-346.262) [-346.717] -- 0:00:13
Average standard deviation of split frequencies: 0.005949
765500 -- (-344.894) [-345.617] (-347.107) (-346.505) * (-347.194) (-345.528) (-347.036) [-345.782] -- 0:00:13
766000 -- (-345.125) [-346.493] (-347.627) (-349.983) * (-347.985) (-347.658) [-346.668] (-347.261) -- 0:00:13
766500 -- (-346.879) (-346.876) (-349.547) [-346.529] * [-347.719] (-347.118) (-346.644) (-345.096) -- 0:00:13
767000 -- (-346.277) (-346.263) [-345.878] (-345.397) * (-346.822) (-346.314) [-346.550] (-345.481) -- 0:00:13
767500 -- (-347.032) [-346.843] (-345.305) (-346.096) * (-346.926) (-349.324) [-345.541] (-350.515) -- 0:00:13
768000 -- (-346.833) (-345.952) (-347.837) [-347.432] * (-346.353) [-346.815] (-346.703) (-346.987) -- 0:00:13
768500 -- (-347.603) (-346.007) [-345.508] (-348.403) * (-348.166) (-352.052) [-345.896] (-348.387) -- 0:00:13
769000 -- (-346.790) [-345.908] (-344.924) (-347.470) * [-346.815] (-348.541) (-347.923) (-346.409) -- 0:00:13
769500 -- (-347.652) [-345.496] (-352.447) (-349.858) * (-347.737) (-347.881) (-346.806) [-347.027] -- 0:00:13
770000 -- (-349.457) (-346.907) (-345.216) [-351.504] * (-349.084) [-345.783] (-346.226) (-352.289) -- 0:00:13
Average standard deviation of split frequencies: 0.005587
770500 -- (-347.210) (-345.243) (-348.386) [-346.187] * (-347.840) (-346.782) (-346.743) [-348.644] -- 0:00:13
771000 -- (-346.782) [-345.331] (-346.620) (-346.218) * (-345.085) (-344.961) (-345.842) [-348.633] -- 0:00:13
771500 -- (-349.524) (-348.480) [-345.987] (-347.435) * (-348.704) (-346.670) (-346.991) [-346.471] -- 0:00:13
772000 -- (-353.172) (-346.699) [-345.883] (-348.478) * [-348.344] (-348.745) (-347.760) (-347.330) -- 0:00:13
772500 -- (-348.871) [-346.299] (-345.125) (-347.189) * (-346.283) (-345.840) [-345.762] (-348.208) -- 0:00:13
773000 -- (-345.766) [-347.514] (-351.157) (-346.080) * [-348.612] (-349.812) (-354.120) (-346.419) -- 0:00:13
773500 -- (-345.217) (-347.244) [-346.147] (-350.577) * (-345.827) [-347.247] (-346.811) (-346.513) -- 0:00:13
774000 -- [-346.697] (-347.426) (-349.475) (-345.079) * [-348.143] (-348.211) (-346.058) (-347.319) -- 0:00:13
774500 -- (-345.552) (-350.241) (-348.163) [-345.757] * (-347.290) [-346.566] (-347.272) (-347.534) -- 0:00:13
775000 -- [-347.679] (-347.676) (-347.759) (-346.603) * (-347.139) (-345.612) [-348.046] (-346.120) -- 0:00:13
Average standard deviation of split frequencies: 0.005913
775500 -- (-346.314) [-347.532] (-346.420) (-345.478) * (-348.014) [-345.322] (-347.385) (-349.689) -- 0:00:13
776000 -- (-347.087) (-345.331) (-345.623) [-345.339] * (-346.453) [-345.235] (-349.793) (-345.687) -- 0:00:13
776500 -- (-349.544) (-346.075) (-352.509) [-346.319] * [-346.061] (-345.730) (-345.373) (-346.667) -- 0:00:13
777000 -- (-351.022) (-345.598) (-345.376) [-344.972] * (-348.013) [-345.886] (-352.340) (-346.787) -- 0:00:13
777500 -- (-347.730) [-345.645] (-348.069) (-345.077) * (-348.349) (-347.133) (-348.259) [-345.501] -- 0:00:13
778000 -- (-347.562) [-347.314] (-347.903) (-346.465) * (-351.387) (-346.610) [-350.728] (-348.193) -- 0:00:13
778500 -- (-344.786) (-348.549) [-346.600] (-351.872) * (-352.181) (-350.782) (-345.237) [-347.712] -- 0:00:13
779000 -- [-346.270] (-349.918) (-347.731) (-347.171) * (-346.930) (-346.791) [-346.957] (-348.072) -- 0:00:13
779500 -- (-347.543) (-347.461) (-347.629) [-347.739] * (-347.753) [-347.893] (-349.092) (-346.111) -- 0:00:13
780000 -- (-347.013) (-347.332) [-345.554] (-346.526) * (-348.415) [-349.307] (-346.935) (-345.492) -- 0:00:12
Average standard deviation of split frequencies: 0.005918
780500 -- (-349.743) [-348.008] (-345.100) (-348.788) * (-349.056) (-347.289) (-345.733) [-345.730] -- 0:00:12
781000 -- (-347.072) (-350.675) (-346.582) [-346.354] * (-347.065) [-345.217] (-346.972) (-351.058) -- 0:00:12
781500 -- [-348.667] (-345.526) (-347.911) (-347.287) * (-346.800) [-345.329] (-350.263) (-346.913) -- 0:00:12
782000 -- (-346.813) (-347.090) (-346.422) [-345.784] * [-346.236] (-347.058) (-347.487) (-346.660) -- 0:00:12
782500 -- [-345.276] (-349.311) (-349.289) (-346.137) * (-348.837) [-346.882] (-345.415) (-345.727) -- 0:00:12
783000 -- (-349.250) (-349.153) (-348.027) [-350.813] * (-348.547) [-346.752] (-346.241) (-345.722) -- 0:00:12
783500 -- (-348.830) (-349.828) [-346.566] (-348.517) * [-346.589] (-348.973) (-348.635) (-344.942) -- 0:00:12
784000 -- (-352.426) (-345.540) [-349.524] (-346.379) * (-346.769) [-345.942] (-347.593) (-344.984) -- 0:00:12
784500 -- (-347.185) (-348.011) (-348.157) [-345.731] * (-349.863) (-347.386) [-346.983] (-349.374) -- 0:00:12
785000 -- [-345.835] (-346.953) (-348.241) (-346.732) * (-345.945) [-347.115] (-345.242) (-348.117) -- 0:00:12
Average standard deviation of split frequencies: 0.005698
785500 -- (-347.910) (-348.102) (-353.430) [-345.262] * (-346.633) (-347.332) (-349.579) [-347.741] -- 0:00:12
786000 -- [-345.507] (-348.327) (-346.244) (-346.263) * (-347.086) (-345.565) [-346.404] (-348.358) -- 0:00:12
786500 -- (-346.242) [-350.504] (-345.941) (-347.102) * [-346.241] (-347.019) (-349.925) (-348.327) -- 0:00:12
787000 -- (-347.969) (-349.139) [-346.995] (-347.971) * [-346.277] (-346.781) (-349.325) (-349.012) -- 0:00:12
787500 -- (-347.432) (-346.525) (-346.769) [-347.752] * (-346.521) (-346.498) [-346.921] (-351.957) -- 0:00:12
788000 -- (-347.436) [-345.313] (-347.848) (-347.702) * (-346.938) (-347.963) [-349.261] (-349.568) -- 0:00:12
788500 -- (-349.312) [-346.667] (-348.178) (-348.220) * (-347.417) (-348.295) [-346.415] (-349.568) -- 0:00:12
789000 -- [-344.988] (-347.999) (-349.481) (-346.668) * [-347.083] (-346.514) (-346.260) (-345.956) -- 0:00:12
789500 -- (-349.245) (-346.774) [-349.468] (-348.428) * (-350.721) [-351.364] (-348.409) (-346.727) -- 0:00:12
790000 -- [-346.751] (-347.784) (-348.396) (-348.641) * (-348.057) (-349.191) [-345.688] (-348.303) -- 0:00:12
Average standard deviation of split frequencies: 0.006037
790500 -- (-347.518) (-346.379) [-346.954] (-347.186) * (-345.431) (-348.241) (-347.065) [-349.428] -- 0:00:12
791000 -- [-347.541] (-347.301) (-346.483) (-344.839) * (-345.556) (-348.274) (-347.380) [-346.645] -- 0:00:12
791500 -- (-347.865) (-346.164) (-345.675) [-345.042] * (-347.628) [-346.370] (-346.876) (-345.625) -- 0:00:12
792000 -- [-346.246] (-347.533) (-346.972) (-344.979) * (-349.274) [-349.224] (-349.255) (-345.413) -- 0:00:12
792500 -- (-345.330) (-347.808) (-348.181) [-346.481] * (-347.163) (-347.032) (-346.765) [-348.484] -- 0:00:12
793000 -- (-345.636) (-345.920) [-347.094] (-349.096) * (-350.802) (-346.577) (-345.153) [-345.390] -- 0:00:12
793500 -- (-350.266) (-349.793) [-351.043] (-349.348) * (-345.252) (-345.581) [-345.622] (-345.307) -- 0:00:12
794000 -- (-346.651) (-352.131) [-347.074] (-346.340) * (-345.956) (-351.667) (-345.421) [-346.244] -- 0:00:12
794500 -- (-346.385) (-348.230) [-345.847] (-345.975) * (-351.709) (-351.715) (-346.094) [-347.668] -- 0:00:12
795000 -- (-349.844) (-346.681) (-347.934) [-345.025] * (-345.371) (-349.475) (-348.361) [-346.210] -- 0:00:12
Average standard deviation of split frequencies: 0.006181
795500 -- (-348.387) (-345.657) [-348.700] (-346.387) * (-346.254) (-348.660) (-349.522) [-350.065] -- 0:00:12
796000 -- (-348.921) (-349.925) [-344.883] (-347.775) * (-348.583) (-349.807) [-348.207] (-348.787) -- 0:00:12
796500 -- (-348.167) (-345.321) [-345.625] (-346.707) * (-349.472) (-348.995) (-349.600) [-349.350] -- 0:00:12
797000 -- (-346.166) [-346.113] (-348.770) (-346.832) * (-347.346) (-348.993) (-346.943) [-349.002] -- 0:00:11
797500 -- (-346.555) [-348.357] (-347.003) (-347.057) * (-349.504) [-348.346] (-345.422) (-351.081) -- 0:00:11
798000 -- (-346.269) (-345.333) (-347.199) [-347.569] * (-348.185) (-345.816) (-347.316) [-347.521] -- 0:00:11
798500 -- [-345.021] (-346.588) (-349.312) (-348.305) * [-351.476] (-345.865) (-346.394) (-353.907) -- 0:00:11
799000 -- (-347.339) (-347.047) (-346.023) [-346.734] * (-347.005) [-346.629] (-347.917) (-352.837) -- 0:00:11
799500 -- (-347.916) (-346.864) [-350.113] (-345.001) * (-351.082) (-348.530) (-352.408) [-347.514] -- 0:00:11
800000 -- (-349.305) (-347.467) [-347.280] (-346.080) * (-348.430) (-349.998) (-345.469) [-346.163] -- 0:00:11
Average standard deviation of split frequencies: 0.005888
800500 -- (-346.453) [-348.726] (-348.591) (-350.213) * (-346.467) (-346.447) (-345.700) [-345.840] -- 0:00:11
801000 -- (-347.195) (-345.073) [-348.185] (-350.052) * (-345.544) [-346.259] (-354.139) (-345.702) -- 0:00:11
801500 -- (-345.948) (-348.569) [-349.482] (-346.153) * (-347.127) (-347.735) [-350.192] (-347.277) -- 0:00:11
802000 -- [-345.406] (-353.448) (-347.103) (-350.209) * [-345.920] (-349.293) (-346.594) (-345.257) -- 0:00:11
802500 -- [-346.347] (-349.672) (-347.064) (-346.131) * (-350.511) (-345.312) [-347.127] (-346.949) -- 0:00:11
803000 -- [-347.952] (-347.464) (-347.572) (-348.811) * (-353.337) [-345.813] (-348.302) (-348.890) -- 0:00:11
803500 -- [-347.750] (-348.411) (-347.493) (-347.708) * (-346.582) (-346.546) (-345.930) [-349.236] -- 0:00:11
804000 -- (-346.470) (-346.931) [-346.450] (-346.706) * (-346.903) (-347.145) [-347.747] (-348.250) -- 0:00:11
804500 -- (-347.042) [-346.726] (-349.943) (-352.452) * (-346.569) [-346.421] (-348.596) (-346.462) -- 0:00:11
805000 -- (-347.983) [-345.467] (-348.025) (-349.743) * (-350.230) (-348.699) (-345.501) [-345.400] -- 0:00:11
Average standard deviation of split frequencies: 0.005520
805500 -- (-347.257) [-346.623] (-348.011) (-347.906) * (-354.569) (-348.541) (-347.494) [-347.251] -- 0:00:11
806000 -- (-349.233) (-345.548) (-345.255) [-348.243] * (-346.380) [-348.148] (-345.982) (-346.088) -- 0:00:11
806500 -- [-345.778] (-350.626) (-348.312) (-350.227) * (-350.854) (-346.013) (-346.136) [-346.688] -- 0:00:11
807000 -- [-347.735] (-347.967) (-348.855) (-355.542) * (-349.778) (-346.769) (-346.419) [-346.385] -- 0:00:11
807500 -- (-346.553) [-346.549] (-345.909) (-345.871) * (-347.630) (-349.245) [-345.960] (-347.314) -- 0:00:11
808000 -- (-346.687) [-346.634] (-346.748) (-347.609) * (-345.501) [-347.302] (-348.480) (-357.104) -- 0:00:11
808500 -- (-347.878) (-345.052) [-346.930] (-346.065) * (-347.567) (-347.307) [-345.959] (-346.237) -- 0:00:11
809000 -- [-345.189] (-345.805) (-344.958) (-345.738) * (-349.519) (-347.944) [-345.655] (-349.333) -- 0:00:11
