--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:53:43 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/5res/ML0857/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1016.97 -1019.37
2 -1016.96 -1019.99
--------------------------------------
TOTAL -1016.96 -1019.73
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886840 0.085113 0.370713 1.457604 0.854733 1501.00 1501.00 1.000
r(A<->C){all} 0.172357 0.021780 0.000070 0.471496 0.134249 193.68 236.10 1.000
r(A<->G){all} 0.165140 0.020033 0.000010 0.455532 0.128002 170.01 206.04 1.001
r(A<->T){all} 0.162999 0.017838 0.000025 0.431778 0.130954 192.94 236.86 1.007
r(C<->G){all} 0.165286 0.021317 0.000035 0.449568 0.124811 196.93 197.79 1.000
r(C<->T){all} 0.160626 0.018912 0.000008 0.433784 0.124259 181.79 243.19 1.000
r(G<->T){all} 0.173592 0.020976 0.000094 0.473759 0.137078 221.02 226.20 1.003
pi(A){all} 0.200478 0.000210 0.173020 0.228853 0.199739 1214.98 1326.04 1.000
pi(C){all} 0.294834 0.000272 0.264726 0.328537 0.294757 1289.83 1309.32 1.000
pi(G){all} 0.328147 0.000276 0.297320 0.361494 0.328017 1194.41 1208.65 1.000
pi(T){all} 0.176541 0.000189 0.149826 0.202976 0.176215 1393.73 1447.37 1.000
alpha{1,2} 0.428726 0.255305 0.000304 1.458503 0.248434 1200.10 1272.87 1.000
alpha{3} 0.457938 0.231091 0.000173 1.422572 0.308353 778.77 901.26 1.000
pinvar{all} 0.998028 0.000005 0.993662 0.999999 0.998729 988.40 1144.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -984.240128
Model 2: PositiveSelection -984.240106
Model 0: one-ratio -984.24013
Model 7: beta -984.240203
Model 8: beta&w>1 -984.240105
Model 0 vs 1 3.999999989900971E-6
Model 2 vs 1 4.4000000116284355E-5
Model 8 vs 7 1.9599999995989492E-4
>C1
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C2
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C3
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C4
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C5
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C6
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=250
C1 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C2 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C3 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C4 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C5 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C6 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
**************************************************
C1 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C2 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C3 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C4 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C5 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C6 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
**************************************************
C1 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C2 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C3 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C4 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C5 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C6 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
**************************************************
C1 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C2 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C3 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C4 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C5 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C6 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
**************************************************
C1 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C2 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C3 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C4 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C5 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C6 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
**************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 250 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 250 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7500]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7500]--->[7500]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.494 Mb, Max= 30.802 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C2 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C3 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C4 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C5 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
C6 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
**************************************************
C1 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C2 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C3 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C4 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C5 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
C6 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
**************************************************
C1 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C2 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C3 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C4 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C5 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
C6 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
**************************************************
C1 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C2 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C3 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C4 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C5 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
C6 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
**************************************************
C1 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C2 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C3 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C4 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C5 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
C6 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
**************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
C2 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
C3 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
C4 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
C5 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
C6 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
**************************************************
C1 GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
C2 GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
C3 GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
C4 GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
C5 GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
C6 GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
**************************************************
C1 AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
C2 AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
C3 AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
C4 AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
C5 AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
C6 AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
**************************************************
C1 ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
C2 ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
C3 ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