809500 -- [-346.245] (-347.594) (-344.995) (-348.198) * (-347.351) (-347.571) [-348.585] (-348.575) -- 0:00:11
810000 -- (-345.524) (-345.413) [-349.380] (-345.410) * (-345.437) (-346.685) (-346.212) [-350.343] -- 0:00:11
Average standard deviation of split frequencies: 0.005270
810500 -- (-348.514) (-348.620) (-350.930) [-345.237] * (-346.589) (-346.219) (-345.685) [-347.058] -- 0:00:11
811000 -- (-349.124) (-346.706) [-346.678] (-348.498) * (-347.285) (-347.574) [-346.843] (-346.848) -- 0:00:11
811500 -- (-345.811) [-346.508] (-345.459) (-347.706) * [-346.670] (-347.035) (-346.286) (-349.143) -- 0:00:11
812000 -- [-346.906] (-345.714) (-345.479) (-348.143) * (-346.768) (-347.545) [-349.694] (-347.375) -- 0:00:11
812500 -- (-346.295) (-347.048) (-345.446) [-347.173] * (-346.293) (-347.760) (-347.109) [-346.770] -- 0:00:11
813000 -- [-347.022] (-346.958) (-350.034) (-348.352) * (-345.823) [-350.560] (-346.345) (-347.870) -- 0:00:11
813500 -- [-345.325] (-348.749) (-347.199) (-345.468) * (-349.389) (-348.528) [-350.712] (-348.328) -- 0:00:11
814000 -- [-349.112] (-348.005) (-346.448) (-346.803) * (-345.845) [-348.486] (-346.175) (-346.387) -- 0:00:10
814500 -- (-347.849) [-347.721] (-347.644) (-349.302) * (-348.572) (-348.469) [-345.923] (-345.910) -- 0:00:10
815000 -- [-346.735] (-348.614) (-345.458) (-345.976) * (-345.770) (-345.545) [-346.190] (-346.145) -- 0:00:10
Average standard deviation of split frequencies: 0.005272
815500 -- (-349.103) [-346.168] (-346.200) (-345.215) * (-345.854) (-347.310) [-345.456] (-345.730) -- 0:00:10
816000 -- (-346.910) (-349.497) (-347.636) [-345.313] * [-345.255] (-346.270) (-346.886) (-348.336) -- 0:00:10
816500 -- (-348.299) [-349.816] (-348.047) (-347.157) * (-345.767) (-345.330) (-345.230) [-347.462] -- 0:00:10
817000 -- (-347.370) (-346.977) (-346.718) [-346.627] * [-346.332] (-345.260) (-345.590) (-348.714) -- 0:00:10
817500 -- (-346.781) (-347.561) [-345.597] (-345.260) * [-347.991] (-347.597) (-345.847) (-350.789) -- 0:00:10
818000 -- (-345.117) (-346.235) [-348.439] (-345.714) * (-345.725) [-347.106] (-346.886) (-350.541) -- 0:00:10
818500 -- [-345.969] (-347.436) (-345.828) (-346.850) * (-348.219) (-347.244) [-348.569] (-346.082) -- 0:00:10
819000 -- (-347.523) (-348.062) [-346.823] (-348.425) * (-348.235) (-350.006) (-349.156) [-346.611] -- 0:00:10
819500 -- (-347.356) (-345.153) [-345.512] (-348.819) * (-348.968) (-347.056) [-346.662] (-347.550) -- 0:00:10
820000 -- [-347.090] (-346.989) (-347.115) (-349.468) * (-346.801) [-349.698] (-346.138) (-347.867) -- 0:00:10
Average standard deviation of split frequencies: 0.005706
820500 -- [-346.242] (-347.164) (-347.704) (-345.614) * [-346.505] (-350.201) (-346.037) (-345.243) -- 0:00:10
821000 -- (-347.040) (-348.345) (-346.293) [-351.298] * (-350.676) (-348.411) (-345.934) [-345.224] -- 0:00:10
821500 -- (-347.738) (-348.143) (-345.372) [-348.553] * (-347.941) (-360.237) [-345.117] (-349.355) -- 0:00:10
822000 -- [-344.906] (-346.472) (-344.970) (-350.862) * (-346.228) (-347.119) (-345.239) [-345.570] -- 0:00:10
822500 -- (-344.906) [-345.767] (-349.339) (-346.012) * (-348.198) (-347.416) [-346.508] (-347.141) -- 0:00:10
823000 -- (-357.751) [-346.809] (-347.327) (-346.294) * (-347.142) (-346.158) (-345.138) [-347.164] -- 0:00:10
823500 -- (-350.771) [-347.213] (-348.713) (-346.861) * [-345.767] (-346.547) (-346.171) (-348.180) -- 0:00:10
824000 -- (-347.474) (-344.941) [-347.666] (-347.387) * [-349.099] (-348.479) (-347.675) (-348.033) -- 0:00:10
824500 -- (-350.802) [-346.544] (-345.358) (-349.339) * (-346.523) [-346.749] (-347.225) (-348.412) -- 0:00:10
825000 -- (-345.499) [-346.948] (-352.823) (-348.571) * (-347.270) [-346.211] (-349.259) (-350.460) -- 0:00:10
Average standard deviation of split frequencies: 0.005243
825500 -- (-348.952) (-345.525) [-349.210] (-349.415) * (-347.846) (-346.980) [-347.256] (-345.575) -- 0:00:10
826000 -- (-346.896) (-347.358) (-352.505) [-348.273] * [-348.920] (-346.565) (-350.430) (-344.812) -- 0:00:10
826500 -- (-350.396) (-346.661) [-351.995] (-349.912) * [-348.321] (-347.292) (-347.325) (-347.903) -- 0:00:10
827000 -- (-347.513) (-346.826) [-348.163] (-349.436) * (-353.232) (-345.787) [-346.740] (-346.301) -- 0:00:10
827500 -- (-348.121) [-346.152] (-347.022) (-348.440) * (-347.046) [-345.291] (-351.419) (-347.466) -- 0:00:10
828000 -- (-346.448) [-348.004] (-347.510) (-349.000) * (-346.997) (-348.080) (-349.549) [-349.208] -- 0:00:10
828500 -- (-347.246) (-346.141) (-347.835) [-346.912] * (-349.290) (-348.327) (-349.838) [-345.660] -- 0:00:10
829000 -- (-345.996) [-346.412] (-346.210) (-345.848) * (-351.768) (-347.346) (-349.472) [-346.756] -- 0:00:10
829500 -- (-345.578) (-347.339) [-347.292] (-347.299) * (-349.894) (-349.216) [-348.594] (-348.021) -- 0:00:10
830000 -- (-346.268) (-347.358) (-350.595) [-346.171] * (-354.832) (-348.140) [-345.304] (-347.383) -- 0:00:10
Average standard deviation of split frequencies: 0.004918
830500 -- (-345.864) [-346.147] (-347.639) (-347.424) * (-351.554) [-345.388] (-346.151) (-348.039) -- 0:00:10
831000 -- (-345.930) (-349.852) [-345.256] (-348.366) * (-347.165) (-347.172) [-346.467] (-350.739) -- 0:00:09
831500 -- (-347.366) (-350.358) [-347.174] (-345.876) * (-346.834) (-348.217) [-345.495] (-357.497) -- 0:00:09
832000 -- (-354.327) (-348.491) [-347.394] (-354.835) * [-345.872] (-350.165) (-346.993) (-347.059) -- 0:00:09
832500 -- [-347.221] (-347.592) (-345.625) (-348.097) * (-345.852) (-346.019) (-345.966) [-347.036] -- 0:00:09
833000 -- (-346.286) (-347.382) [-345.936] (-346.382) * (-346.968) [-345.366] (-346.318) (-347.978) -- 0:00:09
833500 -- (-348.268) [-347.473] (-345.548) (-345.887) * [-346.872] (-347.352) (-350.303) (-350.739) -- 0:00:09
834000 -- [-346.374] (-346.187) (-345.972) (-347.822) * (-347.906) (-347.492) [-347.254] (-347.374) -- 0:00:09
834500 -- (-347.596) (-348.829) (-347.131) [-347.614] * (-347.417) (-347.684) [-346.345] (-351.481) -- 0:00:09
835000 -- (-345.265) [-345.989] (-347.168) (-345.476) * (-346.232) [-345.755] (-348.314) (-345.330) -- 0:00:09
Average standard deviation of split frequencies: 0.005150
835500 -- (-348.754) [-346.148] (-345.546) (-346.847) * [-345.092] (-347.371) (-345.691) (-348.856) -- 0:00:09
836000 -- (-346.948) [-351.245] (-349.026) (-348.194) * (-348.935) (-345.591) [-346.068] (-345.457) -- 0:00:09
836500 -- [-346.440] (-351.342) (-349.557) (-349.384) * [-347.890] (-347.752) (-345.163) (-346.728) -- 0:00:09
837000 -- (-346.413) (-347.051) (-348.177) [-347.235] * (-350.143) (-347.828) [-348.282] (-349.171) -- 0:00:09
837500 -- (-346.283) (-349.102) [-345.209] (-349.165) * (-346.859) [-349.210] (-349.919) (-348.742) -- 0:00:09
838000 -- (-348.339) (-348.386) [-349.350] (-348.373) * (-345.511) [-347.386] (-345.260) (-345.469) -- 0:00:09
838500 -- (-348.546) (-345.615) [-347.321] (-348.216) * (-345.716) [-348.664] (-345.708) (-351.565) -- 0:00:09
839000 -- [-346.272] (-346.814) (-347.591) (-347.145) * (-345.058) (-348.156) (-346.659) [-346.500] -- 0:00:09
839500 -- (-345.843) (-348.906) [-346.670] (-346.962) * [-347.274] (-351.703) (-347.806) (-345.654) -- 0:00:09
840000 -- (-346.898) [-348.341] (-347.562) (-349.369) * (-346.910) (-345.676) [-346.452] (-346.843) -- 0:00:09
Average standard deviation of split frequencies: 0.005234
840500 -- (-346.915) (-348.380) (-346.007) [-346.829] * (-345.768) (-345.560) (-346.602) [-347.068] -- 0:00:09
841000 -- (-348.688) (-346.441) [-347.578] (-345.375) * (-347.080) [-346.875] (-346.864) (-347.489) -- 0:00:09
841500 -- (-346.833) (-349.366) [-346.239] (-346.149) * (-348.716) (-348.652) (-348.685) [-345.922] -- 0:00:09
842000 -- (-347.205) [-348.468] (-347.295) (-349.040) * (-348.417) (-348.677) (-349.464) [-345.930] -- 0:00:09
842500 -- (-348.421) (-350.829) (-346.564) [-348.975] * (-348.099) (-348.941) [-346.117] (-347.726) -- 0:00:09
843000 -- (-347.377) (-345.870) (-354.135) [-347.652] * (-348.675) [-345.390] (-346.008) (-346.199) -- 0:00:09
843500 -- (-349.101) (-346.516) [-345.681] (-348.572) * (-347.644) (-346.624) [-345.658] (-347.719) -- 0:00:09
844000 -- (-348.925) [-346.334] (-345.503) (-349.345) * (-345.423) (-352.835) [-346.429] (-347.227) -- 0:00:09
844500 -- (-345.637) (-347.371) [-346.881] (-346.519) * [-348.962] (-350.255) (-346.248) (-347.162) -- 0:00:09
845000 -- (-346.632) (-350.577) (-352.764) [-346.992] * (-347.508) (-349.769) [-345.177] (-345.862) -- 0:00:09
Average standard deviation of split frequencies: 0.005363
845500 -- [-345.966] (-347.190) (-356.262) (-346.423) * (-347.200) (-349.403) (-348.798) [-348.176] -- 0:00:09
846000 -- (-347.205) [-347.242] (-349.463) (-346.527) * (-348.339) (-350.301) (-348.257) [-349.048] -- 0:00:09
846500 -- [-345.897] (-347.929) (-346.433) (-346.655) * (-347.261) (-347.597) (-352.913) [-345.931] -- 0:00:09
847000 -- (-350.159) [-344.801] (-346.188) (-345.418) * (-347.974) (-345.335) (-351.311) [-345.271] -- 0:00:09
847500 -- (-352.419) [-348.970] (-345.745) (-347.746) * (-345.982) [-345.919] (-347.633) (-347.573) -- 0:00:08
848000 -- (-348.205) (-348.256) [-345.358] (-346.768) * (-350.915) (-347.170) [-347.561] (-346.731) -- 0:00:08
848500 -- [-345.137] (-351.913) (-346.389) (-349.804) * (-349.419) (-345.690) (-347.095) [-346.328] -- 0:00:08
849000 -- [-346.902] (-345.521) (-345.913) (-348.954) * (-345.145) (-347.560) (-346.422) [-345.499] -- 0:00:08
849500 -- [-345.938] (-350.057) (-345.670) (-356.603) * [-350.587] (-348.342) (-348.844) (-345.975) -- 0:00:08
850000 -- (-349.237) (-346.709) [-345.220] (-354.530) * (-348.684) (-347.835) (-349.240) [-347.184] -- 0:00:08
Average standard deviation of split frequencies: 0.005091
850500 -- [-347.223] (-350.378) (-346.050) (-348.861) * [-345.798] (-347.539) (-346.647) (-346.854) -- 0:00:08
851000 -- (-347.422) (-348.133) [-345.296] (-350.494) * (-349.998) (-348.017) (-348.830) [-349.328] -- 0:00:08
851500 -- (-346.981) [-346.634] (-345.629) (-350.171) * (-349.551) [-345.560] (-346.387) (-347.893) -- 0:00:08
852000 -- (-345.939) (-345.701) (-347.211) [-349.317] * (-349.512) (-345.360) [-347.713] (-349.505) -- 0:00:08
852500 -- (-345.354) (-345.196) [-350.910] (-346.156) * (-348.658) (-346.335) (-348.454) [-346.316] -- 0:00:08
853000 -- (-348.530) [-345.807] (-347.096) (-346.156) * (-352.516) (-349.891) (-349.404) [-347.177] -- 0:00:08
853500 -- (-346.800) (-346.080) (-348.428) [-346.740] * [-348.656] (-346.114) (-346.776) (-347.004) -- 0:00:08
854000 -- [-347.699] (-346.407) (-346.170) (-347.469) * (-348.296) (-347.659) (-351.758) [-348.936] -- 0:00:08
854500 -- [-350.535] (-348.496) (-344.847) (-345.407) * [-346.259] (-352.436) (-347.848) (-346.377) -- 0:00:08
855000 -- (-346.795) (-347.121) (-345.591) [-346.434] * [-346.962] (-348.607) (-347.233) (-348.292) -- 0:00:08
Average standard deviation of split frequencies: 0.004956
855500 -- [-349.218] (-346.487) (-346.719) (-351.106) * (-347.242) [-346.221] (-349.486) (-346.199) -- 0:00:08
856000 -- (-345.550) (-347.585) [-346.561] (-345.394) * [-346.605] (-345.499) (-350.191) (-352.209) -- 0:00:08
856500 -- (-346.272) [-349.663] (-346.403) (-345.801) * (-346.111) [-347.104] (-346.422) (-346.305) -- 0:00:08
857000 -- (-347.352) (-345.964) (-346.618) [-345.031] * [-345.917] (-347.215) (-346.525) (-347.946) -- 0:00:08
857500 -- [-348.414] (-347.007) (-346.347) (-345.698) * (-345.981) (-345.965) [-347.314] (-345.682) -- 0:00:08
858000 -- [-345.446] (-346.425) (-348.095) (-345.050) * (-345.820) (-345.837) (-348.521) [-348.064] -- 0:00:08
858500 -- (-346.023) (-347.995) [-345.908] (-345.334) * [-346.722] (-348.231) (-346.783) (-345.144) -- 0:00:08
859000 -- (-346.868) (-347.356) (-345.525) [-348.251] * [-347.058] (-346.693) (-347.653) (-347.148) -- 0:00:08
859500 -- (-347.238) (-346.574) (-347.220) [-346.595] * [-347.193] (-346.959) (-348.525) (-346.122) -- 0:00:08
860000 -- (-346.302) [-344.960] (-347.142) (-346.277) * (-348.019) (-346.649) (-349.124) [-346.225] -- 0:00:08
Average standard deviation of split frequencies: 0.005169
860500 -- [-347.834] (-347.003) (-345.906) (-345.571) * [-345.983] (-349.657) (-346.842) (-346.724) -- 0:00:08
861000 -- [-346.282] (-347.855) (-346.097) (-347.960) * [-345.730] (-346.636) (-349.146) (-345.533) -- 0:00:08
861500 -- (-348.983) (-346.331) (-346.901) [-345.419] * (-346.629) [-347.082] (-352.094) (-345.363) -- 0:00:08
862000 -- [-350.104] (-348.752) (-345.991) (-346.986) * [-348.415] (-346.304) (-347.407) (-349.192) -- 0:00:08
862500 -- (-348.557) (-346.791) [-345.769] (-347.108) * (-348.769) (-349.944) (-350.961) [-345.307] -- 0:00:08
863000 -- (-346.279) (-346.839) (-346.074) [-346.447] * (-347.992) (-355.340) (-349.752) [-346.111] -- 0:00:08
863500 -- (-348.794) (-346.897) (-346.482) [-346.580] * (-349.664) (-348.627) (-350.322) [-345.758] -- 0:00:08
864000 -- [-347.528] (-347.341) (-347.864) (-346.359) * (-350.619) [-347.283] (-351.114) (-345.783) -- 0:00:08
864500 -- (-348.850) (-349.937) (-346.698) [-346.485] * (-346.963) (-347.026) (-350.012) [-345.385] -- 0:00:07
865000 -- (-352.681) (-347.422) (-346.036) [-345.877] * (-349.712) (-347.140) [-350.206] (-346.608) -- 0:00:07
Average standard deviation of split frequencies: 0.005307
865500 -- (-345.577) (-347.833) [-346.205] (-346.024) * [-346.715] (-348.196) (-352.281) (-346.770) -- 0:00:07
866000 -- (-347.746) [-351.842] (-346.671) (-346.895) * [-346.301] (-348.950) (-346.040) (-348.661) -- 0:00:07
866500 -- (-350.610) [-347.809] (-348.182) (-347.613) * (-347.810) (-348.707) [-345.663] (-348.766) -- 0:00:07
867000 -- (-347.874) (-345.103) (-345.810) [-346.307] * (-346.296) (-346.824) [-345.325] (-345.452) -- 0:00:07
867500 -- (-347.085) (-346.637) (-348.142) [-346.037] * [-345.095] (-345.350) (-346.108) (-345.574) -- 0:00:07
868000 -- [-349.493] (-347.755) (-354.630) (-347.751) * (-349.021) (-348.943) (-345.739) [-345.696] -- 0:00:07
868500 -- (-347.893) [-345.107] (-350.935) (-352.493) * [-347.714] (-347.869) (-348.296) (-348.796) -- 0:00:07
869000 -- [-345.941] (-346.230) (-347.973) (-345.603) * [-348.258] (-348.398) (-350.405) (-347.241) -- 0:00:07
869500 -- (-348.899) (-344.773) (-347.544) [-345.845] * (-347.460) [-346.948] (-348.296) (-346.054) -- 0:00:07
870000 -- (-346.814) (-346.333) (-347.721) [-346.242] * [-347.900] (-345.876) (-346.247) (-349.069) -- 0:00:07
Average standard deviation of split frequencies: 0.005234
870500 -- (-349.608) (-346.433) [-347.685] (-346.053) * (-349.286) (-351.072) (-348.752) [-345.684] -- 0:00:07
871000 -- (-348.860) [-347.856] (-347.080) (-347.744) * (-353.881) (-347.272) [-345.837] (-347.926) -- 0:00:07
871500 -- (-348.569) [-349.844] (-350.644) (-350.002) * (-350.197) (-345.533) [-345.940] (-350.280) -- 0:00:07
872000 -- [-346.832] (-347.749) (-349.941) (-346.056) * (-351.037) [-346.512] (-347.973) (-347.255) -- 0:00:07
872500 -- (-345.781) (-347.595) (-347.716) [-345.652] * (-348.094) [-347.320] (-348.480) (-347.123) -- 0:00:07
873000 -- [-346.010] (-346.806) (-350.029) (-345.476) * (-351.572) [-348.124] (-348.348) (-346.392) -- 0:00:07
873500 -- (-346.222) (-348.551) [-348.442] (-346.606) * (-347.363) (-348.330) (-346.327) [-347.174] -- 0:00:07
874000 -- (-348.120) (-348.164) (-347.870) [-346.361] * (-346.832) (-348.593) (-346.313) [-345.519] -- 0:00:07
874500 -- (-347.237) (-350.053) [-347.636] (-348.400) * (-345.956) (-348.682) (-345.985) [-346.580] -- 0:00:07
875000 -- [-346.442] (-351.803) (-347.658) (-353.158) * [-346.780] (-346.515) (-345.775) (-348.404) -- 0:00:07
Average standard deviation of split frequencies: 0.004807
875500 -- (-348.024) [-347.020] (-346.224) (-350.975) * (-345.763) (-349.685) (-347.536) [-347.206] -- 0:00:07
876000 -- (-346.444) (-346.405) (-348.310) [-348.831] * (-344.960) [-345.352] (-346.861) (-346.641) -- 0:00:07
876500 -- (-347.303) (-345.764) (-345.061) [-345.883] * (-347.544) [-347.616] (-346.825) (-347.073) -- 0:00:07
877000 -- (-347.499) (-346.530) (-345.376) [-347.490] * (-349.186) [-346.096] (-345.473) (-345.992) -- 0:00:07
877500 -- (-346.932) (-346.800) [-346.697] (-351.599) * [-345.905] (-349.208) (-346.786) (-346.199) -- 0:00:07
878000 -- (-348.346) (-346.900) [-349.040] (-348.063) * (-345.639) [-346.043] (-348.433) (-346.493) -- 0:00:07
878500 -- (-347.053) (-345.477) (-348.121) [-345.591] * (-346.295) (-348.456) [-351.320] (-350.564) -- 0:00:07
879000 -- (-347.302) (-345.737) (-346.780) [-346.491] * [-349.510] (-346.481) (-346.844) (-346.271) -- 0:00:07
879500 -- (-348.935) (-348.173) (-346.292) [-346.940] * [-348.404] (-345.709) (-348.083) (-351.523) -- 0:00:07
880000 -- [-345.997] (-348.009) (-346.620) (-348.711) * (-347.370) (-349.454) [-345.503] (-350.321) -- 0:00:07
Average standard deviation of split frequencies: 0.004746
880500 -- [-347.100] (-346.991) (-350.156) (-349.464) * [-347.168] (-351.669) (-351.505) (-347.871) -- 0:00:07
881000 -- (-349.383) (-345.226) (-346.925) [-346.216] * (-350.634) (-349.533) (-348.853) [-345.989] -- 0:00:07
881500 -- (-348.478) [-347.329] (-345.019) (-348.798) * (-350.617) (-346.747) [-344.992] (-347.529) -- 0:00:06
882000 -- [-348.084] (-347.618) (-345.746) (-351.718) * (-346.770) (-345.986) [-345.238] (-346.290) -- 0:00:06
882500 -- [-345.644] (-346.393) (-348.402) (-346.183) * (-350.027) (-348.398) (-346.682) [-347.420] -- 0:00:06
883000 -- [-348.728] (-346.203) (-345.844) (-347.305) * (-348.212) [-346.652] (-351.013) (-347.349) -- 0:00:06
883500 -- (-347.647) (-347.765) (-349.889) [-347.425] * (-348.992) [-346.649] (-352.476) (-349.574) -- 0:00:06
884000 -- [-352.566] (-347.310) (-350.484) (-348.546) * (-346.679) [-345.255] (-352.839) (-347.282) -- 0:00:06
884500 -- [-346.431] (-346.369) (-348.359) (-345.998) * (-346.615) (-346.430) [-346.059] (-350.676) -- 0:00:06
885000 -- (-350.614) (-349.436) (-347.905) [-345.379] * (-346.457) (-348.578) (-346.276) [-348.482] -- 0:00:06
Average standard deviation of split frequencies: 0.004057
885500 -- (-350.741) [-346.012] (-348.129) (-348.401) * (-346.795) (-348.203) [-346.756] (-345.948) -- 0:00:06
886000 -- (-348.644) (-347.072) (-349.470) [-349.086] * [-348.364] (-345.644) (-346.941) (-347.676) -- 0:00:06
886500 -- [-347.322] (-348.356) (-347.387) (-345.342) * [-347.896] (-348.255) (-347.474) (-348.439) -- 0:00:06
887000 -- (-348.055) [-350.741] (-349.117) (-350.250) * [-347.081] (-348.261) (-345.056) (-348.008) -- 0:00:06
887500 -- [-346.946] (-346.989) (-348.030) (-347.474) * (-350.605) (-349.601) [-347.557] (-347.055) -- 0:00:06
888000 -- (-347.972) (-346.052) (-347.880) [-346.274] * [-345.842] (-347.966) (-347.350) (-353.714) -- 0:00:06
888500 -- (-349.634) [-345.847] (-346.154) (-347.978) * (-347.059) (-345.865) [-346.491] (-348.926) -- 0:00:06
889000 -- [-347.712] (-349.599) (-349.566) (-347.964) * [-346.402] (-345.459) (-346.104) (-347.019) -- 0:00:06
889500 -- [-352.647] (-349.916) (-347.566) (-353.276) * (-345.436) (-347.644) (-347.454) [-347.296] -- 0:00:06
890000 -- [-345.620] (-348.453) (-347.784) (-350.688) * (-345.295) (-347.072) (-345.701) [-347.390] -- 0:00:06
Average standard deviation of split frequencies: 0.004234
890500 -- (-347.816) (-344.892) (-348.659) [-346.085] * (-345.846) [-345.212] (-355.349) (-345.971) -- 0:00:06
891000 -- (-348.777) [-346.304] (-345.680) (-346.240) * [-349.184] (-347.266) (-349.491) (-348.159) -- 0:00:06
891500 -- (-349.947) (-346.437) [-345.918] (-351.551) * (-346.204) (-348.158) [-352.943] (-347.678) -- 0:00:06
892000 -- (-347.175) (-346.242) (-347.023) [-348.012] * [-347.994] (-347.448) (-348.209) (-348.129) -- 0:00:06
892500 -- [-345.036] (-347.801) (-345.838) (-346.613) * (-348.311) (-345.680) [-346.381] (-350.937) -- 0:00:06
893000 -- (-346.804) (-347.417) [-347.895] (-346.007) * [-346.429] (-345.676) (-351.223) (-348.038) -- 0:00:06
893500 -- (-345.359) (-347.664) (-345.818) [-346.472] * (-346.622) (-353.695) [-352.169] (-345.912) -- 0:00:06
894000 -- (-347.243) [-347.212] (-345.699) (-345.573) * (-345.936) (-350.368) (-345.823) [-345.776] -- 0:00:06
894500 -- [-346.063] (-350.617) (-345.351) (-347.244) * (-345.894) (-346.849) (-345.503) [-346.064] -- 0:00:06
895000 -- (-347.055) (-346.799) (-346.333) [-346.432] * (-346.630) (-347.258) (-346.995) [-346.134] -- 0:00:06
Average standard deviation of split frequencies: 0.003716
895500 -- (-345.665) (-348.053) [-349.168] (-346.266) * (-351.035) [-345.712] (-345.186) (-348.725) -- 0:00:06
896000 -- (-345.857) [-347.811] (-352.284) (-346.828) * [-346.502] (-352.898) (-348.572) (-346.574) -- 0:00:06
896500 -- (-347.232) [-345.149] (-351.604) (-346.107) * (-346.200) (-347.394) [-347.187] (-349.708) -- 0:00:06
897000 -- [-348.408] (-347.367) (-348.770) (-346.465) * [-347.279] (-345.949) (-345.994) (-348.379) -- 0:00:06