C4 ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
C5 ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
C6 ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
**************************************************
C1 AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
C2 AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
C3 AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
C4 AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
C5 AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
C6 AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
**************************************************
C1 GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
C2 GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
C3 GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
C4 GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
C5 GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
C6 GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
**************************************************
C1 TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
C2 TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
C3 TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
C4 TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
C5 TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
C6 TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
**************************************************
C1 TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
C2 TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
C3 TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
C4 TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
C5 TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
C6 TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
**************************************************
C1 TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
C2 TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
C3 TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
C4 TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
C5 TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
C6 TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
**************************************************
C1 GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
C2 GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
C3 GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
C4 GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
C5 GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
C6 GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
**************************************************
C1 CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
C2 CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
C3 CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
C4 CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
C5 CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
C6 CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
**************************************************
C1 ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
C2 ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
C3 ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
C4 ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
C5 ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
C6 ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
**************************************************
C1 TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
C2 TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
C3 TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
C4 TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
C5 TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
C6 TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
**************************************************
C1 GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
C2 GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
C3 GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
C4 GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
C5 GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
C6 GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
**************************************************
C1 TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
C2 TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
C3 TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
C4 TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
C5 TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
C6 TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
**************************************************
>C1
ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
>C2
ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
>C3
ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
>C4
ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
>C5
ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
>C6
ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC
GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC
AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG
ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT
AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG
GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC
TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA
TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT
TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC
GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG
CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA
ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC
TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT
GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC
TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
>C1
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C2
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C3
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C4
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C5
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
>C6
MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 750 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579798344
Setting output file names to "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1220153657
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0878497501
Seed = 1538632955
Swapseed = 1579798344
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1678.535956 -- -24.965149
Chain 2 -- -1678.535860 -- -24.965149
Chain 3 -- -1678.535700 -- -24.965149
Chain 4 -- -1678.535956 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1678.535956 -- -24.965149
Chain 2 -- -1678.535956 -- -24.965149
Chain 3 -- -1678.535860 -- -24.965149
Chain 4 -- -1678.535956 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1678.536] (-1678.536) (-1678.536) (-1678.536) * [-1678.536] (-1678.536) (-1678.536) (-1678.536)
500 -- [-1032.787] (-1039.195) (-1025.328) (-1021.375) * [-1033.391] (-1041.602) (-1029.072) (-1033.899) -- 0:00:00
1000 -- (-1024.864) (-1032.450) (-1027.499) [-1025.751] * (-1036.727) [-1030.433] (-1022.644) (-1032.481) -- 0:00:00
1500 -- [-1022.697] (-1021.172) (-1023.132) (-1024.285) * (-1029.458) [-1026.595] (-1026.588) (-1033.007) -- 0:00:00
2000 -- [-1027.680] (-1031.468) (-1027.567) (-1026.342) * (-1026.316) [-1024.066] (-1032.288) (-1026.987) -- 0:00:00
2500 -- (-1025.244) [-1020.359] (-1025.174) (-1031.716) * (-1027.308) (-1030.353) (-1024.484) [-1027.186] -- 0:00:00
3000 -- (-1026.070) (-1031.703) (-1028.697) [-1024.559] * (-1029.977) (-1026.982) (-1033.801) [-1025.368] -- 0:00:00