897500 -- (-348.964) (-346.926) [-345.823] (-345.701) * (-346.508) [-345.622] (-345.967) (-346.293) -- 0:00:06
898000 -- (-349.622) (-348.085) [-346.782] (-346.577) * (-344.864) (-346.923) [-345.534] (-348.651) -- 0:00:06
898500 -- (-346.907) (-346.420) (-347.239) [-346.108] * [-346.675] (-346.601) (-346.100) (-345.690) -- 0:00:05
899000 -- [-346.275] (-346.312) (-347.223) (-346.960) * [-348.124] (-347.580) (-349.852) (-346.779) -- 0:00:05
899500 -- (-350.677) [-346.797] (-347.100) (-346.766) * (-345.565) (-346.603) (-346.316) [-349.581] -- 0:00:05
900000 -- (-352.326) [-348.401] (-345.903) (-348.157) * (-352.548) (-347.344) (-346.283) [-345.249] -- 0:00:05
Average standard deviation of split frequencies: 0.003978
900500 -- (-352.123) (-347.434) (-349.042) [-347.217] * (-346.327) [-346.444] (-347.167) (-347.635) -- 0:00:05
901000 -- (-346.924) (-346.298) [-345.767] (-347.819) * (-346.931) [-346.890] (-348.935) (-347.817) -- 0:00:05
901500 -- (-346.675) (-346.696) (-347.175) [-347.753] * (-345.189) (-346.931) [-349.013] (-348.995) -- 0:00:05
902000 -- (-347.208) [-346.554] (-349.693) (-348.375) * (-345.718) (-346.145) (-348.716) [-346.479] -- 0:00:05
902500 -- [-345.297] (-346.218) (-347.627) (-346.382) * [-345.928] (-347.629) (-345.309) (-349.187) -- 0:00:05
903000 -- [-345.655] (-348.189) (-346.664) (-347.963) * (-348.012) (-346.126) [-347.251] (-348.322) -- 0:00:05
903500 -- [-346.398] (-347.989) (-346.167) (-347.017) * (-347.041) (-345.659) (-346.407) [-346.178] -- 0:00:05
904000 -- (-349.921) (-349.187) [-348.317] (-347.396) * (-345.104) (-346.855) (-345.178) [-348.027] -- 0:00:05
904500 -- (-347.314) [-348.282] (-347.991) (-350.363) * [-346.289] (-346.580) (-347.155) (-345.112) -- 0:00:05
905000 -- (-349.799) (-347.846) (-347.415) [-348.384] * (-346.142) [-346.870] (-346.943) (-345.058) -- 0:00:05
Average standard deviation of split frequencies: 0.004197
905500 -- (-349.665) (-347.716) [-348.864] (-347.643) * (-347.505) [-346.218] (-345.548) (-345.614) -- 0:00:05
906000 -- (-347.994) [-346.594] (-348.786) (-346.130) * (-346.401) (-346.091) [-345.071] (-349.244) -- 0:00:05
906500 -- (-347.857) [-347.146] (-350.562) (-345.156) * (-353.171) (-346.168) [-345.787] (-347.772) -- 0:00:05
907000 -- (-347.665) (-346.471) (-345.119) [-348.032] * (-350.365) (-346.664) [-346.985] (-347.543) -- 0:00:05
907500 -- (-346.909) [-346.237] (-345.172) (-350.987) * [-346.977] (-346.350) (-347.457) (-349.887) -- 0:00:05
908000 -- [-347.811] (-346.989) (-345.817) (-349.243) * [-346.942] (-346.155) (-346.417) (-348.119) -- 0:00:05
908500 -- [-345.897] (-350.674) (-346.700) (-351.790) * (-346.869) [-348.634] (-347.915) (-349.458) -- 0:00:05
909000 -- (-348.708) (-353.149) (-347.052) [-346.615] * (-349.941) (-348.413) (-346.901) [-346.101] -- 0:00:05
909500 -- (-347.530) (-348.107) (-347.186) [-347.518] * [-351.414] (-346.722) (-347.307) (-348.575) -- 0:00:05
910000 -- (-347.391) [-348.165] (-349.417) (-348.284) * (-345.679) (-349.264) [-349.759] (-344.970) -- 0:00:05
Average standard deviation of split frequencies: 0.003831
910500 -- (-347.330) (-346.241) (-346.737) [-349.489] * (-345.312) (-353.434) (-346.992) [-346.296] -- 0:00:05
911000 -- (-347.959) (-347.566) (-345.276) [-349.415] * (-345.707) [-347.577] (-348.425) (-347.308) -- 0:00:05
911500 -- (-345.272) (-348.273) [-347.124] (-348.429) * (-346.536) [-348.534] (-345.602) (-348.981) -- 0:00:05
912000 -- (-345.675) (-352.536) [-345.963] (-346.669) * (-345.870) (-349.855) (-346.194) [-352.873] -- 0:00:05
912500 -- (-347.324) [-347.781] (-346.474) (-350.088) * [-346.998] (-353.379) (-345.664) (-346.565) -- 0:00:05
913000 -- (-345.973) (-350.073) [-347.581] (-346.203) * (-348.957) (-347.298) [-345.329] (-350.174) -- 0:00:05
913500 -- (-345.957) (-346.468) (-347.976) [-346.415] * (-347.339) (-346.021) (-346.756) [-347.597] -- 0:00:05
914000 -- (-348.007) (-345.877) (-345.004) [-348.452] * (-346.453) (-345.690) (-348.071) [-345.202] -- 0:00:05
914500 -- (-346.866) (-348.598) [-347.164] (-348.944) * [-348.819] (-346.809) (-349.333) (-346.542) -- 0:00:05
915000 -- (-349.670) [-346.285] (-348.989) (-350.770) * [-347.323] (-347.482) (-346.007) (-345.642) -- 0:00:05
Average standard deviation of split frequencies: 0.003980
915500 -- [-346.835] (-347.829) (-347.578) (-345.408) * [-349.625] (-345.106) (-345.395) (-346.900) -- 0:00:04
916000 -- (-346.596) (-349.030) [-345.526] (-346.600) * (-348.441) (-349.310) [-348.682] (-347.308) -- 0:00:04
916500 -- [-346.965] (-348.639) (-350.727) (-355.405) * (-346.128) [-349.147] (-346.527) (-349.063) -- 0:00:04
917000 -- (-347.935) [-350.018] (-348.680) (-354.205) * (-346.057) [-347.022] (-348.845) (-347.942) -- 0:00:04
917500 -- (-346.475) (-345.789) [-350.144] (-347.162) * (-347.235) [-346.339] (-348.628) (-350.680) -- 0:00:04
918000 -- (-349.313) (-346.665) (-354.280) [-345.195] * (-347.453) (-346.370) [-347.372] (-346.886) -- 0:00:04
918500 -- (-345.981) (-347.911) [-347.279] (-345.277) * (-347.516) [-347.443] (-350.885) (-347.121) -- 0:00:04
919000 -- (-347.481) [-345.625] (-346.245) (-348.718) * [-349.859] (-345.806) (-345.546) (-347.739) -- 0:00:04
919500 -- [-348.076] (-346.725) (-348.768) (-346.570) * (-349.178) (-348.275) (-346.766) [-346.803] -- 0:00:04
920000 -- (-349.145) [-346.173] (-352.615) (-348.281) * (-347.477) [-350.442] (-346.078) (-345.396) -- 0:00:04
Average standard deviation of split frequencies: 0.004267
920500 -- (-350.213) [-346.219] (-347.899) (-346.385) * [-346.657] (-346.429) (-350.916) (-345.651) -- 0:00:04
921000 -- [-350.192] (-345.479) (-350.433) (-346.177) * (-348.027) [-347.917] (-346.940) (-346.942) -- 0:00:04
921500 -- (-347.413) (-348.072) [-347.119] (-346.722) * (-346.525) (-346.446) (-347.976) [-347.101] -- 0:00:04
922000 -- (-351.908) (-345.691) (-346.004) [-346.579] * [-348.167] (-345.972) (-349.128) (-349.323) -- 0:00:04
922500 -- (-346.189) [-346.712] (-347.541) (-350.334) * (-347.030) (-346.147) (-349.537) [-346.007] -- 0:00:04
923000 -- (-346.317) [-350.389] (-346.779) (-347.529) * [-346.134] (-345.458) (-346.117) (-346.596) -- 0:00:04
923500 -- (-347.827) [-347.118] (-348.129) (-346.633) * [-347.833] (-346.787) (-350.921) (-349.712) -- 0:00:04
924000 -- (-347.150) [-350.126] (-346.733) (-345.677) * (-348.482) (-348.499) (-347.117) [-346.996] -- 0:00:04
924500 -- (-347.867) [-347.366] (-349.057) (-345.771) * [-345.614] (-349.313) (-346.130) (-344.996) -- 0:00:04
925000 -- (-346.467) (-346.834) (-347.019) [-346.483] * [-348.594] (-346.830) (-350.424) (-349.104) -- 0:00:04
Average standard deviation of split frequencies: 0.004104
925500 -- (-346.757) (-349.218) (-349.076) [-348.440] * [-345.458] (-349.169) (-350.422) (-351.465) -- 0:00:04
926000 -- (-345.386) (-350.199) (-351.901) [-345.722] * [-346.547] (-348.891) (-348.753) (-347.550) -- 0:00:04
926500 -- (-348.421) [-347.059] (-346.044) (-346.478) * (-345.640) (-352.121) (-347.986) [-345.688] -- 0:00:04
927000 -- [-347.242] (-345.601) (-347.017) (-345.543) * (-347.009) (-348.383) (-349.209) [-346.233] -- 0:00:04
927500 -- (-346.631) (-345.521) [-345.847] (-347.580) * (-348.736) (-347.979) [-349.126] (-346.519) -- 0:00:04
928000 -- (-349.412) [-345.768] (-345.317) (-346.833) * (-349.182) (-348.610) (-350.472) [-347.133] -- 0:00:04
928500 -- (-346.560) (-346.520) [-346.258] (-346.206) * (-348.801) (-346.227) [-347.913] (-349.851) -- 0:00:04
929000 -- (-348.387) [-353.061] (-346.584) (-345.793) * (-347.666) (-346.492) [-346.272] (-352.183) -- 0:00:04
929500 -- [-346.371] (-348.993) (-347.364) (-346.282) * (-345.171) (-349.201) (-346.508) [-347.642] -- 0:00:04
930000 -- (-345.636) (-347.430) [-350.471] (-346.564) * (-344.862) (-349.692) (-346.832) [-345.731] -- 0:00:04
Average standard deviation of split frequencies: 0.004390
930500 -- [-353.175] (-348.822) (-345.895) (-346.098) * (-349.522) (-347.084) [-346.605] (-348.547) -- 0:00:04
931000 -- (-347.079) (-347.897) (-346.618) [-345.365] * (-345.486) (-345.826) (-354.846) [-347.700] -- 0:00:04
931500 -- [-346.339] (-346.747) (-345.674) (-345.071) * (-348.732) (-346.138) [-347.310] (-346.839) -- 0:00:04
932000 -- [-345.276] (-346.321) (-349.155) (-346.478) * [-346.425] (-346.319) (-346.825) (-353.440) -- 0:00:04
932500 -- (-351.696) (-346.172) [-346.272] (-348.813) * (-347.428) [-346.049] (-351.493) (-351.140) -- 0:00:03
933000 -- (-354.484) [-346.087] (-349.398) (-346.760) * [-345.334] (-348.373) (-349.502) (-351.246) -- 0:00:03
933500 -- (-346.110) [-347.776] (-347.747) (-345.648) * (-345.962) [-348.922] (-348.438) (-347.719) -- 0:00:03
934000 -- [-346.352] (-348.384) (-346.246) (-345.640) * (-351.152) [-346.562] (-350.101) (-349.424) -- 0:00:03
934500 -- [-346.335] (-346.862) (-348.976) (-347.507) * (-347.126) [-347.302] (-353.796) (-346.372) -- 0:00:03
935000 -- [-345.159] (-348.614) (-345.831) (-346.380) * [-350.784] (-349.865) (-348.151) (-346.625) -- 0:00:03
Average standard deviation of split frequencies: 0.004398
935500 -- (-346.325) [-345.450] (-350.973) (-346.681) * (-345.346) (-346.668) [-350.222] (-350.717) -- 0:00:03
936000 -- (-346.583) (-345.426) (-347.355) [-346.975] * (-350.468) (-349.700) [-346.590] (-348.256) -- 0:00:03
936500 -- (-346.000) (-346.632) [-345.188] (-351.204) * (-348.162) (-348.005) (-347.777) [-347.795] -- 0:00:03
937000 -- (-345.001) (-346.424) [-348.483] (-350.987) * [-349.620] (-352.851) (-349.010) (-345.253) -- 0:00:03
937500 -- (-350.810) [-347.651] (-346.280) (-346.423) * (-345.555) (-349.208) [-347.606] (-351.094) -- 0:00:03
938000 -- (-348.337) (-350.448) (-349.649) [-346.377] * [-344.707] (-347.560) (-348.053) (-348.796) -- 0:00:03
938500 -- [-345.807] (-345.546) (-346.654) (-346.947) * [-346.223] (-346.087) (-346.176) (-346.285) -- 0:00:03
939000 -- (-348.163) (-345.211) [-347.043] (-345.493) * (-352.348) (-345.587) (-346.456) [-345.078] -- 0:00:03
939500 -- (-345.943) (-348.589) (-346.910) [-345.477] * (-347.788) (-345.591) [-347.076] (-345.895) -- 0:00:03
940000 -- (-345.732) (-349.694) [-351.852] (-345.058) * [-346.763] (-346.324) (-348.436) (-346.829) -- 0:00:03
Average standard deviation of split frequencies: 0.003942
940500 -- [-346.324] (-353.073) (-352.992) (-349.361) * [-346.179] (-345.250) (-352.281) (-346.550) -- 0:00:03
941000 -- [-346.672] (-347.679) (-347.380) (-345.331) * (-347.655) [-349.776] (-346.782) (-350.422) -- 0:00:03