3500 -- (-1027.825) (-1026.635) [-1028.461] (-1023.250) * (-1021.919) (-1025.917) (-1026.056) [-1021.236] -- 0:00:00
4000 -- (-1021.155) (-1029.423) (-1030.083) [-1022.348] * [-1028.719] (-1024.986) (-1025.612) (-1029.295) -- 0:00:00
4500 -- (-1024.549) (-1024.097) [-1024.471] (-1031.652) * [-1027.808] (-1027.943) (-1026.710) (-1027.606) -- 0:00:00
5000 -- [-1025.001] (-1024.712) (-1029.190) (-1022.339) * [-1020.061] (-1030.705) (-1029.806) (-1028.128) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-1027.267) (-1029.882) (-1028.403) [-1023.776] * (-1028.962) [-1031.482] (-1029.369) (-1033.941) -- 0:00:00
6000 -- [-1022.091] (-1021.341) (-1025.497) (-1027.626) * (-1030.063) (-1024.082) [-1025.435] (-1027.227) -- 0:00:00
6500 -- [-1022.291] (-1022.464) (-1027.972) (-1026.458) * (-1021.453) (-1019.169) [-1026.017] (-1031.865) -- 0:00:00
7000 -- (-1034.645) (-1025.654) (-1024.018) [-1027.545] * [-1022.589] (-1031.363) (-1028.862) (-1025.925) -- 0:00:00
7500 -- (-1030.955) (-1021.100) (-1025.656) [-1026.435] * (-1025.021) [-1026.818] (-1027.748) (-1026.845) -- 0:00:00
8000 -- (-1031.768) (-1018.910) (-1028.909) [-1026.127] * (-1025.796) (-1027.048) (-1022.527) [-1024.774] -- 0:00:00
8500 -- (-1020.725) (-1020.081) (-1026.305) [-1030.733] * (-1031.831) (-1024.821) [-1023.994] (-1025.052) -- 0:00:00
9000 -- (-1023.649) [-1020.191] (-1023.033) (-1024.461) * (-1032.338) (-1026.343) [-1021.296] (-1024.130) -- 0:00:00
9500 -- (-1020.973) [-1018.767] (-1032.825) (-1024.739) * [-1025.718] (-1028.626) (-1027.826) (-1025.530) -- 0:00:00
10000 -- (-1022.671) (-1016.765) [-1026.048] (-1024.291) * (-1031.089) [-1022.010] (-1027.179) (-1026.376) -- 0:00:00
Average standard deviation of split frequencies: 0.070309
10500 -- (-1028.190) (-1016.073) (-1023.412) [-1027.615] * (-1025.819) [-1021.665] (-1025.961) (-1024.473) -- 0:00:00
11000 -- (-1034.845) (-1016.822) (-1028.530) [-1023.609] * (-1024.543) [-1034.164] (-1032.298) (-1022.573) -- 0:00:00
11500 -- (-1034.829) [-1016.347] (-1030.144) (-1034.020) * (-1028.011) [-1025.777] (-1025.178) (-1024.387) -- 0:00:00
12000 -- (-1027.737) (-1018.279) [-1025.203] (-1033.135) * (-1023.196) [-1026.874] (-1027.988) (-1024.244) -- 0:00:00
12500 -- [-1021.791] (-1019.531) (-1028.670) (-1023.961) * (-1026.069) [-1028.626] (-1021.911) (-1032.294) -- 0:00:00
13000 -- (-1024.210) [-1018.053] (-1024.045) (-1028.246) * [-1023.916] (-1021.203) (-1029.882) (-1025.391) -- 0:00:00
13500 -- (-1031.821) (-1019.049) (-1030.420) [-1020.329] * (-1026.485) (-1024.166) [-1023.250] (-1025.897) -- 0:00:00
14000 -- (-1024.375) (-1019.631) (-1026.495) [-1026.061] * (-1034.839) (-1029.558) [-1024.082] (-1033.920) -- 0:00:00
14500 -- (-1030.134) (-1015.723) (-1029.517) [-1029.278] * (-1037.870) (-1026.617) (-1024.324) [-1032.201] -- 0:01:07
15000 -- (-1026.840) [-1018.383] (-1033.892) (-1025.294) * (-1028.750) (-1031.253) [-1033.818] (-1026.576) -- 0:01:05
Average standard deviation of split frequencies: 0.057523
15500 -- (-1023.048) [-1015.979] (-1028.657) (-1025.095) * (-1029.068) (-1032.991) (-1026.406) [-1023.773] -- 0:01:03
16000 -- (-1025.090) (-1016.219) (-1031.673) [-1025.022] * [-1026.290] (-1026.035) (-1028.296) (-1029.624) -- 0:01:01
16500 -- [-1022.442] (-1018.403) (-1028.522) (-1030.073) * (-1025.578) (-1023.937) (-1026.633) [-1025.735] -- 0:00:59
17000 -- [-1025.494] (-1016.258) (-1023.720) (-1024.221) * (-1049.219) [-1022.575] (-1022.907) (-1028.483) -- 0:00:57
17500 -- (-1021.222) (-1016.097) [-1021.819] (-1029.089) * (-1020.908) (-1028.064) [-1026.728] (-1023.903) -- 0:00:56
18000 -- (-1028.570) (-1020.034) [-1022.866] (-1027.837) * (-1019.147) (-1024.977) (-1027.209) [-1027.716] -- 0:00:54
18500 -- [-1023.730] (-1018.573) (-1021.739) (-1035.876) * (-1022.244) (-1033.756) (-1023.725) [-1021.922] -- 0:00:53
19000 -- (-1033.449) (-1018.406) [-1021.377] (-1027.151) * (-1020.497) (-1030.048) [-1024.783] (-1026.045) -- 0:00:51
19500 -- [-1025.562] (-1017.011) (-1030.140) (-1031.222) * [-1018.495] (-1025.916) (-1025.438) (-1022.660) -- 0:00:50
20000 -- (-1034.881) (-1016.325) (-1027.196) [-1026.066] * (-1020.127) [-1027.225] (-1023.810) (-1030.252) -- 0:00:49
Average standard deviation of split frequencies: 0.051956
20500 -- [-1023.945] (-1018.065) (-1029.675) (-1028.235) * (-1016.500) (-1027.728) [-1030.127] (-1031.903) -- 0:00:47
21000 -- (-1023.285) (-1018.054) [-1027.172] (-1029.737) * [-1018.429] (-1027.404) (-1028.177) (-1026.840) -- 0:00:46
21500 -- (-1024.889) (-1022.165) (-1020.499) [-1033.676] * [-1016.531] (-1029.821) (-1023.267) (-1024.543) -- 0:00:45
22000 -- (-1024.760) (-1016.246) [-1032.912] (-1029.270) * (-1017.376) (-1037.183) [-1029.726] (-1024.367) -- 0:00:44
22500 -- (-1024.220) [-1016.913] (-1034.157) (-1030.646) * (-1016.953) (-1031.131) [-1024.378] (-1029.644) -- 0:00:43
23000 -- [-1025.044] (-1017.074) (-1038.448) (-1023.832) * (-1016.826) (-1037.876) [-1022.635] (-1022.665) -- 0:00:42
23500 -- (-1024.607) (-1019.077) [-1024.155] (-1027.746) * (-1016.251) (-1027.478) [-1026.202] (-1031.407) -- 0:00:41
24000 -- (-1025.030) (-1017.418) [-1027.758] (-1033.930) * (-1017.662) [-1031.870] (-1023.843) (-1027.155) -- 0:00:40
24500 -- [-1021.401] (-1017.510) (-1030.740) (-1026.342) * (-1019.436) (-1032.312) [-1031.530] (-1024.958) -- 0:00:39
25000 -- (-1024.189) (-1016.218) (-1028.709) [-1020.683] * [-1016.367] (-1035.355) (-1025.902) (-1031.956) -- 0:00:39
Average standard deviation of split frequencies: 0.058513
25500 -- (-1025.188) [-1017.887] (-1023.638) (-1023.444) * (-1019.432) (-1017.508) (-1025.317) [-1026.825] -- 0:00:38
26000 -- (-1028.962) (-1017.021) (-1025.437) [-1021.314] * [-1017.584] (-1017.324) (-1026.507) (-1025.691) -- 0:00:37
26500 -- (-1027.917) (-1026.749) [-1024.867] (-1026.773) * (-1019.368) [-1016.170] (-1031.210) (-1032.934) -- 0:00:36
27000 -- (-1027.801) (-1018.093) (-1022.742) [-1022.751] * (-1019.496) [-1016.427] (-1023.860) (-1023.352) -- 0:00:36
27500 -- (-1033.828) (-1016.721) (-1023.381) [-1025.487] * (-1019.939) (-1019.154) [-1033.639] (-1025.229) -- 0:00:35
28000 -- (-1024.086) (-1018.544) (-1030.348) [-1026.331] * (-1019.165) (-1018.298) [-1016.379] (-1023.446) -- 0:00:34
28500 -- (-1026.648) [-1015.679] (-1028.043) (-1027.738) * (-1018.198) [-1016.597] (-1017.071) (-1028.404) -- 0:00:34
29000 -- (-1022.320) (-1017.211) [-1027.840] (-1024.700) * (-1016.896) (-1016.437) [-1018.947] (-1025.634) -- 0:00:33
29500 -- (-1026.926) (-1017.929) [-1027.287] (-1020.333) * (-1018.222) [-1015.865] (-1018.288) (-1030.159) -- 0:00:32
30000 -- (-1029.985) [-1016.659] (-1030.311) (-1022.931) * (-1020.498) [-1018.415] (-1017.383) (-1028.949) -- 0:00:32
Average standard deviation of split frequencies: 0.042273
30500 -- (-1020.958) (-1018.520) (-1020.439) [-1024.632] * (-1017.038) (-1016.442) [-1019.004] (-1033.981) -- 0:01:03
31000 -- [-1024.919] (-1017.379) (-1025.645) (-1031.074) * [-1016.938] (-1016.723) (-1016.093) (-1025.508) -- 0:01:02
31500 -- (-1025.019) (-1022.842) (-1030.638) [-1024.940] * (-1016.193) (-1017.178) [-1016.270] (-1032.022) -- 0:01:01
32000 -- (-1025.759) (-1017.276) [-1023.916] (-1031.939) * (-1016.692) [-1017.442] (-1020.827) (-1034.758) -- 0:01:00
32500 -- (-1025.423) [-1017.078] (-1026.823) (-1023.021) * (-1017.637) (-1017.471) (-1019.909) [-1022.795] -- 0:00:59
33000 -- [-1021.331] (-1023.015) (-1032.360) (-1021.407) * (-1022.175) (-1016.797) (-1018.677) [-1023.073] -- 0:00:58
33500 -- (-1028.634) (-1016.461) (-1029.045) [-1020.902] * (-1021.702) [-1017.124] (-1018.519) (-1030.450) -- 0:00:57