941500 -- [-345.898] (-345.480) (-346.197) (-346.022) * [-346.127] (-350.389) (-347.815) (-347.469) -- 0:00:03
942000 -- (-347.187) [-345.985] (-346.432) (-347.657) * (-355.255) (-347.818) (-346.536) [-345.933] -- 0:00:03
942500 -- (-348.597) [-347.667] (-346.390) (-347.911) * (-348.655) (-347.027) [-350.044] (-348.729) -- 0:00:03
943000 -- (-350.420) [-346.790] (-349.564) (-345.855) * (-348.025) [-345.795] (-351.843) (-347.917) -- 0:00:03
943500 -- (-346.444) (-346.515) [-348.755] (-351.203) * (-350.511) (-345.711) (-353.498) [-347.337] -- 0:00:03
944000 -- (-345.921) (-350.583) (-347.634) [-345.446] * (-352.342) (-347.013) (-346.438) [-346.951] -- 0:00:03
944500 -- (-347.429) [-345.880] (-346.342) (-347.165) * (-347.863) [-346.298] (-346.842) (-349.395) -- 0:00:03
945000 -- (-345.633) [-345.304] (-348.033) (-347.533) * [-344.805] (-347.493) (-346.013) (-345.763) -- 0:00:03
Average standard deviation of split frequencies: 0.004086
945500 -- (-345.578) [-346.379] (-347.779) (-345.592) * (-345.915) (-345.154) (-345.169) [-345.690] -- 0:00:03
946000 -- (-346.455) (-345.543) [-346.161] (-347.876) * (-350.591) [-346.188] (-346.044) (-352.476) -- 0:00:03
946500 -- (-348.168) (-346.074) (-351.596) [-345.799] * (-346.308) [-349.542] (-347.960) (-348.080) -- 0:00:03
947000 -- (-349.475) (-345.792) (-348.481) [-345.917] * [-345.840] (-345.045) (-349.452) (-347.654) -- 0:00:03
947500 -- (-347.989) [-346.311] (-344.996) (-348.583) * (-347.411) (-345.760) (-350.761) [-347.482] -- 0:00:03
948000 -- (-347.120) [-348.230] (-349.358) (-347.102) * (-347.199) [-346.461] (-345.162) (-346.385) -- 0:00:03
948500 -- (-347.140) (-348.748) (-347.828) [-345.907] * (-347.642) (-348.026) [-344.832] (-346.899) -- 0:00:03
949000 -- [-346.940] (-345.706) (-348.247) (-346.083) * (-348.667) [-348.790] (-348.136) (-348.447) -- 0:00:03
949500 -- [-345.577] (-347.914) (-346.397) (-347.014) * (-349.880) (-345.534) (-347.494) [-345.957] -- 0:00:02
950000 -- (-350.077) (-346.754) (-346.669) [-349.003] * (-349.072) [-346.695] (-347.522) (-349.012) -- 0:00:02
Average standard deviation of split frequencies: 0.004198
950500 -- (-347.662) [-346.303] (-347.679) (-346.888) * (-348.982) (-345.861) [-345.704] (-350.384) -- 0:00:02
951000 -- (-349.187) [-347.604] (-347.738) (-347.333) * (-346.878) (-346.811) [-346.060] (-349.777) -- 0:00:02
951500 -- (-347.939) [-345.917] (-346.451) (-348.138) * [-345.729] (-345.628) (-345.666) (-345.270) -- 0:00:02
952000 -- (-348.813) (-348.141) [-346.054] (-347.552) * (-350.453) [-345.673] (-345.776) (-347.309) -- 0:00:02
952500 -- (-346.081) (-346.729) [-346.663] (-349.298) * (-345.782) (-346.253) [-345.272] (-355.176) -- 0:00:02
953000 -- (-345.118) [-345.747] (-346.118) (-350.512) * (-346.250) (-346.301) (-346.159) [-346.997] -- 0:00:02
953500 -- (-346.927) [-347.799] (-350.459) (-346.856) * [-347.528] (-347.149) (-349.428) (-345.978) -- 0:00:02
954000 -- (-347.448) (-350.142) [-347.039] (-347.687) * (-349.403) (-348.990) [-346.635] (-345.087) -- 0:00:02
954500 -- [-346.204] (-350.760) (-348.547) (-347.535) * (-350.084) [-347.594] (-350.691) (-347.559) -- 0:00:02
955000 -- (-348.560) (-350.465) (-346.910) [-348.920] * (-348.380) (-346.774) [-349.912] (-347.969) -- 0:00:02
Average standard deviation of split frequencies: 0.004208
955500 -- (-346.428) (-347.403) (-349.687) [-348.535] * (-347.796) [-344.909] (-347.625) (-350.413) -- 0:00:02
956000 -- (-345.454) (-346.141) [-346.092] (-348.986) * (-347.341) [-345.614] (-345.441) (-346.166) -- 0:00:02
956500 -- (-347.458) (-347.207) [-345.405] (-355.620) * (-351.676) [-347.851] (-345.919) (-346.321) -- 0:00:02
957000 -- (-348.191) (-347.740) [-345.185] (-348.452) * (-351.593) [-348.596] (-346.207) (-346.656) -- 0:00:02
957500 -- (-351.101) (-348.304) [-345.264] (-353.542) * (-345.476) [-347.541] (-347.014) (-346.348) -- 0:00:02
958000 -- (-349.642) (-346.578) (-346.177) [-345.781] * [-345.654] (-346.553) (-348.597) (-347.890) -- 0:00:02
958500 -- (-350.060) (-345.878) (-347.823) [-347.857] * [-346.978] (-349.283) (-347.271) (-347.413) -- 0:00:02
959000 -- (-348.391) (-349.185) (-346.615) [-346.496] * (-347.582) (-349.531) [-345.605] (-345.670) -- 0:00:02
959500 -- [-346.649] (-346.540) (-348.025) (-345.940) * (-348.006) [-350.584] (-348.394) (-347.589) -- 0:00:02
960000 -- (-347.157) (-350.354) [-347.418] (-345.680) * (-348.659) [-347.496] (-347.692) (-347.487) -- 0:00:02
Average standard deviation of split frequencies: 0.004384
960500 -- (-346.019) (-348.873) [-346.895] (-346.331) * (-347.547) [-345.881] (-347.259) (-347.861) -- 0:00:02
961000 -- (-348.224) (-350.823) [-346.727] (-346.360) * [-347.074] (-347.272) (-347.138) (-347.718) -- 0:00:02
961500 -- (-346.784) (-357.396) [-346.939] (-346.310) * (-347.404) (-345.313) (-346.816) [-345.516] -- 0:00:02
962000 -- (-348.063) [-351.191] (-347.780) (-348.437) * [-350.492] (-346.718) (-346.431) (-348.559) -- 0:00:02
962500 -- [-346.040] (-351.665) (-346.064) (-348.865) * (-346.993) (-345.991) [-346.611] (-352.017) -- 0:00:02
963000 -- (-346.213) [-349.278] (-345.905) (-348.670) * (-348.191) (-345.801) [-345.697] (-350.910) -- 0:00:02
963500 -- (-347.947) (-348.335) (-347.562) [-346.837] * (-348.816) [-347.589] (-349.299) (-345.890) -- 0:00:02
964000 -- (-346.117) [-347.895] (-347.182) (-346.187) * (-346.060) (-346.420) [-345.666] (-348.960) -- 0:00:02
964500 -- (-345.075) [-346.785] (-345.945) (-348.659) * [-346.325] (-346.903) (-345.957) (-345.864) -- 0:00:02
965000 -- (-348.502) (-350.232) (-346.727) [-345.718] * (-346.651) (-349.709) (-347.859) [-345.227] -- 0:00:02
Average standard deviation of split frequencies: 0.004359
965500 -- [-346.824] (-345.965) (-346.170) (-349.158) * (-350.234) (-350.633) [-347.162] (-346.467) -- 0:00:02
966000 -- (-344.863) [-347.486] (-347.509) (-354.184) * (-346.991) (-347.694) (-347.825) [-346.258] -- 0:00:02
966500 -- (-345.105) (-345.396) [-347.265] (-348.354) * [-345.692] (-350.405) (-350.119) (-348.199) -- 0:00:01
967000 -- (-347.215) [-346.790] (-346.495) (-350.689) * [-347.734] (-350.094) (-347.957) (-347.656) -- 0:00:01
967500 -- (-346.207) (-347.051) (-347.601) [-345.604] * (-349.380) (-347.334) (-346.440) [-348.349] -- 0:00:01
968000 -- [-345.986] (-350.938) (-348.205) (-345.089) * (-345.970) [-346.627] (-348.039) (-345.460) -- 0:00:01
968500 -- [-345.074] (-346.834) (-347.425) (-350.205) * (-344.938) (-345.755) (-346.265) [-347.010] -- 0:00:01
969000 -- (-346.854) (-346.399) [-346.516] (-346.236) * (-348.732) [-349.514] (-351.148) (-346.515) -- 0:00:01
969500 -- (-346.455) (-345.507) [-346.008] (-354.754) * (-349.774) (-349.786) (-346.459) [-346.032] -- 0:00:01
970000 -- (-348.609) [-345.568] (-345.461) (-350.147) * (-346.101) (-346.399) [-346.839] (-348.929) -- 0:00:01
Average standard deviation of split frequencies: 0.004371
970500 -- (-346.240) (-345.023) (-346.847) [-347.079] * [-348.187] (-345.116) (-348.381) (-350.295) -- 0:00:01
971000 -- (-346.478) (-345.405) [-347.633] (-346.069) * (-350.309) (-345.871) [-346.276] (-353.561) -- 0:00:01
971500 -- (-346.339) [-346.573] (-347.906) (-346.298) * (-347.550) (-346.990) (-348.908) [-348.376] -- 0:00:01
972000 -- (-349.633) [-346.475] (-346.952) (-346.641) * (-345.906) (-347.625) [-352.782] (-349.525) -- 0:00:01
972500 -- (-350.441) (-347.136) [-349.463] (-347.817) * (-347.861) (-346.687) [-349.372] (-350.896) -- 0:00:01
973000 -- (-345.933) (-350.484) [-348.836] (-348.858) * [-347.425] (-348.290) (-346.354) (-346.623) -- 0:00:01
973500 -- (-347.952) (-350.593) (-352.862) [-349.934] * (-346.552) (-348.170) [-345.345] (-344.923) -- 0:00:01
974000 -- [-346.148] (-345.269) (-349.017) (-348.785) * [-345.066] (-349.022) (-350.429) (-349.115) -- 0:00:01
974500 -- (-347.049) [-346.806] (-347.029) (-349.387) * (-346.037) [-350.816] (-348.748) (-349.501) -- 0:00:01
975000 -- (-349.136) [-346.798] (-346.338) (-348.085) * [-347.031] (-348.561) (-346.666) (-347.539) -- 0:00:01
Average standard deviation of split frequencies: 0.004347
975500 -- (-350.463) (-351.140) [-345.467] (-349.850) * [-347.471] (-346.224) (-346.705) (-345.744) -- 0:00:01
976000 -- (-350.474) (-352.008) (-345.301) [-346.344] * (-350.823) [-346.210] (-347.727) (-346.590) -- 0:00:01
976500 -- (-346.564) (-349.203) (-348.081) [-346.153] * [-348.319] (-346.982) (-347.878) (-347.880) -- 0:00:01
977000 -- (-346.425) (-347.099) [-347.161] (-346.429) * (-346.575) [-346.085] (-348.224) (-346.611) -- 0:00:01
977500 -- (-344.861) (-347.269) (-347.327) [-346.499] * (-347.982) (-347.107) (-345.895) [-347.499] -- 0:00:01
978000 -- [-346.455] (-348.820) (-349.471) (-347.458) * (-345.972) (-347.658) (-346.955) [-346.697] -- 0:00:01
978500 -- (-349.788) [-348.268] (-346.162) (-346.282) * (-346.172) [-346.928] (-346.744) (-349.279) -- 0:00:01
979000 -- (-347.956) (-351.470) (-346.237) [-346.019] * (-346.203) (-351.211) [-347.396] (-354.715) -- 0:00:01
979500 -- [-347.798] (-347.107) (-347.176) (-349.438) * (-346.415) (-348.303) [-346.317] (-347.746) -- 0:00:01
980000 -- [-346.986] (-346.020) (-347.543) (-347.356) * (-345.133) (-347.035) [-346.034] (-350.310) -- 0:00:01
Average standard deviation of split frequencies: 0.004999
980500 -- (-348.635) [-346.048] (-346.086) (-345.890) * (-348.470) [-352.151] (-347.323) (-345.882) -- 0:00:01
981000 -- (-349.723) [-348.992] (-347.773) (-354.095) * (-350.414) (-348.384) (-347.009) [-345.610] -- 0:00:01
981500 -- (-346.057) (-345.530) [-347.134] (-349.301) * (-351.216) [-347.135] (-346.705) (-346.130) -- 0:00:01
982000 -- (-346.514) [-346.691] (-347.376) (-347.449) * (-349.587) (-345.677) [-347.468] (-348.326) -- 0:00:01
982500 -- [-345.695] (-346.695) (-349.004) (-347.290) * (-348.836) [-346.738] (-345.797) (-346.209) -- 0:00:01
983000 -- [-346.756] (-346.075) (-347.520) (-345.211) * [-347.455] (-348.403) (-347.001) (-345.998) -- 0:00:01
983500 -- (-350.334) (-345.033) [-345.135] (-346.465) * [-345.728] (-348.422) (-350.658) (-347.108) -- 0:00:00
984000 -- (-345.424) (-349.880) [-345.649] (-346.611) * (-345.622) (-345.402) (-353.305) [-346.044] -- 0:00:00
984500 -- [-345.031] (-348.291) (-348.566) (-347.051) * (-347.990) (-349.112) (-355.759) [-348.310] -- 0:00:00
985000 -- (-355.039) (-347.461) [-349.952] (-346.362) * (-346.451) (-349.460) (-349.800) [-351.226] -- 0:00:00
Average standard deviation of split frequencies: 0.004717
985500 -- (-351.019) (-345.600) [-348.228] (-349.464) * (-347.125) [-348.216] (-344.958) (-347.276) -- 0:00:00
986000 -- (-348.163) (-347.115) [-346.629] (-345.808) * [-346.655] (-351.101) (-346.454) (-347.509) -- 0:00:00
986500 -- (-347.999) (-346.459) [-346.856] (-344.876) * (-346.959) [-346.622] (-349.787) (-347.490) -- 0:00:00
987000 -- [-346.432] (-347.905) (-352.060) (-345.814) * (-347.302) (-347.832) (-346.857) [-345.920] -- 0:00:00
987500 -- [-347.414] (-346.620) (-347.809) (-346.081) * (-348.619) (-347.259) [-349.210] (-347.104) -- 0:00:00
988000 -- (-349.604) [-347.494] (-348.735) (-347.986) * [-350.213] (-347.016) (-348.032) (-345.389) -- 0:00:00
988500 -- (-349.609) (-346.828) (-348.554) [-346.875] * (-349.656) [-348.821] (-347.719) (-348.972) -- 0:00:00
989000 -- (-347.431) [-347.239] (-345.151) (-345.984) * (-349.675) [-345.176] (-349.933) (-345.996) -- 0:00:00
989500 -- (-349.206) (-348.123) [-345.185] (-347.662) * [-345.739] (-347.328) (-349.635) (-348.022) -- 0:00:00
990000 -- [-346.288] (-346.303) (-345.462) (-347.808) * (-345.650) [-347.820] (-351.108) (-356.109) -- 0:00:00
Average standard deviation of split frequencies: 0.004727
990500 -- (-349.034) (-347.969) (-350.987) [-345.932] * (-346.632) [-352.238] (-351.003) (-355.495) -- 0:00:00
991000 -- (-349.522) (-349.332) (-349.036) [-346.238] * (-346.313) (-346.965) (-349.803) [-349.454] -- 0:00:00
991500 -- [-346.167] (-346.739) (-349.325) (-348.097) * (-347.357) (-347.166) [-347.504] (-346.682) -- 0:00:00
992000 -- (-346.421) (-345.889) (-347.564) [-345.429] * [-346.819] (-348.684) (-347.610) (-344.879) -- 0:00:00
992500 -- [-347.252] (-347.711) (-348.119) (-348.740) * [-345.580] (-350.177) (-346.462) (-347.757) -- 0:00:00
993000 -- (-346.928) (-345.234) [-345.674] (-354.710) * (-345.704) (-350.306) [-346.052] (-346.378) -- 0:00:00
993500 -- [-347.621] (-347.826) (-346.722) (-349.502) * (-345.318) (-350.905) [-348.553] (-345.481) -- 0:00:00
994000 -- (-347.336) (-352.417) [-346.331] (-347.550) * [-351.041] (-347.133) (-347.858) (-346.339) -- 0:00:00
994500 -- [-350.118] (-350.469) (-351.939) (-347.157) * (-345.802) (-348.474) [-346.790] (-354.118) -- 0:00:00
995000 -- (-345.085) (-349.181) [-347.921] (-345.534) * (-348.493) (-349.065) [-346.230] (-348.888) -- 0:00:00
Average standard deviation of split frequencies: 0.004796
995500 -- (-345.299) (-353.893) (-347.215) [-345.123] * (-349.207) [-346.730] (-347.542) (-345.611) -- 0:00:00
996000 -- (-348.113) (-348.739) [-345.106] (-350.797) * (-351.783) [-350.432] (-347.615) (-347.584) -- 0:00:00
996500 -- (-347.377) (-347.241) (-346.273) [-346.360] * [-346.491] (-346.169) (-349.244) (-344.762) -- 0:00:00
997000 -- (-348.314) [-348.752] (-346.155) (-347.640) * [-348.972] (-345.987) (-349.809) (-346.644) -- 0:00:00
997500 -- [-345.892] (-348.481) (-347.324) (-346.509) * [-345.999] (-347.623) (-346.398) (-346.076) -- 0:00:00
998000 -- (-346.561) (-347.819) [-345.085] (-348.676) * (-352.471) (-345.261) (-347.769) [-345.525] -- 0:00:00
998500 -- [-347.824] (-347.322) (-350.094) (-348.689) * (-347.109) (-347.976) [-346.655] (-347.001) -- 0:00:00
999000 -- (-346.561) [-345.441] (-347.985) (-347.443) * (-352.758) (-348.504) [-345.643] (-346.191) -- 0:00:00
999500 -- (-348.289) (-346.897) (-348.773) [-346.449] * (-346.068) (-346.383) [-346.165] (-348.164) -- 0:00:00
1000000 -- (-350.438) (-346.528) (-349.727) [-348.375] * (-345.879) (-352.657) [-346.605] (-350.693) -- 0:00:00
Average standard deviation of split frequencies: 0.004931
Analysis completed in 59 seconds
Analysis used 57.96 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -344.67
Likelihood of best state for "cold" chain of run 2 was -344.67
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.6 % ( 51 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
42.9 % ( 36 %) Dirichlet(Pi{all})
41.2 % ( 31 %) Slider(Pi{all})
78.9 % ( 46 %) Multiplier(Alpha{1,2})
77.7 % ( 58 %) Multiplier(Alpha{3})
26.1 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.2 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 75 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
43.8 % ( 36 %) Dirichlet(Pi{all})
40.6 % ( 25 %) Slider(Pi{all})
78.8 % ( 44 %) Multiplier(Alpha{1,2})
77.7 % ( 49 %) Multiplier(Alpha{3})
26.1 % ( 29 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.4 % ( 71 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 87 %) ParsSPR(Tau{all},V{all})
28.1 % ( 25 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.4 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167050 0.82 0.67
3 | 166441 166664 0.84
4 | 166650 166833 166362
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166808 0.82 0.67
3 | 166578 166840 0.84
4 | 166812 166701 166261
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -346.38
| 1 1 |
| 2 |
| 1 |
|1 2 2 1 2 2 2 11|
| 112 1 1 |
| 2 2 1 1 112 2 1 2 1 11 2 21 * |
| 2 1 2 1 2 2 2 2 1 11 21 1 |
| 1 1 2 * 1 1 1 12 2 22 1 |
| 1 1 2 1 2 * 2 2 2 |
| 2* 2 * 12 2 12 11 1 1 2* 2 2 |
| 2 2 * 1 1 2 1 |
| 1 2 2 * |
| 1 1 2 2 1 2 2|
|2 1 1 |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -347.85
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.35 -349.60
2 -346.41 -350.34
--------------------------------------
TOTAL -346.38 -350.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891688 0.085073 0.356749 1.456219 0.857652 1501.00 1501.00 1.000
r(A<->C){all} 0.163578 0.019820 0.000004 0.447294 0.125445 239.09 268.30 1.003
r(A<->G){all} 0.153608 0.017010 0.000065 0.413415 0.120591 294.70 302.57 1.000
r(A<->T){all} 0.168778 0.020235 0.000114 0.446384 0.129499 112.60 214.64 1.001
r(C<->G){all} 0.176389 0.021631 0.000029 0.469762 0.139827 172.71 217.06 1.000
r(C<->T){all} 0.159868 0.018998 0.000032 0.448835 0.122190 76.14 136.16 1.002
r(G<->T){all} 0.177778 0.022557 0.000142 0.482849 0.137699 107.75 187.89 1.000
pi(A){all} 0.222996 0.000665 0.174482 0.273642 0.222187 1241.26 1278.82 1.002
pi(C){all} 0.284948 0.000774 0.230220 0.339884 0.284163 1210.33 1339.70 1.002
pi(G){all} 0.304901 0.000799 0.254981 0.363897 0.304171 1167.76 1212.86 1.000
pi(T){all} 0.187155 0.000582 0.137818 0.233558 0.186173 1245.30 1307.28 1.000
alpha{1,2} 0.414892 0.225222 0.000101 1.402263 0.240039 1250.75 1295.44 1.001
alpha{3} 0.465595 0.235729 0.000476 1.429992 0.301062 1206.20 1255.29 1.000
pinvar{all} 0.993538 0.000061 0.979035 0.999998 0.995911 1134.97 1218.12 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- ...**.
9 -- ..****
10 -- .**...
11 -- .**.**
12 -- .*..*.
13 -- ...*.*
14 -- ..*.*.
15 -- .***.*
16 -- ....**
17 -- .*.***
18 -- .*.*..
19 -- .*...*
20 -- .****.
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 469 0.156229 0.003298 0.153897 0.158561 2
8 460 0.153231 0.007537 0.147901 0.158561 2
9 451 0.150233 0.000471 0.149900 0.150566 2
10 449 0.149567 0.008951 0.143238 0.155896 2
11 442 0.147235 0.002827 0.145237 0.149234 2
12 433 0.144237 0.002355 0.142572 0.145903 2
13 433 0.144237 0.002355 0.142572 0.145903 2
14 422 0.140573 0.014133 0.130580 0.150566 2
15 420 0.139907 0.004711 0.136576 0.143238 2
16 420 0.139907 0.004711 0.136576 0.143238 2
17 418 0.139241 0.006595 0.134577 0.143904 2
18 415 0.138241 0.005182 0.134577 0.141905 2
19 405 0.134910 0.000471 0.134577 0.135243 2
20 394 0.131246 0.003769 0.128581 0.133911 2
21 390 0.129913 0.006595 0.125250 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.102113 0.010569 0.000013 0.311138 0.071204 1.001 2
length{all}[2] 0.100134 0.010193 0.000003 0.301228 0.068391 1.000 2
length{all}[3] 0.098268 0.009828 0.000020 0.295132 0.067747 1.000 2
length{all}[4] 0.098071 0.009958 0.000013 0.297830 0.067311 1.000 2
length{all}[5] 0.097204 0.009576 0.000017 0.293710 0.064292 1.001 2
length{all}[6] 0.098850 0.009976 0.000048 0.291159 0.069642 1.000 2
length{all}[7] 0.090361 0.007519 0.000122 0.290988 0.064668 1.000 2
length{all}[8] 0.100930 0.009870 0.000090 0.288254 0.067386 0.999 2
length{all}[9] 0.099570 0.008408 0.001648 0.293339 0.071655 1.002 2
length{all}[10] 0.095292 0.008143 0.000430 0.281630 0.069867 0.998 2
length{all}[11] 0.098464 0.008669 0.000079 0.315221 0.071914 0.999 2
length{all}[12] 0.104756 0.010371 0.000481 0.302647 0.075393 0.998 2
length{all}[13] 0.096861 0.010430 0.000441 0.305606 0.062989 1.001 2
length{all}[14] 0.106602 0.009886 0.000893 0.305661 0.081546 0.998 2
length{all}[15] 0.094605 0.008747 0.000191 0.292596 0.064900 0.999 2
length{all}[16] 0.098176 0.008900 0.000000 0.281877 0.074202 1.000 2
length{all}[17] 0.107777 0.010065 0.000084 0.298133 0.082714 0.998 2
length{all}[18] 0.093701 0.008877 0.000321 0.277698 0.063224 1.003 2
length{all}[19] 0.102601 0.011163 0.000006 0.301051 0.066709 0.999 2
length{all}[20] 0.106125 0.011648 0.000344 0.318188 0.072611 0.998 2
length{all}[21] 0.098070 0.009943 0.000257 0.303044 0.063820 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004931
Maximum standard deviation of split frequencies = 0.014133
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 252
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 41 patterns at 84 / 84 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 41 patterns at 84 / 84 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
40016 bytes for conP
3608 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.054060 0.080239 0.068866 0.047148 0.079857 0.043150 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -367.095475
Iterating by ming2
Initial: fx= 367.095475
x= 0.05406 0.08024 0.06887 0.04715 0.07986 0.04315 0.30000 1.30000
1 h-m-p 0.0000 0.0005 200.7587 +++ 345.869579 m 0.0005 14 | 1/8
2 h-m-p 0.0022 0.0112 32.8959 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 184.4450 ++ 344.213771 m 0.0000 46 | 2/8
4 h-m-p 0.0003 0.0167 24.5080 ----------.. | 2/8
5 h-m-p 0.0000 0.0001 164.9526 ++ 341.920839 m 0.0001 76 | 3/8
6 h-m-p 0.0006 0.0211 19.9144 -----------.. | 3/8
7 h-m-p 0.0000 0.0002 142.8841 +++ 338.224011 m 0.0002 108 | 4/8
8 h-m-p 0.0014 0.0301 14.8631 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 116.8758 ++ 336.385238 m 0.0001 139 | 5/8
10 h-m-p 0.0012 0.0516 9.6308 -----------.. | 5/8
11 h-m-p 0.0000 0.0000 82.7898 ++ 336.353144 m 0.0000 170 | 6/8
12 h-m-p 0.0160 8.0000 0.0000 C 336.353144 0 0.0055 181 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 ----------Y 336.353144 0 0.0000 204
Out..