34000 -- (-1028.693) (-1018.162) [-1029.466] (-1025.463) * [-1017.432] (-1017.778) (-1018.772) (-1031.236) -- 0:00:56
34500 -- (-1028.614) (-1017.486) (-1024.180) [-1027.605] * [-1016.348] (-1020.443) (-1016.893) (-1028.881) -- 0:00:55
35000 -- (-1032.535) [-1017.109] (-1030.119) (-1029.341) * (-1017.324) (-1017.767) [-1018.741] (-1034.077) -- 0:00:55
Average standard deviation of split frequencies: 0.040593
35500 -- [-1023.125] (-1017.671) (-1031.327) (-1027.106) * (-1017.325) (-1017.302) [-1016.884] (-1035.455) -- 0:00:54
36000 -- (-1028.069) (-1021.988) [-1027.663] (-1024.407) * (-1017.492) [-1019.053] (-1020.296) (-1028.589) -- 0:00:53
36500 -- (-1020.957) [-1017.411] (-1024.170) (-1030.230) * (-1017.923) [-1019.260] (-1016.640) (-1025.472) -- 0:00:52
37000 -- (-1018.733) [-1017.387] (-1025.067) (-1028.391) * [-1018.023] (-1019.220) (-1017.719) (-1023.565) -- 0:00:52
37500 -- (-1017.896) [-1017.263] (-1028.762) (-1024.746) * (-1020.503) (-1021.755) (-1016.850) [-1028.585] -- 0:00:51
38000 -- (-1017.478) (-1017.593) [-1023.077] (-1028.770) * (-1021.199) (-1018.084) (-1016.208) [-1027.189] -- 0:00:50
38500 -- (-1016.962) (-1015.918) [-1025.451] (-1025.575) * (-1016.892) [-1020.091] (-1016.346) (-1023.849) -- 0:00:49
39000 -- (-1017.678) [-1016.692] (-1029.072) (-1027.466) * (-1015.901) [-1016.247] (-1016.995) (-1025.002) -- 0:00:49
39500 -- (-1016.379) (-1017.738) [-1023.347] (-1040.061) * [-1016.163] (-1017.565) (-1016.443) (-1019.133) -- 0:00:48
40000 -- (-1018.758) (-1017.193) [-1035.874] (-1028.488) * (-1016.667) (-1019.548) (-1016.879) [-1015.574] -- 0:00:48
Average standard deviation of split frequencies: 0.035996
40500 -- (-1016.769) (-1016.776) [-1028.940] (-1026.070) * [-1015.876] (-1020.626) (-1018.497) (-1015.979) -- 0:00:47
41000 -- (-1016.905) [-1016.516] (-1018.067) (-1029.779) * (-1015.901) [-1019.204] (-1020.359) (-1016.340) -- 0:00:46
41500 -- (-1018.754) (-1016.087) (-1018.878) [-1025.487] * (-1015.719) [-1018.659] (-1021.672) (-1021.418) -- 0:00:46
42000 -- (-1016.595) [-1017.589] (-1018.713) (-1034.161) * [-1016.051] (-1020.000) (-1017.043) (-1019.585) -- 0:00:45
42500 -- (-1017.060) (-1016.143) (-1018.305) [-1029.712] * [-1016.593] (-1018.417) (-1016.883) (-1016.780) -- 0:00:45
43000 -- (-1017.699) (-1016.866) (-1017.364) [-1019.210] * [-1018.654] (-1016.441) (-1017.851) (-1015.960) -- 0:00:44
43500 -- (-1019.943) [-1017.573] (-1018.882) (-1039.087) * (-1016.068) (-1016.973) [-1016.830] (-1019.098) -- 0:00:43
44000 -- (-1019.175) (-1017.641) (-1016.875) [-1022.836] * [-1015.610] (-1017.862) (-1018.883) (-1016.776) -- 0:00:43
44500 -- (-1018.452) (-1017.733) (-1015.797) [-1023.521] * [-1016.315] (-1016.572) (-1027.138) (-1017.424) -- 0:00:42
45000 -- (-1019.512) [-1017.609] (-1015.765) (-1026.676) * [-1017.688] (-1018.953) (-1016.254) (-1016.835) -- 0:00:42
Average standard deviation of split frequencies: 0.031313
45500 -- [-1017.145] (-1018.293) (-1017.325) (-1031.806) * (-1017.792) (-1017.931) (-1016.833) [-1016.845] -- 0:00:41
46000 -- [-1016.799] (-1015.672) (-1017.472) (-1024.948) * (-1017.985) (-1021.384) (-1015.617) [-1016.747] -- 0:00:41
46500 -- (-1019.077) (-1016.912) (-1015.563) [-1024.041] * (-1019.478) (-1018.753) [-1015.606] (-1018.833) -- 0:01:01
47000 -- (-1017.378) (-1022.596) (-1015.661) [-1028.874] * (-1020.291) (-1018.109) [-1017.158] (-1021.279) -- 0:01:00
47500 -- [-1016.265] (-1017.784) (-1018.715) (-1028.267) * (-1016.172) [-1019.759] (-1017.265) (-1018.693) -- 0:01:00
48000 -- (-1016.908) [-1015.622] (-1019.210) (-1024.094) * (-1019.988) (-1017.286) (-1019.502) [-1017.955] -- 0:00:59
48500 -- (-1015.861) [-1018.395] (-1018.124) (-1026.268) * (-1018.104) (-1017.090) (-1016.566) [-1017.356] -- 0:00:58
49000 -- (-1016.145) (-1017.660) (-1019.901) [-1028.674] * (-1017.256) [-1016.497] (-1015.907) (-1016.432) -- 0:00:58
49500 -- [-1016.979] (-1022.459) (-1019.252) (-1023.638) * (-1018.899) (-1016.792) (-1016.740) [-1016.555] -- 0:00:57
50000 -- [-1018.027] (-1017.028) (-1017.303) (-1026.574) * (-1018.200) [-1017.505] (-1018.147) (-1017.701) -- 0:00:57
Average standard deviation of split frequencies: 0.025176
50500 -- (-1016.384) (-1018.581) [-1017.790] (-1028.348) * [-1015.552] (-1017.526) (-1016.755) (-1019.001) -- 0:00:56
51000 -- [-1018.610] (-1017.902) (-1016.768) (-1029.552) * (-1015.540) (-1021.170) (-1016.538) [-1018.598] -- 0:00:55
51500 -- [-1017.927] (-1020.360) (-1016.267) (-1026.839) * (-1019.404) (-1020.781) (-1018.707) [-1016.694] -- 0:00:55
52000 -- (-1017.555) (-1021.373) (-1015.971) [-1025.592] * (-1018.025) (-1020.759) [-1016.405] (-1016.895) -- 0:00:54
52500 -- [-1017.051] (-1019.591) (-1016.599) (-1029.795) * (-1021.449) [-1018.812] (-1018.134) (-1016.177) -- 0:00:54
53000 -- (-1016.564) [-1022.764] (-1017.543) (-1033.067) * (-1015.940) [-1016.724] (-1021.658) (-1017.046) -- 0:00:53
53500 -- (-1017.525) (-1019.157) [-1015.586] (-1024.174) * (-1022.345) (-1018.650) (-1021.448) [-1017.575] -- 0:00:53
54000 -- [-1017.192] (-1016.869) (-1016.762) (-1025.522) * (-1021.911) (-1019.870) [-1021.872] (-1016.783) -- 0:00:52
54500 -- (-1018.259) (-1018.005) [-1015.686] (-1034.954) * (-1018.672) [-1017.771] (-1019.559) (-1017.384) -- 0:00:52
55000 -- (-1025.450) [-1016.412] (-1016.583) (-1025.107) * (-1020.148) [-1016.967] (-1017.931) (-1016.720) -- 0:00:51
Average standard deviation of split frequencies: 0.023675
55500 -- (-1018.981) [-1016.107] (-1015.699) (-1024.410) * (-1021.601) (-1016.030) [-1016.374] (-1017.387) -- 0:00:51
56000 -- [-1016.821] (-1016.405) (-1018.434) (-1024.834) * [-1017.876] (-1016.733) (-1016.568) (-1017.737) -- 0:00:50
56500 -- (-1022.886) [-1018.684] (-1018.433) (-1023.010) * (-1020.993) (-1015.524) (-1016.791) [-1015.606] -- 0:00:50
57000 -- [-1018.891] (-1018.373) (-1023.985) (-1025.331) * (-1017.552) (-1019.260) [-1017.427] (-1015.728) -- 0:00:49
57500 -- (-1017.412) (-1017.647) [-1018.312] (-1028.435) * [-1017.716] (-1017.622) (-1016.604) (-1016.983) -- 0:00:49
58000 -- (-1017.087) (-1017.806) (-1019.060) [-1022.107] * (-1018.478) (-1016.713) [-1016.189] (-1018.760) -- 0:00:48
58500 -- (-1016.263) (-1018.121) (-1018.322) [-1022.585] * (-1017.280) (-1016.030) [-1016.218] (-1017.058) -- 0:00:48
59000 -- (-1016.623) (-1016.001) [-1016.692] (-1024.724) * (-1016.349) [-1019.242] (-1015.616) (-1015.829) -- 0:00:47
59500 -- (-1016.630) (-1017.123) [-1016.670] (-1030.455) * (-1018.348) (-1016.074) (-1016.907) [-1017.995] -- 0:00:47
60000 -- (-1017.355) (-1016.588) [-1017.792] (-1023.098) * (-1019.075) [-1017.414] (-1019.833) (-1018.041) -- 0:00:47
Average standard deviation of split frequencies: 0.018455
60500 -- [-1018.420] (-1021.750) (-1016.450) (-1023.462) * [-1016.949] (-1017.530) (-1018.990) (-1018.669) -- 0:00:46
61000 -- (-1019.984) (-1025.235) [-1016.826] (-1029.162) * [-1016.361] (-1019.374) (-1017.937) (-1018.685) -- 0:00:46
61500 -- (-1015.782) (-1016.961) [-1017.623] (-1033.956) * (-1016.632) (-1016.445) (-1018.443) [-1017.688] -- 0:00:45
62000 -- (-1016.835) (-1019.349) [-1019.858] (-1031.593) * (-1019.188) [-1015.834] (-1019.429) (-1018.762) -- 0:01:00
62500 -- (-1019.158) [-1016.550] (-1019.340) (-1033.457) * (-1021.198) [-1016.541] (-1019.099) (-1018.235) -- 0:01:00
63000 -- (-1027.962) (-1016.635) [-1017.521] (-1027.547) * (-1017.553) [-1016.361] (-1016.428) (-1017.898) -- 0:00:59
63500 -- (-1023.404) (-1018.746) [-1017.532] (-1025.570) * [-1019.379] (-1016.614) (-1016.404) (-1019.214) -- 0:00:58
64000 -- (-1020.454) (-1016.422) (-1016.773) [-1024.913] * (-1016.398) (-1015.840) (-1016.900) [-1018.101] -- 0:00:58
64500 -- (-1017.870) [-1016.096] (-1018.718) (-1026.986) * [-1016.153] (-1016.243) (-1017.986) (-1025.730) -- 0:00:58
65000 -- (-1017.204) (-1018.402) (-1019.121) [-1023.199] * (-1016.807) [-1017.011] (-1021.678) (-1018.360) -- 0:00:57
Average standard deviation of split frequencies: 0.021785
65500 -- (-1017.779) (-1018.619) [-1017.599] (-1036.572) * [-1016.931] (-1017.096) (-1017.718) (-1017.548) -- 0:00:57
66000 -- (-1016.877) (-1018.317) [-1015.722] (-1021.831) * (-1016.458) (-1017.316) [-1019.313] (-1017.004) -- 0:00:56
66500 -- (-1019.083) (-1017.987) [-1016.742] (-1030.192) * (-1016.007) [-1016.289] (-1017.354) (-1017.786) -- 0:00:56
67000 -- (-1018.874) (-1016.463) [-1017.692] (-1026.747) * (-1016.484) (-1016.789) (-1018.646) [-1017.494] -- 0:00:55
67500 -- [-1016.256] (-1016.377) (-1016.711) (-1026.387) * (-1018.029) (-1018.538) [-1019.314] (-1020.238) -- 0:00:55
68000 -- (-1015.869) (-1018.330) (-1015.846) [-1024.152] * (-1016.832) [-1020.574] (-1020.229) (-1017.803) -- 0:00:54
68500 -- (-1016.913) (-1017.709) (-1017.103) [-1023.909] * (-1017.324) (-1016.207) (-1020.505) [-1017.106] -- 0:00:54
69000 -- (-1022.011) [-1015.831] (-1019.847) (-1029.260) * (-1020.455) [-1015.915] (-1016.754) (-1017.092) -- 0:00:53
69500 -- (-1016.819) (-1018.512) (-1020.174) [-1033.906] * (-1018.279) [-1015.684] (-1019.090) (-1021.482) -- 0:00:53
70000 -- (-1015.858) (-1016.591) (-1021.687) [-1030.425] * (-1018.953) (-1015.723) [-1018.310] (-1016.864) -- 0:00:53
Average standard deviation of split frequencies: 0.028806
70500 -- [-1015.879] (-1019.530) (-1020.713) (-1032.552) * (-1016.830) (-1017.600) [-1020.776] (-1015.543) -- 0:00:52
71000 -- [-1019.260] (-1017.191) (-1019.281) (-1035.818) * (-1016.156) (-1018.932) [-1016.197] (-1016.364) -- 0:00:52
71500 -- (-1015.663) (-1019.249) [-1019.418] (-1032.541) * (-1016.105) (-1018.302) (-1016.164) [-1015.647] -- 0:00:51
72000 -- [-1016.860] (-1018.321) (-1020.278) (-1028.286) * [-1016.872] (-1016.464) (-1017.163) (-1017.363) -- 0:00:51
72500 -- [-1015.400] (-1020.251) (-1019.969) (-1024.890) * (-1019.247) [-1016.998] (-1022.858) (-1015.996) -- 0:00:51
73000 -- (-1016.079) [-1018.215] (-1018.969) (-1029.542) * (-1018.597) (-1016.764) (-1017.042) [-1023.620] -- 0:00:50
73500 -- (-1015.615) [-1017.005] (-1016.587) (-1022.911) * (-1018.646) (-1018.972) (-1016.969) [-1015.902] -- 0:00:50
74000 -- (-1016.501) [-1017.037] (-1016.246) (-1030.782) * (-1018.382) (-1018.038) (-1017.109) [-1019.173] -- 0:00:50
74500 -- (-1016.877) (-1018.418) (-1015.996) [-1030.685] * [-1017.652] (-1018.371) (-1017.858) (-1019.415) -- 0:00:49
75000 -- (-1022.015) (-1018.538) [-1018.253] (-1028.067) * (-1016.172) (-1019.281) [-1016.904] (-1019.480) -- 0:00:49
Average standard deviation of split frequencies: 0.022837
75500 -- [-1018.209] (-1016.764) (-1016.554) (-1034.524) * [-1016.235] (-1016.505) (-1017.120) (-1019.421) -- 0:00:48
76000 -- [-1016.652] (-1016.032) (-1018.710) (-1044.531) * (-1016.652) [-1015.660] (-1018.584) (-1018.242) -- 0:00:48
76500 -- (-1020.021) [-1018.338] (-1016.701) (-1026.398) * (-1016.082) (-1017.023) (-1016.554) [-1017.600] -- 0:00:48
77000 -- (-1016.262) (-1022.940) [-1017.932] (-1023.919) * (-1018.865) [-1015.298] (-1018.152) (-1017.573) -- 0:00:47
77500 -- (-1016.814) [-1024.600] (-1017.915) (-1032.817) * (-1015.721) (-1016.072) [-1016.122] (-1018.196) -- 0:00:47
78000 -- (-1018.963) (-1026.648) [-1017.862] (-1031.949) * (-1017.247) [-1015.952] (-1015.690) (-1022.383) -- 0:00:47
78500 -- (-1021.180) (-1017.345) [-1015.744] (-1026.759) * (-1018.586) [-1018.487] (-1017.057) (-1015.868) -- 0:00:58
79000 -- (-1016.804) [-1017.313] (-1015.729) (-1034.660) * (-1021.596) (-1018.512) [-1018.177] (-1015.461) -- 0:00:58
79500 -- (-1016.720) (-1017.004) [-1020.126] (-1028.287) * (-1020.201) [-1017.117] (-1017.006) (-1017.949) -- 0:00:57
80000 -- (-1017.423) [-1016.364] (-1019.942) (-1027.137) * (-1022.020) (-1019.805) (-1016.387) [-1018.495] -- 0:00:57
Average standard deviation of split frequencies: 0.020985
80500 -- (-1016.366) [-1016.344] (-1019.193) (-1027.685) * [-1018.581] (-1018.911) (-1016.700) (-1020.255) -- 0:00:57
81000 -- (-1017.460) (-1016.400) [-1019.138] (-1028.466) * (-1017.092) (-1023.040) [-1017.559] (-1020.045) -- 0:00:56
81500 -- (-1018.658) (-1019.382) (-1017.636) [-1023.045] * [-1016.366] (-1020.528) (-1016.120) (-1017.833) -- 0:00:56
82000 -- [-1016.599] (-1017.613) (-1018.564) (-1024.036) * (-1016.243) (-1015.906) [-1016.695] (-1020.538) -- 0:00:55
82500 -- (-1018.503) [-1018.094] (-1015.587) (-1027.503) * (-1017.146) [-1015.939] (-1019.644) (-1017.476) -- 0:00:55
83000 -- (-1018.099) (-1016.878) (-1019.582) [-1028.254] * (-1018.931) (-1016.194) [-1018.069] (-1018.399) -- 0:00:55
83500 -- (-1018.343) [-1016.894] (-1016.281) (-1032.777) * (-1018.128) (-1017.112) [-1017.990] (-1016.629) -- 0:00:54
84000 -- (-1019.443) (-1016.838) [-1015.708] (-1027.099) * (-1016.025) (-1016.244) (-1016.787) [-1018.288] -- 0:00:54
84500 -- (-1018.406) [-1016.713] (-1015.664) (-1034.119) * [-1016.564] (-1020.564) (-1015.723) (-1018.071) -- 0:00:54
85000 -- [-1016.175] (-1018.897) (-1018.808) (-1022.191) * (-1016.743) [-1020.353] (-1016.368) (-1016.403) -- 0:00:53
Average standard deviation of split frequencies: 0.017690
85500 -- (-1016.399) (-1018.995) [-1016.617] (-1030.303) * [-1016.820] (-1019.378) (-1017.296) (-1016.780) -- 0:00:53
86000 -- (-1016.840) [-1017.802] (-1020.370) (-1035.316) * (-1018.666) (-1019.888) (-1017.948) [-1019.876] -- 0:00:53
86500 -- [-1016.326] (-1017.055) (-1020.191) (-1027.013) * (-1019.698) (-1018.354) (-1018.900) [-1016.000] -- 0:00:52
87000 -- (-1018.116) (-1016.316) (-1016.053) [-1025.823] * [-1016.070] (-1023.641) (-1016.182) (-1017.071) -- 0:00:52
87500 -- (-1020.167) (-1015.548) (-1017.071) [-1020.978] * (-1017.481) (-1025.465) (-1020.189) [-1016.565] -- 0:00:52
88000 -- (-1021.532) [-1015.648] (-1020.008) (-1028.924) * (-1017.795) [-1015.914] (-1023.733) (-1020.579) -- 0:00:51
88500 -- (-1017.282) [-1015.663] (-1018.849) (-1026.455) * (-1016.472) (-1017.140) (-1022.623) [-1019.199] -- 0:00:51
89000 -- [-1016.343] (-1016.226) (-1019.060) (-1031.201) * (-1017.477) [-1017.600] (-1019.340) (-1016.021) -- 0:00:51
89500 -- [-1016.803] (-1017.124) (-1016.293) (-1034.188) * (-1018.593) [-1018.406] (-1022.337) (-1018.153) -- 0:00:50
90000 -- (-1016.797) (-1017.804) (-1016.552) [-1022.324] * (-1017.871) [-1019.837] (-1023.466) (-1016.198) -- 0:00:50
Average standard deviation of split frequencies: 0.016307
90500 -- (-1015.652) (-1016.457) [-1019.355] (-1026.042) * (-1015.702) (-1018.459) (-1021.314) [-1016.565] -- 0:00:50
91000 -- (-1017.963) (-1016.894) [-1017.989] (-1025.408) * (-1017.488) (-1016.690) (-1019.532) [-1017.133] -- 0:00:49
91500 -- [-1017.787] (-1016.276) (-1017.836) (-1026.172) * [-1016.836] (-1016.993) (-1019.380) (-1017.084) -- 0:00:49
92000 -- [-1017.227] (-1016.840) (-1019.447) (-1033.387) * (-1015.630) (-1019.933) (-1017.291) [-1017.393] -- 0:00:49
92500 -- [-1015.844] (-1019.364) (-1018.768) (-1029.251) * (-1022.588) (-1020.343) (-1017.294) [-1016.847] -- 0:00:49
93000 -- [-1019.469] (-1018.892) (-1018.669) (-1028.824) * (-1016.991) (-1022.801) (-1017.711) [-1017.226] -- 0:00:48
93500 -- (-1020.020) (-1016.945) (-1016.995) [-1031.370] * [-1016.600] (-1020.717) (-1018.827) (-1018.538) -- 0:00:48
94000 -- (-1021.291) [-1017.557] (-1021.061) (-1024.897) * [-1016.237] (-1018.011) (-1017.338) (-1017.637) -- 0:00:48
94500 -- (-1021.960) [-1017.804] (-1020.347) (-1023.592) * (-1015.478) (-1018.354) [-1019.461] (-1020.285) -- 0:00:47