lnL = -336.353144
205 lfun, 205 eigenQcodon, 1230 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.070218 0.029604 0.016909 0.087985 0.066870 0.072899 0.299854 0.646734 0.586577
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.293565
np = 9
lnL0 = -364.630296
Iterating by ming2
Initial: fx= 364.630296
x= 0.07022 0.02960 0.01691 0.08799 0.06687 0.07290 0.29985 0.64673 0.58658
1 h-m-p 0.0000 0.0002 198.8363 +++ 356.423441 m 0.0002 15 | 1/9
2 h-m-p 0.0002 0.0008 97.0451 ++ 351.175240 m 0.0008 27 | 2/9
3 h-m-p 0.0001 0.0006 223.8980 ++ 339.311292 m 0.0006 39 | 3/9
4 h-m-p 0.0004 0.0022 50.5629 ++ 337.560431 m 0.0022 51 | 4/9
5 h-m-p 0.0000 0.0001 150.3566 ++ 337.493837 m 0.0001 63 | 5/9
6 h-m-p 0.0001 0.0015 204.5950 ---------.. | 5/9
7 h-m-p 0.0000 0.0002 82.8729 +++ 336.353158 m 0.0002 95 | 6/9
8 h-m-p 0.2557 8.0000 0.0000 +++ 336.353158 m 8.0000 108 | 6/9
9 h-m-p 0.0160 8.0000 0.0120 +++++ 336.353156 m 8.0000 126 | 6/9
10 h-m-p 0.1701 1.1481 0.5634 ++ 336.353151 m 1.1481 141 | 7/9
11 h-m-p 0.3992 2.6781 0.4935 ---------------.. | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 336.353151 m 8.0000 186 | 7/9
13 h-m-p 0.0003 0.1457 3.1044 +++++ 336.353143 m 0.1457 203 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 N 336.353143 0 1.6000 215 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 N 336.353143 0 0.0160 228
Out..
lnL = -336.353143
229 lfun, 687 eigenQcodon, 2748 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.087779 0.038350 0.015238 0.060048 0.100854 0.075203 0.000100 1.592395 0.574097 0.412273 1.548004
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.262976
np = 11
lnL0 = -366.192946
Iterating by ming2
Initial: fx= 366.192946
x= 0.08778 0.03835 0.01524 0.06005 0.10085 0.07520 0.00011 1.59240 0.57410 0.41227 1.54800
1 h-m-p 0.0000 0.0000 185.7511 ++ 366.004673 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 118.2849 ++++ 358.793670 m 0.0007 32 | 2/11
3 h-m-p 0.0002 0.0010 52.5422 ++ 351.019724 m 0.0010 46 | 3/11
4 h-m-p 0.0017 0.0086 23.7751 ++ 342.721514 m 0.0086 60 | 4/11
5 h-m-p 0.0000 0.0000 2860.9872 ++ 339.137206 m 0.0000 74 | 5/11
6 h-m-p 0.0001 0.0003 290.2174 ++ 338.106578 m 0.0003 88 | 6/11
7 h-m-p 0.0052 0.0262 5.9886 ------------.. | 6/11
8 h-m-p 0.0000 0.0001 114.7530 ++ 337.231657 m 0.0001 126 | 7/11
9 h-m-p 0.0160 8.0000 0.8620 -------------.. | 7/11
10 h-m-p 0.0000 0.0001 81.9628 ++ 336.353154 m 0.0001 169 | 8/11
11 h-m-p 0.0603 8.0000 0.0000 ++++ 336.353154 m 8.0000 185 | 8/11
12 h-m-p 0.0160 8.0000 0.0064 +++++ 336.353153 m 8.0000 205 | 8/11
13 h-m-p 0.0262 1.0890 1.9623 +++ 336.353144 m 1.0890 223 | 8/11
14 h-m-p -0.0000 -0.0000 0.3211
h-m-p: -0.00000000e+00 -0.00000000e+00 3.21084982e-01 336.353144
.. | 8/11
15 h-m-p 0.0160 8.0000 0.0000 ---N 336.353144 0 0.0001 254 | 8/11
16 h-m-p 0.0160 8.0000 0.3111 +++++ 336.353142 m 8.0000 274 | 8/11
17 h-m-p 1.6000 8.0000 0.1036 +Y 336.353142 0 4.5240 292 | 8/11
18 h-m-p 1.6000 8.0000 0.0088 C 336.353142 0 1.7559 309 | 8/11
19 h-m-p 1.6000 8.0000 0.0043 -----N 336.353142 0 0.0004 331 | 8/11
20 h-m-p 0.7139 8.0000 0.0000 -N 336.353142 0 0.0446 349 | 8/11
21 h-m-p 0.0160 8.0000 1.7351 +Y 336.353142 0 0.1291 367 | 8/11
22 h-m-p 1.6000 8.0000 0.0634 -C 336.353142 0 0.1000 382 | 8/11
23 h-m-p 1.6000 8.0000 0.0002 ++ 336.353142 m 8.0000 399 | 8/11
24 h-m-p 0.0160 8.0000 0.2462 +++C 336.353142 0 1.3581 419 | 8/11
25 h-m-p 1.6000 8.0000 0.0213 ++ 336.353142 m 8.0000 436 | 8/11
26 h-m-p 1.0624 8.0000 0.1603 +Y 336.353142 0 3.1231 454 | 8/11
27 h-m-p 1.6000 8.0000 0.1885 +C 336.353142 0 6.5628 472 | 8/11
28 h-m-p 0.6669 8.0000 1.8549 C 336.353142 0 0.8222 489 | 8/11
29 h-m-p 1.6000 8.0000 0.7424 Y 336.353142 0 1.1604 503 | 8/11
30 h-m-p 1.6000 8.0000 0.4790 Y 336.353142 0 1.6000 520 | 8/11
31 h-m-p 1.6000 8.0000 0.2214 Y 336.353142 0 1.0372 537 | 8/11
32 h-m-p 1.6000 8.0000 0.0512 Y 336.353142 0 0.9834 554 | 8/11
33 h-m-p 1.6000 8.0000 0.0011 Y 336.353142 0 1.6000 571 | 8/11
34 h-m-p 0.7525 8.0000 0.0024 ---Y 336.353142 0 0.0029 591 | 8/11
35 h-m-p 0.0160 8.0000 0.0077 Y 336.353142 0 0.0160 608 | 8/11
36 h-m-p 1.3396 8.0000 0.0001 +N 336.353142 0 5.3583 626 | 8/11
37 h-m-p 1.6000 8.0000 0.0001 N 336.353142 0 0.4000 643 | 8/11
38 h-m-p 1.6000 8.0000 0.0000 ---N 336.353142 0 0.0063 663 | 8/11
39 h-m-p 0.0160 8.0000 0.0063 ----N 336.353142 0 0.0000 684 | 8/11
40 h-m-p 1.6000 8.0000 0.0000 N 336.353142 0 1.6000 701 | 7/11
41 h-m-p 0.0241 8.0000 0.0000 Y 336.353142 0 0.0060 718
Out..
lnL = -336.353142
719 lfun, 2876 eigenQcodon, 12942 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -336.355022 S = -336.351557 -0.001324
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:05
did 20 / 41 patterns 0:05
did 30 / 41 patterns 0:05
did 40 / 41 patterns 0:05
did 41 / 41 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.038851 0.013755 0.071655 0.053203 0.064648 0.090046 0.000100 1.060541 1.718810
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.644320
np = 9
lnL0 = -362.933611
Iterating by ming2
Initial: fx= 362.933611
x= 0.03885 0.01376 0.07165 0.05320 0.06465 0.09005 0.00011 1.06054 1.71881
1 h-m-p 0.0000 0.0000 189.1455 ++ 362.782952 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0671 15.7554 ----------.. | 1/9
3 h-m-p 0.0000 0.0002 189.2234 +++ 356.578345 m 0.0002 47 | 2/9
4 h-m-p 0.0021 0.0767 13.7856 ------------.. | 2/9
5 h-m-p 0.0000 0.0003 175.4077 +++ 346.621922 m 0.0003 82 | 3/9
6 h-m-p 0.0058 0.1241 8.6095 ------------.. | 3/9
7 h-m-p 0.0000 0.0002 161.2492 +++ 341.931865 m 0.0002 117 | 4/9
8 h-m-p 0.0061 0.2819 4.1156 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 141.4415 ++ 339.081338 m 0.0001 151 | 5/9
10 h-m-p 0.0073 0.7789 2.2455 -------------.. | 5/9
11 h-m-p 0.0000 0.0001 116.4058 ++ 337.907234 m 0.0001 186 | 6/9
12 h-m-p 0.0071 3.5424 1.6478 -------------.. | 6/9
13 h-m-p 0.0000 0.0002 82.4692 +++ 336.353154 m 0.0002 222 | 7/9
14 h-m-p 0.3379 8.0000 0.0000 +++ 336.353154 m 8.0000 235 | 7/9
15 h-m-p 0.0398 8.0000 0.0006 ++++ 336.353154 m 8.0000 251 | 7/9
16 h-m-p 0.0160 8.0000 0.7930 +++++ 336.353150 m 8.0000 268 | 7/9
17 h-m-p 1.6000 8.0000 0.2608 ++ 336.353150 m 8.0000 282 | 7/9
18 h-m-p 0.5942 8.0000 3.5113 ++ 336.353150 m 8.0000 296 | 7/9
19 h-m-p 1.6000 8.0000 0.4916 ----------N 336.353150 0 0.0000 318 | 7/9
20 h-m-p 1.2625 8.0000 0.0000 ----Y 336.353150 0 0.0012 336
Out..
lnL = -336.353150
337 lfun, 3707 eigenQcodon, 20220 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.060775 0.087763 0.045316 0.071269 0.081515 0.107363 0.000100 0.900000 0.606396 1.392643 1.300104
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.013711
np = 11
lnL0 = -370.529295
Iterating by ming2
Initial: fx= 370.529295
x= 0.06077 0.08776 0.04532 0.07127 0.08152 0.10736 0.00011 0.90000 0.60640 1.39264 1.30010
1 h-m-p 0.0000 0.0000 168.1540 ++ 370.459200 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0028 96.8721 +++++ 350.543341 m 0.0028 33 | 2/11
3 h-m-p 0.0000 0.0000 2523.2892 ++ 344.648091 m 0.0000 47 | 3/11
4 h-m-p 0.0029 0.0145 18.2563 ++ 341.871192 m 0.0145 61 | 4/11
5 h-m-p 0.0001 0.0004 33.6696 ++ 339.980748 m 0.0004 75 | 5/11
6 h-m-p 0.0003 0.0017 37.2818 ++ 339.670141 m 0.0017 89 | 6/11
7 h-m-p 0.0006 0.0030 79.4067 ++ 339.598851 m 0.0030 103 | 7/11
8 h-m-p 0.0099 0.0674 11.5357 -------------.. | 7/11
9 h-m-p 0.0000 0.0005 76.8872 +++ 336.353153 m 0.0005 143 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 336.353153 m 8.0000 157 | 8/11
11 h-m-p 0.0082 4.1106 0.6463 +++++ 336.353135 m 4.1106 177 | 9/11
12 h-m-p 1.6000 8.0000 0.2283 ++ 336.353135 m 8.0000 194 | 9/11
13 h-m-p 0.9982 8.0000 1.8298 ++ 336.353133 m 8.0000 210 | 9/11
14 h-m-p 1.6000 8.0000 1.1152 ++ 336.353133 m 8.0000 224 | 9/11
15 h-m-p 0.3625 1.8123 15.7736 --------Y 336.353133 0 0.0000 246 | 9/11
16 h-m-p 1.6000 8.0000 0.0000 --C 336.353133 0 0.0316 262 | 9/11
17 h-m-p 0.4568 8.0000 0.0000 ----Y 336.353133 0 0.0004 282
Out..