95000 -- (-1020.170) (-1019.766) (-1015.725) [-1028.723] * [-1017.220] (-1017.833) (-1018.909) (-1017.817) -- 0:00:47
Average standard deviation of split frequencies: 0.015468
95500 -- [-1019.086] (-1015.632) (-1015.308) (-1033.508) * [-1017.348] (-1017.116) (-1017.188) (-1017.501) -- 0:00:56
96000 -- (-1017.893) (-1016.257) (-1016.887) [-1023.564] * (-1018.527) [-1016.822] (-1016.062) (-1017.347) -- 0:00:56
96500 -- (-1020.080) [-1016.394] (-1018.874) (-1029.380) * (-1015.746) (-1016.646) [-1016.072] (-1019.169) -- 0:00:56
97000 -- (-1018.694) (-1016.235) (-1018.778) [-1027.474] * (-1016.544) [-1017.792] (-1015.873) (-1018.973) -- 0:00:55
97500 -- (-1019.514) (-1015.837) (-1020.727) [-1022.274] * (-1026.743) (-1018.083) (-1016.693) [-1016.667] -- 0:00:55
98000 -- [-1016.181] (-1019.791) (-1015.967) (-1036.370) * (-1019.437) (-1019.303) (-1019.157) [-1019.637] -- 0:00:55
98500 -- [-1017.280] (-1017.771) (-1016.207) (-1029.632) * (-1021.426) (-1018.571) [-1017.058] (-1017.672) -- 0:00:54
99000 -- (-1017.158) (-1017.181) (-1017.649) [-1030.372] * (-1017.162) (-1016.778) (-1017.877) [-1016.554] -- 0:00:54
99500 -- (-1015.822) (-1016.984) (-1017.999) [-1025.731] * (-1018.223) [-1016.801] (-1016.768) (-1017.307) -- 0:00:54
100000 -- (-1015.680) (-1018.993) (-1016.059) [-1027.709] * (-1019.798) (-1017.140) (-1016.816) [-1017.378] -- 0:00:54
Average standard deviation of split frequencies: 0.017745
100500 -- [-1019.435] (-1017.841) (-1015.720) (-1023.883) * (-1017.759) [-1016.767] (-1019.859) (-1016.359) -- 0:00:53
101000 -- (-1018.468) (-1016.584) [-1017.318] (-1023.975) * (-1019.434) (-1016.789) [-1019.973] (-1016.665) -- 0:00:53
101500 -- [-1017.414] (-1016.950) (-1017.106) (-1023.420) * (-1018.523) (-1015.886) [-1016.227] (-1018.513) -- 0:00:53
102000 -- (-1015.772) (-1016.088) [-1017.108] (-1027.899) * (-1020.291) (-1020.796) [-1016.503] (-1016.885) -- 0:00:52
102500 -- (-1016.240) [-1015.811] (-1017.907) (-1030.559) * (-1020.767) (-1024.063) [-1016.702] (-1018.240) -- 0:00:52
103000 -- (-1016.869) [-1018.069] (-1018.377) (-1032.263) * (-1019.907) [-1021.476] (-1019.213) (-1018.173) -- 0:00:52
103500 -- [-1017.790] (-1016.193) (-1019.505) (-1027.239) * [-1018.783] (-1017.229) (-1022.536) (-1021.616) -- 0:00:51
104000 -- (-1017.351) (-1016.851) [-1023.246] (-1029.444) * [-1020.090] (-1015.507) (-1027.922) (-1019.230) -- 0:00:51
104500 -- (-1020.890) (-1017.124) (-1019.756) [-1031.546] * (-1020.957) (-1015.671) (-1019.726) [-1023.438] -- 0:00:51
105000 -- (-1021.140) [-1018.756] (-1018.579) (-1026.916) * (-1018.296) (-1018.465) (-1017.579) [-1017.253] -- 0:00:51
Average standard deviation of split frequencies: 0.017154
105500 -- (-1020.049) (-1018.530) [-1020.003] (-1031.287) * (-1017.470) [-1018.609] (-1017.070) (-1018.914) -- 0:00:50
106000 -- (-1019.240) [-1020.539] (-1019.629) (-1025.706) * (-1019.467) [-1017.539] (-1017.870) (-1019.923) -- 0:00:50
106500 -- [-1018.270] (-1018.427) (-1020.542) (-1029.286) * (-1020.248) [-1020.703] (-1018.573) (-1016.706) -- 0:00:50
107000 -- (-1016.671) (-1020.050) [-1015.902] (-1022.748) * (-1016.662) (-1016.657) (-1017.189) [-1016.927] -- 0:00:50
107500 -- (-1017.657) (-1017.819) (-1016.416) [-1026.677] * [-1016.733] (-1016.230) (-1017.641) (-1017.155) -- 0:00:49
108000 -- (-1016.901) (-1018.348) (-1017.684) [-1024.499] * (-1016.479) [-1016.043] (-1017.644) (-1016.940) -- 0:00:49
108500 -- (-1017.018) (-1020.036) (-1020.391) [-1025.481] * (-1018.328) [-1015.351] (-1019.521) (-1016.942) -- 0:00:49
109000 -- (-1018.262) [-1019.548] (-1016.120) (-1032.528) * (-1016.893) [-1017.042] (-1019.115) (-1018.163) -- 0:00:49
109500 -- (-1018.076) [-1017.610] (-1016.933) (-1031.802) * (-1018.111) [-1019.714] (-1019.617) (-1023.085) -- 0:00:48
110000 -- (-1018.416) (-1016.479) [-1015.820] (-1024.668) * (-1016.589) [-1015.638] (-1020.442) (-1018.160) -- 0:00:48
Average standard deviation of split frequencies: 0.018864
110500 -- (-1024.217) (-1017.182) (-1017.171) [-1021.368] * (-1018.920) [-1017.046] (-1018.739) (-1017.087) -- 0:00:48
111000 -- (-1019.427) (-1016.544) (-1017.224) [-1031.079] * (-1018.790) (-1019.559) [-1016.943] (-1015.825) -- 0:00:48
111500 -- (-1019.217) (-1016.631) [-1017.623] (-1021.425) * (-1016.765) (-1021.209) (-1017.007) [-1015.887] -- 0:00:55
112000 -- (-1016.769) (-1018.761) (-1016.336) [-1024.097] * [-1016.900] (-1019.571) (-1018.106) (-1017.797) -- 0:00:55
112500 -- (-1016.550) [-1018.370] (-1016.887) (-1027.834) * (-1017.500) [-1017.378] (-1017.991) (-1019.087) -- 0:00:55
113000 -- (-1016.555) (-1022.443) (-1016.881) [-1020.972] * [-1021.450] (-1018.439) (-1020.157) (-1015.602) -- 0:00:54
113500 -- (-1018.070) (-1017.431) (-1018.544) [-1028.274] * (-1019.904) (-1015.924) (-1018.780) [-1016.404] -- 0:00:54
114000 -- [-1018.392] (-1018.367) (-1015.951) (-1023.894) * (-1019.002) (-1017.832) [-1017.642] (-1016.388) -- 0:00:54
114500 -- [-1016.508] (-1023.108) (-1017.026) (-1026.393) * (-1019.327) (-1017.825) [-1017.068] (-1017.379) -- 0:00:54
115000 -- (-1016.128) (-1021.028) (-1016.352) [-1024.037] * [-1017.225] (-1017.191) (-1015.913) (-1017.471) -- 0:00:53
Average standard deviation of split frequencies: 0.016041
115500 -- (-1019.639) [-1015.812] (-1017.354) (-1025.299) * (-1017.912) (-1016.936) [-1017.199] (-1019.128) -- 0:00:53
116000 -- (-1017.275) [-1015.730] (-1018.887) (-1034.248) * [-1018.345] (-1016.696) (-1016.329) (-1018.411) -- 0:00:53
116500 -- (-1017.867) [-1016.789] (-1020.481) (-1030.551) * (-1018.179) (-1018.653) (-1016.245) [-1017.508] -- 0:00:53
117000 -- (-1017.295) (-1016.778) (-1020.323) [-1023.691] * (-1017.810) (-1020.202) [-1015.924] (-1016.890) -- 0:00:52
117500 -- (-1016.519) (-1017.042) (-1020.795) [-1025.340] * (-1018.377) (-1018.686) (-1016.979) [-1016.537] -- 0:00:52
118000 -- [-1016.395] (-1016.085) (-1018.329) (-1024.240) * (-1019.049) [-1019.015] (-1019.340) (-1018.055) -- 0:00:52
118500 -- (-1018.334) (-1016.556) [-1016.616] (-1028.056) * (-1018.800) (-1020.339) [-1017.436] (-1020.813) -- 0:00:52
119000 -- (-1016.425) [-1017.193] (-1019.164) (-1025.903) * [-1022.177] (-1019.630) (-1019.236) (-1021.571) -- 0:00:51
119500 -- (-1017.990) (-1015.845) [-1018.694] (-1023.675) * (-1017.439) (-1019.283) (-1016.411) [-1018.019] -- 0:00:51
120000 -- [-1017.057] (-1015.811) (-1018.365) (-1032.251) * [-1017.308] (-1017.370) (-1016.536) (-1019.908) -- 0:00:51
Average standard deviation of split frequencies: 0.015421
120500 -- (-1017.026) (-1018.284) (-1018.468) [-1031.436] * [-1019.160] (-1018.592) (-1016.601) (-1021.460) -- 0:00:51
121000 -- (-1015.892) (-1016.984) (-1020.555) [-1027.811] * (-1020.171) [-1015.925] (-1016.017) (-1018.557) -- 0:00:50
121500 -- [-1017.931] (-1022.981) (-1019.612) (-1026.748) * [-1019.341] (-1015.666) (-1017.465) (-1016.730) -- 0:00:50
122000 -- (-1017.532) (-1016.386) [-1016.648] (-1031.620) * (-1017.367) (-1016.945) [-1020.016] (-1018.283) -- 0:00:50
122500 -- [-1018.843] (-1016.410) (-1018.922) (-1031.728) * [-1016.066] (-1021.574) (-1024.859) (-1015.696) -- 0:00:50
123000 -- (-1015.931) (-1018.784) (-1016.811) [-1028.459] * (-1016.029) (-1020.814) (-1020.288) [-1015.975] -- 0:00:49
123500 -- (-1016.878) (-1019.581) (-1018.696) [-1025.694] * [-1015.667] (-1019.572) (-1017.408) (-1017.149) -- 0:00:49
124000 -- (-1019.103) [-1018.605] (-1018.345) (-1025.864) * (-1015.649) [-1016.535] (-1016.036) (-1018.966) -- 0:00:49
124500 -- (-1023.615) [-1016.600] (-1016.781) (-1031.020) * (-1017.562) (-1016.457) [-1016.057] (-1016.870) -- 0:00:49
125000 -- (-1030.437) [-1016.267] (-1018.475) (-1033.842) * [-1016.850] (-1018.084) (-1016.897) (-1017.671) -- 0:00:49
Average standard deviation of split frequencies: 0.012908
125500 -- (-1018.658) [-1018.425] (-1018.399) (-1026.106) * (-1017.957) [-1017.555] (-1017.472) (-1019.176) -- 0:00:48
126000 -- [-1016.193] (-1017.626) (-1019.394) (-1027.933) * (-1017.648) [-1018.157] (-1020.846) (-1017.791) -- 0:00:48
126500 -- (-1016.360) [-1016.284] (-1020.675) (-1016.456) * (-1018.334) (-1015.534) (-1018.155) [-1017.532] -- 0:00:48
127000 -- (-1016.714) (-1019.974) (-1023.006) [-1017.316] * (-1019.695) (-1015.541) (-1018.810) [-1017.411] -- 0:00:48
127500 -- (-1017.438) [-1018.409] (-1020.460) (-1018.366) * (-1018.534) (-1017.663) (-1016.210) [-1017.873] -- 0:00:47
128000 -- (-1019.103) (-1020.505) [-1016.529] (-1018.613) * (-1019.297) (-1016.388) [-1018.887] (-1019.434) -- 0:00:47
128500 -- (-1018.978) [-1018.070] (-1017.306) (-1019.444) * (-1020.548) [-1015.641] (-1017.959) (-1020.289) -- 0:00:54
129000 -- (-1019.119) [-1019.019] (-1019.028) (-1020.355) * (-1017.894) [-1016.630] (-1023.780) (-1020.194) -- 0:00:54
129500 -- (-1018.498) (-1017.924) [-1016.058] (-1017.122) * (-1018.891) (-1018.152) (-1019.552) [-1019.241] -- 0:00:53
130000 -- [-1018.797] (-1018.412) (-1016.541) (-1021.094) * (-1018.113) [-1016.171] (-1016.706) (-1017.031) -- 0:00:53
Average standard deviation of split frequencies: 0.013028
130500 -- [-1021.156] (-1017.329) (-1017.235) (-1021.817) * (-1016.185) [-1016.234] (-1019.175) (-1017.407) -- 0:00:53
131000 -- (-1020.763) (-1017.666) [-1017.932] (-1019.723) * (-1016.470) [-1016.653] (-1018.066) (-1019.906) -- 0:00:53
131500 -- [-1019.678] (-1016.227) (-1016.635) (-1018.494) * (-1018.571) [-1019.897] (-1021.077) (-1018.720) -- 0:00:52
132000 -- (-1022.554) (-1016.846) [-1022.265] (-1018.019) * (-1017.615) [-1017.466] (-1019.882) (-1019.637) -- 0:00:52
132500 -- (-1020.028) (-1015.988) [-1016.982] (-1016.055) * (-1018.003) (-1019.825) [-1018.266] (-1025.853) -- 0:00:52
133000 -- (-1025.761) (-1024.981) (-1017.236) [-1015.848] * (-1016.230) (-1016.077) (-1019.301) [-1021.822] -- 0:00:52
133500 -- (-1018.253) [-1021.701] (-1018.366) (-1015.374) * [-1015.938] (-1018.370) (-1019.288) (-1026.045) -- 0:00:51
134000 -- [-1019.298] (-1016.979) (-1019.332) (-1021.886) * (-1018.554) (-1018.490) [-1016.817] (-1024.201) -- 0:00:51
134500 -- [-1016.166] (-1017.795) (-1019.848) (-1016.243) * (-1019.972) (-1018.065) [-1017.747] (-1023.079) -- 0:00:51
135000 -- (-1016.589) (-1017.201) [-1018.578] (-1018.544) * [-1016.636] (-1015.514) (-1016.859) (-1022.543) -- 0:00:51
Average standard deviation of split frequencies: 0.014057
135500 -- (-1018.025) [-1016.286] (-1019.550) (-1020.009) * (-1016.941) (-1020.102) (-1017.773) [-1018.307] -- 0:00:51
136000 -- (-1016.790) [-1016.662] (-1018.486) (-1018.955) * (-1021.006) [-1017.871] (-1018.865) (-1020.218) -- 0:00:50
136500 -- [-1017.548] (-1017.147) (-1018.573) (-1016.948) * [-1016.615] (-1018.603) (-1018.317) (-1018.571) -- 0:00:50
137000 -- [-1016.531] (-1016.231) (-1017.579) (-1016.320) * (-1017.034) (-1020.781) [-1017.953] (-1022.512) -- 0:00:50
137500 -- (-1019.702) [-1017.706] (-1018.691) (-1017.948) * [-1017.990] (-1017.313) (-1017.421) (-1016.597) -- 0:00:50
138000 -- [-1016.623] (-1017.317) (-1020.370) (-1016.485) * (-1015.973) (-1016.700) [-1017.246] (-1016.381) -- 0:00:49
138500 -- (-1016.387) (-1020.203) (-1023.510) [-1015.786] * [-1015.648] (-1016.958) (-1017.365) (-1016.122) -- 0:00:49
139000 -- (-1018.414) (-1023.304) [-1016.755] (-1015.630) * (-1015.769) (-1016.923) (-1017.429) [-1016.647] -- 0:00:49
139500 -- (-1021.964) (-1018.330) (-1017.629) [-1015.335] * (-1016.600) [-1017.878] (-1017.886) (-1017.981) -- 0:00:49
140000 -- (-1032.102) (-1017.638) (-1019.975) [-1016.793] * (-1016.602) (-1016.095) [-1016.819] (-1017.225) -- 0:00:49
Average standard deviation of split frequencies: 0.015345
140500 -- [-1021.375] (-1016.637) (-1018.194) (-1016.807) * (-1018.257) [-1016.247] (-1018.288) (-1019.881) -- 0:00:48
141000 -- (-1018.532) (-1017.183) (-1017.098) [-1016.472] * [-1016.462] (-1016.035) (-1017.102) (-1018.318) -- 0:00:48
141500 -- (-1016.703) (-1018.059) (-1017.726) [-1019.193] * (-1019.313) [-1017.603] (-1016.062) (-1016.252) -- 0:00:48
142000 -- [-1018.180] (-1016.976) (-1016.407) (-1017.803) * (-1017.614) (-1017.172) [-1016.534] (-1017.299) -- 0:00:48
142500 -- [-1017.101] (-1017.182) (-1019.232) (-1017.326) * (-1016.893) [-1016.759] (-1016.060) (-1016.633) -- 0:00:48
143000 -- (-1017.284) (-1016.632) [-1017.103] (-1019.673) * [-1019.348] (-1018.123) (-1016.899) (-1016.785) -- 0:00:47
143500 -- [-1018.322] (-1016.555) (-1020.009) (-1016.678) * (-1020.745) (-1019.831) (-1017.193) [-1017.088] -- 0:00:47
144000 -- (-1018.713) (-1017.493) (-1017.497) [-1018.099] * (-1020.528) (-1019.772) (-1017.847) [-1016.080] -- 0:00:47
144500 -- (-1017.748) (-1016.745) (-1017.231) [-1015.985] * (-1020.684) (-1018.664) [-1017.361] (-1021.064) -- 0:00:47
145000 -- (-1016.039) (-1016.379) (-1017.709) [-1018.144] * (-1018.506) (-1018.055) [-1017.365] (-1018.070) -- 0:00:53
Average standard deviation of split frequencies: 0.014275
145500 -- (-1017.132) (-1017.259) [-1016.647] (-1016.525) * (-1018.246) (-1018.386) (-1016.998) [-1016.756] -- 0:00:52
146000 -- (-1015.871) [-1017.114] (-1018.120) (-1015.360) * (-1020.472) (-1019.087) (-1016.658) [-1017.549] -- 0:00:52
146500 -- (-1017.915) (-1017.682) [-1018.205] (-1015.772) * (-1016.898) (-1017.171) (-1018.365) [-1016.018] -- 0:00:52
147000 -- (-1020.936) [-1019.448] (-1019.138) (-1021.724) * (-1019.052) (-1018.934) (-1022.040) [-1016.141] -- 0:00:52
147500 -- [-1016.370] (-1017.273) (-1019.597) (-1018.547) * (-1019.632) [-1015.998] (-1018.153) (-1021.825) -- 0:00:52
148000 -- (-1018.612) (-1016.213) [-1018.872] (-1018.244) * (-1020.456) [-1019.183] (-1017.518) (-1020.705) -- 0:00:51
148500 -- (-1027.858) [-1017.159] (-1018.598) (-1019.532) * (-1020.069) (-1016.357) (-1018.292) [-1017.542] -- 0:00:51
149000 -- (-1018.392) (-1016.394) [-1016.580] (-1018.803) * [-1020.952] (-1016.126) (-1019.251) (-1016.297) -- 0:00:51
149500 -- (-1019.045) (-1016.486) [-1021.074] (-1018.738) * (-1021.297) [-1016.636] (-1017.916) (-1015.998) -- 0:00:51
150000 -- (-1016.490) (-1018.233) (-1019.111) [-1016.636] * (-1022.294) (-1017.107) (-1018.728) [-1016.676] -- 0:00:51
Average standard deviation of split frequencies: 0.015992
150500 -- [-1017.329] (-1022.124) (-1018.010) (-1017.341) * (-1019.178) [-1017.595] (-1017.176) (-1016.235) -- 0:00:50
151000 -- [-1016.261] (-1019.677) (-1018.159) (-1015.864) * (-1020.195) (-1015.592) [-1016.680] (-1015.468) -- 0:00:50
151500 -- (-1015.612) (-1017.227) (-1018.613) [-1016.534] * (-1021.645) [-1015.502] (-1018.211) (-1017.210) -- 0:00:50
152000 -- (-1021.129) (-1017.491) [-1017.842] (-1016.713) * (-1016.859) (-1016.257) [-1018.209] (-1018.530) -- 0:00:50
152500 -- (-1020.868) (-1018.605) (-1017.434) [-1017.554] * (-1021.674) (-1016.034) [-1018.093] (-1017.333) -- 0:00:50
153000 -- (-1018.663) (-1016.986) [-1019.517] (-1015.969) * (-1016.740) (-1015.634) (-1016.225) [-1017.431] -- 0:00:49
153500 -- (-1015.875) (-1016.038) [-1018.043] (-1019.343) * [-1017.097] (-1019.137) (-1015.991) (-1018.192) -- 0:00:49
154000 -- (-1020.274) [-1015.849] (-1016.398) (-1016.024) * (-1018.680) (-1017.890) (-1015.973) [-1017.916] -- 0:00:49
154500 -- (-1016.691) [-1016.842] (-1017.467) (-1017.681) * (-1016.754) (-1019.420) (-1016.182) [-1020.208] -- 0:00:49
155000 -- (-1018.441) [-1016.175] (-1022.094) (-1019.649) * (-1016.100) [-1015.513] (-1017.304) (-1018.242) -- 0:00:49
Average standard deviation of split frequencies: 0.015949