lnL = -336.353133
283 lfun, 3396 eigenQcodon, 18678 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -336.351388 S = -336.351176 -0.000093
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 41 patterns 0:15
did 20 / 41 patterns 0:15
did 30 / 41 patterns 0:16
did 40 / 41 patterns 0:16
did 41 / 41 patterns 0:16
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=84
NC_011896_1_WP_010908250_1_1362_MLBR_RS06410 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
NC_002677_1_NP_301929_1_801_ML1294 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY
**************************************************
NC_011896_1_WP_010908250_1_1362_MLBR_RS06410 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
NC_002677_1_NP_301929_1_801_ML1294 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190 CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
**********************************
>NC_011896_1_WP_010908250_1_1362_MLBR_RS06410 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC GG >NC_002677_1_NP_301929_1_801_ML1294 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC GG >NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC GG >NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC GG >NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC GG >NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190 TTGAGCAACCGACTGGCGCCACCGCGGAGCCGGCTACCCGCCGGTTGGGA CGCTGAGATGTCTAACGAGTACGAATGGGTGCCGTTGCACCTGCCGTCAG AATTGACCACGCTTAACGCATCGACCCGGCTGTCCATCGAGGCTGAATAT TGCGGTTGGGAGCTGATCAAGGTGCGGATCTACACCGACGGCAGTAGGAG GACATTGTTGCGCCGCAATAACTCTCGTCTAGAAAACACAGGCTCCGACC GG
>NC_011896_1_WP_010908250_1_1362_MLBR_RS06410 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR >NC_002677_1_NP_301929_1_801_ML1294 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR >NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR >NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR >NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR >NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190 LSNRLAPPRSRLPAGWDAEMSNEYEWVPLHLPSELTTLNASTRLSIEAEY CGWELIKVRIYTDGSRRTLLRRNNSRLENTGSDR
#NEXUS
[ID: 5248598772]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908250_1_1362_MLBR_RS06410
NC_002677_1_NP_301929_1_801_ML1294
NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900
NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915
NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030
NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908250_1_1362_MLBR_RS06410,
2 NC_002677_1_NP_301929_1_801_ML1294,
3 NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900,
4 NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915,
5 NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030,
6 NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07120372,2:0.06839058,3:0.06774733,4:0.06731096,5:0.0642923,6:0.06964229);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07120372,2:0.06839058,3:0.06774733,4:0.06731096,5:0.0642923,6:0.06964229);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -346.35 -349.60
2 -346.41 -350.34
--------------------------------------
TOTAL -346.38 -350.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1294/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.891688 0.085073 0.356749 1.456219 0.857652 1501.00 1501.00 1.000
r(A<->C){all} 0.163578 0.019820 0.000004 0.447294 0.125445 239.09 268.30 1.003
r(A<->G){all} 0.153608 0.017010 0.000065 0.413415 0.120591 294.70 302.57 1.000
r(A<->T){all} 0.168778 0.020235 0.000114 0.446384 0.129499 112.60 214.64 1.001
r(C<->G){all} 0.176389 0.021631 0.000029 0.469762 0.139827 172.71 217.06 1.000
r(C<->T){all} 0.159868 0.018998 0.000032 0.448835 0.122190 76.14 136.16 1.002
r(G<->T){all} 0.177778 0.022557 0.000142 0.482849 0.137699 107.75 187.89 1.000
pi(A){all} 0.222996 0.000665 0.174482 0.273642 0.222187 1241.26 1278.82 1.002
pi(C){all} 0.284948 0.000774 0.230220 0.339884 0.284163 1210.33 1339.70 1.002
pi(G){all} 0.304901 0.000799 0.254981 0.363897 0.304171 1167.76 1212.86 1.000
pi(T){all} 0.187155 0.000582 0.137818 0.233558 0.186173 1245.30 1307.28 1.000
alpha{1,2} 0.414892 0.225222 0.000101 1.402263 0.240039 1250.75 1295.44 1.001
alpha{3} 0.465595 0.235729 0.000476 1.429992 0.301062 1206.20 1255.29 1.000
pinvar{all} 0.993538 0.000061 0.979035 0.999998 0.995911 1134.97 1218.12 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/6res/ML1294/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 84
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 1 1 1 1 1 1 | CGC 2 2 2 2 2 2
CTA 2 2 2 2 2 2 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 4 4 4 4 4 4 | CCG 3 3 3 3 3 3 | CAG 0 0 0 0 0 0 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 3 3 3 3 3 3 | AAC 5 5 5 5 5 5 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 0 0 0 0 0 0 | Gly GGT 2 2 2 2 2 2
GTC 0 0 0 0 0 0 | GCC 1 1 1 1 1 1 | GAC 3 3 3 3 3 3 | GGC 2 2 2 2 2 2
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 4 4 4 4 4 4 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 1 1 1 1 1 1 | GAG 4 4 4 4 4 4 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908250_1_1362_MLBR_RS06410
position 1: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 2: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 3: T:0.13095 C:0.33333 A:0.14286 G:0.39286
Average T:0.18651 C:0.28571 A:0.22222 G:0.30556
#2: NC_002677_1_NP_301929_1_801_ML1294
position 1: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 2: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 3: T:0.13095 C:0.33333 A:0.14286 G:0.39286
Average T:0.18651 C:0.28571 A:0.22222 G:0.30556
#3: NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900
position 1: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 2: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 3: T:0.13095 C:0.33333 A:0.14286 G:0.39286
Average T:0.18651 C:0.28571 A:0.22222 G:0.30556
#4: NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915
position 1: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 2: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 3: T:0.13095 C:0.33333 A:0.14286 G:0.39286
Average T:0.18651 C:0.28571 A:0.22222 G:0.30556
#5: NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030
position 1: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 2: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 3: T:0.13095 C:0.33333 A:0.14286 G:0.39286
Average T:0.18651 C:0.28571 A:0.22222 G:0.30556
#6: NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190
position 1: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 2: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 3: T:0.13095 C:0.33333 A:0.14286 G:0.39286
Average T:0.18651 C:0.28571 A:0.22222 G:0.30556
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 0
TTC 0 | TCC 12 | TAC 12 | TGC 6
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 6 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 6
CTC 0 | CCC 6 | CAC 6 | CGC 12
CTA 12 | CCA 6 | Gln Q CAA 0 | CGA 6
CTG 24 | CCG 18 | CAG 0 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 6
ATC 18 | ACC 18 | AAC 30 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 6 | AAG 6 | AGG 12
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 12 | Asp D GAT 0 | Gly G GGT 12
GTC 0 | GCC 6 | GAC 18 | GGC 12
GTA 0 | GCA 6 | Glu E GAA 24 | GGA 0
GTG 12 | GCG 6 | GAG 24 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 2: T:0.21429 C:0.26190 A:0.26190 G:0.26190
position 3: T:0.13095 C:0.33333 A:0.14286 G:0.39286
Average T:0.18651 C:0.28571 A:0.22222 G:0.30556
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -336.353144 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299854 1.300104
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908250_1_1362_MLBR_RS06410: 0.000004, NC_002677_1_NP_301929_1_801_ML1294: 0.000004, NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900: 0.000004, NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915: 0.000004, NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030: 0.000004, NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29985
omega (dN/dS) = 1.30010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 203.2 48.8 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 203.2 48.8 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 203.2 48.8 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 203.2 48.8 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 203.2 48.8 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 203.2 48.8 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -336.353143 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.526369 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908250_1_1362_MLBR_RS06410: 0.000004, NC_002677_1_NP_301929_1_801_ML1294: 0.000004, NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900: 0.000004, NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915: 0.000004, NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030: 0.000004, NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.52637 0.47363
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.6 46.4 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 205.6 46.4 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 205.6 46.4 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 205.6 46.4 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 205.6 46.4 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 205.6 46.4 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -336.353142 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.059079 0.895576 0.000001 6.045733
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908250_1_1362_MLBR_RS06410: 0.000004, NC_002677_1_NP_301929_1_801_ML1294: 0.000004, NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900: 0.000004, NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915: 0.000004, NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030: 0.000004, NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.05908 0.89558 0.04535
w: 0.00000 1.00000 6.04573
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.6 46.4 1.1697 0.0000 0.0000 0.0 0.0
7..2 0.000 205.6 46.4 1.1697 0.0000 0.0000 0.0 0.0
7..3 0.000 205.6 46.4 1.1697 0.0000 0.0000 0.0 0.0
7..4 0.000 205.6 46.4 1.1697 0.0000 0.0000 0.0 0.0
7..5 0.000 205.6 46.4 1.1697 0.0000 0.0000 0.0 0.0
7..6 0.000 205.6 46.4 1.1697 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908250_1_1362_MLBR_RS06410)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908250_1_1362_MLBR_RS06410)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -336.353150 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 28.602558 25.709304
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908250_1_1362_MLBR_RS06410: 0.000004, NC_002677_1_NP_301929_1_801_ML1294: 0.000004, NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900: 0.000004, NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915: 0.000004, NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030: 0.000004, NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 28.60256 q = 25.70930
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.41552 0.45642 0.48100 0.50071 0.51841 0.53551 0.55312 0.57262 0.59680 0.63663
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.6 46.4 0.5267 0.0000 0.0000 0.0 0.0
7..2 0.000 205.6 46.4 0.5267 0.0000 0.0000 0.0 0.0
7..3 0.000 205.6 46.4 0.5267 0.0000 0.0000 0.0 0.0
7..4 0.000 205.6 46.4 0.5267 0.0000 0.0000 0.0 0.0
7..5 0.000 205.6 46.4 0.5267 0.0000 0.0000 0.0 0.0
7..6 0.000 205.6 46.4 0.5267 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -336.353133 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.627775 29.586466
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908250_1_1362_MLBR_RS06410: 0.000004, NC_002677_1_NP_301929_1_801_ML1294: 0.000004, NZ_LVXE01000068_1_WP_010908250_1_2483_A3216_RS12900: 0.000004, NZ_LYPH01000072_1_WP_010908250_1_2481_A8144_RS11915: 0.000004, NZ_CP029543_1_WP_010908250_1_1383_DIJ64_RS07030: 0.000004, NZ_AP014567_1_WP_010908250_1_1415_JK2ML_RS07190: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.62778
(p1 = 0.99999) w = 29.58647
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 29.58647
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 205.6 46.4 29.5862 0.0000 0.0000 0.0 0.0
7..2 0.000 205.6 46.4 29.5862 0.0000 0.0000 0.0 0.0
7..3 0.000 205.6 46.4 29.5862 0.0000 0.0000 0.0 0.0
7..4 0.000 205.6 46.4 29.5862 0.0000 0.0000 0.0 0.0
7..5 0.000 205.6 46.4 29.5862 0.0000 0.0000 0.0 0.0
7..6 0.000 205.6 46.4 29.5862 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908250_1_1362_MLBR_RS06410)
Pr(w>1) post mean +- SE for w
1 L 1.000** 29.586
2 S 1.000** 29.586
3 N 1.000** 29.586
4 R 1.000** 29.586
5 L 1.000** 29.586
6 A 1.000** 29.586
7 P 1.000** 29.586
8 P 1.000** 29.586
9 R 1.000** 29.586
10 S 1.000** 29.586
11 R 1.000** 29.586
12 L 1.000** 29.586
13 P 1.000** 29.586
14 A 1.000** 29.586
15 G 1.000** 29.586
16 W 1.000** 29.586
17 D 1.000** 29.586
18 A 1.000** 29.586
19 E 1.000** 29.586
20 M 1.000** 29.586
21 S 1.000** 29.586
22 N 1.000** 29.586
23 E 1.000** 29.586
24 Y 1.000** 29.586
25 E 1.000** 29.586
26 W 1.000** 29.586
27 V 1.000** 29.586
28 P 1.000** 29.586
29 L 1.000** 29.586
30 H 1.000** 29.586
31 L 1.000** 29.586
32 P 1.000** 29.586
33 S 1.000** 29.586
34 E 1.000** 29.586
35 L 1.000** 29.586
36 T 1.000** 29.586
37 T 1.000** 29.586
38 L 1.000** 29.586
39 N 1.000** 29.586
40 A 1.000** 29.586
41 S 1.000** 29.586
42 T 1.000** 29.586
43 R 1.000** 29.586
44 L 1.000** 29.586
45 S 1.000** 29.586
46 I 1.000** 29.586
47 E 1.000** 29.586
48 A 1.000** 29.586
49 E 1.000** 29.586
50 Y 1.000** 29.586
51 C 1.000** 29.586
52 G 1.000** 29.586
53 W 1.000** 29.586
54 E 1.000** 29.586
55 L 1.000** 29.586
56 I 1.000** 29.586
57 K 1.000** 29.586
58 V 1.000** 29.586
59 R 1.000** 29.586
60 I 1.000** 29.586
61 Y 1.000** 29.586
62 T 1.000** 29.586
63 D 1.000** 29.586
64 G 1.000** 29.586
65 S 1.000** 29.586
66 R 1.000** 29.586
67 R 1.000** 29.586
68 T 1.000** 29.586
69 L 1.000** 29.586
70 L 1.000** 29.586
71 R 1.000** 29.586
72 R 1.000** 29.586
73 N 1.000** 29.586
74 N 1.000** 29.586
75 S 1.000** 29.586
76 R 1.000** 29.586
77 L 1.000** 29.586
78 E 1.000** 29.586
79 N 1.000** 29.586
80 T 1.000** 29.586
81 G 1.000** 29.586
82 S 1.000** 29.586
83 D 1.000** 29.586
84 R 1.000** 29.586
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908250_1_1362_MLBR_RS06410)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -336.353143 Model 2: PositiveSelection -336.353142 Model 0: one-ratio -336.353144 Model 7: beta -336.35315 Model 8: beta&w>1 -336.353133 Model 0 vs 1 1.9999999949504854E-6 Model 2 vs 1 1.9999999949504854E-6 Model 8 vs 7 3.400000002784509E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