155500 -- (-1019.646) [-1016.125] (-1018.701) (-1019.804) * (-1019.464) (-1015.609) (-1023.359) [-1016.806] -- 0:00:48
156000 -- (-1018.337) [-1016.316] (-1018.083) (-1022.449) * (-1020.878) (-1015.636) (-1016.058) [-1017.053] -- 0:00:48
156500 -- (-1018.226) [-1021.255] (-1019.454) (-1022.687) * (-1017.252) (-1016.816) [-1017.078] (-1017.901) -- 0:00:48
157000 -- (-1021.342) (-1016.126) (-1018.961) [-1017.083] * (-1017.972) [-1015.938] (-1016.686) (-1022.989) -- 0:00:48
157500 -- (-1019.064) [-1016.035] (-1020.219) (-1016.990) * [-1016.889] (-1020.770) (-1017.442) (-1018.323) -- 0:00:48
158000 -- (-1018.452) (-1019.857) (-1018.141) [-1017.478] * (-1016.460) (-1021.145) (-1016.839) [-1017.324] -- 0:00:47
158500 -- (-1016.991) (-1019.317) (-1016.265) [-1018.456] * [-1018.453] (-1017.387) (-1015.995) (-1021.712) -- 0:00:47
159000 -- (-1018.895) (-1016.897) (-1016.265) [-1016.149] * (-1018.538) [-1018.614] (-1016.591) (-1020.340) -- 0:00:47
159500 -- (-1017.523) (-1016.986) [-1016.926] (-1019.031) * (-1019.852) (-1016.976) [-1016.321] (-1018.058) -- 0:00:47
160000 -- [-1017.906] (-1016.724) (-1018.322) (-1016.827) * (-1016.676) (-1017.760) (-1020.185) [-1016.961] -- 0:00:47
Average standard deviation of split frequencies: 0.015361
160500 -- (-1015.821) (-1016.811) [-1016.366] (-1020.577) * (-1018.066) [-1017.867] (-1020.294) (-1018.920) -- 0:00:47
161000 -- (-1015.756) [-1018.709] (-1019.309) (-1021.696) * [-1016.841] (-1017.147) (-1015.732) (-1016.874) -- 0:00:46
161500 -- (-1017.793) [-1016.064] (-1016.792) (-1016.017) * (-1020.009) [-1016.756] (-1016.502) (-1018.661) -- 0:00:51
162000 -- [-1015.958] (-1016.302) (-1016.051) (-1016.031) * (-1015.797) [-1016.051] (-1018.280) (-1017.971) -- 0:00:51
162500 -- (-1016.699) [-1017.073] (-1020.093) (-1017.475) * (-1018.261) (-1020.862) (-1017.269) [-1017.981] -- 0:00:51
163000 -- (-1017.370) [-1017.413] (-1021.853) (-1017.970) * [-1017.635] (-1017.875) (-1021.329) (-1018.485) -- 0:00:51
163500 -- (-1018.547) (-1017.790) (-1021.976) [-1015.898] * (-1019.408) [-1016.069] (-1018.333) (-1017.210) -- 0:00:51
164000 -- [-1017.532] (-1018.346) (-1022.958) (-1016.748) * (-1016.272) [-1016.079] (-1017.580) (-1017.237) -- 0:00:50
164500 -- (-1019.315) (-1015.758) [-1020.291] (-1017.724) * (-1016.758) [-1018.436] (-1018.628) (-1017.255) -- 0:00:50
165000 -- (-1018.516) [-1015.635] (-1016.441) (-1017.994) * (-1016.184) (-1019.338) (-1016.290) [-1017.783] -- 0:00:50
Average standard deviation of split frequencies: 0.013726
165500 -- (-1017.387) [-1016.348] (-1016.196) (-1018.406) * (-1016.229) (-1017.448) (-1017.294) [-1017.901] -- 0:00:50
166000 -- (-1019.140) (-1017.165) [-1016.508] (-1019.107) * (-1015.552) [-1018.545] (-1020.677) (-1017.550) -- 0:00:50
166500 -- (-1017.107) (-1022.014) [-1015.991] (-1018.303) * [-1016.220] (-1016.640) (-1019.241) (-1020.964) -- 0:00:50
167000 -- (-1019.567) (-1016.840) [-1017.852] (-1019.347) * (-1017.078) (-1016.820) [-1016.116] (-1023.639) -- 0:00:49
167500 -- (-1018.238) (-1019.194) [-1017.408] (-1024.320) * (-1015.885) [-1016.356] (-1018.356) (-1021.608) -- 0:00:49
168000 -- (-1019.235) (-1018.196) (-1019.544) [-1017.640] * (-1023.454) (-1016.628) [-1017.633] (-1016.919) -- 0:00:49
168500 -- [-1017.114] (-1016.599) (-1016.713) (-1017.246) * (-1021.077) (-1016.548) (-1017.773) [-1017.580] -- 0:00:49
169000 -- [-1016.866] (-1016.993) (-1019.880) (-1020.374) * (-1017.809) (-1017.645) (-1021.219) [-1018.832] -- 0:00:49
169500 -- (-1016.973) (-1017.337) (-1016.646) [-1018.393] * (-1017.121) (-1018.937) (-1022.292) [-1016.563] -- 0:00:48
170000 -- (-1021.815) [-1015.642] (-1017.160) (-1018.678) * [-1018.335] (-1016.232) (-1017.777) (-1018.454) -- 0:00:48
Average standard deviation of split frequencies: 0.011049
170500 -- [-1022.068] (-1017.261) (-1018.132) (-1021.506) * [-1017.426] (-1015.805) (-1015.964) (-1017.318) -- 0:00:48
171000 -- (-1018.544) [-1016.649] (-1017.541) (-1022.568) * (-1018.467) (-1017.625) (-1016.595) [-1016.019] -- 0:00:48
171500 -- (-1021.068) [-1015.634] (-1016.929) (-1018.433) * [-1018.225] (-1022.861) (-1017.051) (-1016.153) -- 0:00:48
172000 -- (-1020.147) (-1017.728) (-1017.007) [-1020.880] * (-1018.739) (-1017.805) [-1016.950] (-1017.533) -- 0:00:48
172500 -- [-1017.939] (-1016.545) (-1020.666) (-1019.659) * (-1024.141) [-1019.352] (-1021.033) (-1017.758) -- 0:00:47
173000 -- (-1017.864) [-1016.173] (-1018.355) (-1018.646) * (-1018.072) (-1017.720) [-1018.416] (-1020.677) -- 0:00:47
173500 -- [-1018.487] (-1016.950) (-1019.981) (-1017.126) * [-1015.894] (-1018.099) (-1018.897) (-1019.880) -- 0:00:47
174000 -- (-1023.231) (-1016.410) [-1020.309] (-1017.624) * (-1016.305) (-1017.883) [-1018.631] (-1019.537) -- 0:00:47
174500 -- (-1022.068) (-1017.596) (-1018.591) [-1018.230] * [-1015.928] (-1019.441) (-1016.308) (-1022.451) -- 0:00:47
175000 -- [-1019.146] (-1017.049) (-1018.890) (-1019.251) * (-1016.492) (-1020.356) [-1015.991] (-1017.430) -- 0:00:47
Average standard deviation of split frequencies: 0.013235
175500 -- (-1019.160) (-1023.871) (-1018.045) [-1017.919] * (-1015.591) (-1018.878) (-1015.991) [-1018.992] -- 0:00:46
176000 -- (-1016.724) [-1021.010] (-1016.390) (-1018.807) * (-1015.648) (-1018.186) (-1015.802) [-1016.580] -- 0:00:46
176500 -- [-1017.174] (-1018.431) (-1015.645) (-1016.860) * (-1017.124) (-1017.553) [-1016.779] (-1016.691) -- 0:00:46
177000 -- (-1016.513) [-1017.685] (-1018.938) (-1016.213) * (-1016.509) (-1017.682) [-1016.735] (-1016.906) -- 0:00:46
177500 -- [-1017.201] (-1020.598) (-1018.770) (-1018.233) * (-1016.891) (-1017.054) (-1019.134) [-1020.163] -- 0:00:46
178000 -- (-1016.993) [-1018.737] (-1022.032) (-1018.854) * [-1017.287] (-1017.543) (-1017.261) (-1016.958) -- 0:00:46
178500 -- (-1020.501) (-1017.522) (-1016.641) [-1016.035] * [-1017.141] (-1015.617) (-1017.567) (-1016.286) -- 0:00:50
179000 -- (-1022.956) (-1022.581) (-1017.088) [-1016.900] * [-1015.954] (-1015.349) (-1016.527) (-1017.421) -- 0:00:50
179500 -- (-1016.430) (-1016.848) (-1019.784) [-1018.596] * [-1016.238] (-1015.558) (-1018.615) (-1017.264) -- 0:00:50
180000 -- (-1016.194) [-1018.710] (-1023.921) (-1017.511) * [-1018.553] (-1018.771) (-1017.115) (-1017.959) -- 0:00:50
Average standard deviation of split frequencies: 0.012279
180500 -- (-1030.430) (-1019.965) (-1016.724) [-1017.802] * (-1019.849) (-1017.046) [-1015.984] (-1021.266) -- 0:00:49
181000 -- (-1019.874) (-1016.158) [-1017.137] (-1017.192) * (-1016.413) (-1016.308) [-1017.729] (-1017.303) -- 0:00:49
181500 -- (-1016.110) (-1016.256) (-1016.210) [-1017.103] * [-1016.461] (-1015.712) (-1018.195) (-1020.151) -- 0:00:49
182000 -- (-1017.328) [-1016.187] (-1016.096) (-1017.206) * (-1016.732) (-1015.453) [-1019.426] (-1020.141) -- 0:00:49
182500 -- (-1021.989) [-1015.611] (-1015.626) (-1018.763) * (-1017.734) (-1015.716) [-1016.872] (-1016.094) -- 0:00:49
183000 -- (-1016.833) (-1016.683) [-1015.787] (-1021.716) * (-1020.190) [-1016.411] (-1021.012) (-1016.575) -- 0:00:49
183500 -- (-1017.785) [-1018.313] (-1016.148) (-1016.163) * (-1022.707) [-1017.730] (-1016.124) (-1018.169) -- 0:00:48
184000 -- (-1018.060) [-1017.820] (-1018.796) (-1017.077) * (-1020.663) (-1018.601) [-1016.491] (-1018.171) -- 0:00:48
184500 -- (-1018.395) [-1016.729] (-1016.252) (-1019.560) * (-1019.493) (-1021.781) [-1016.472] (-1019.202) -- 0:00:48
185000 -- (-1019.768) [-1023.163] (-1016.545) (-1019.195) * (-1020.139) [-1018.511] (-1018.204) (-1020.640) -- 0:00:48
Average standard deviation of split frequencies: 0.012672
185500 -- (-1016.598) (-1017.821) [-1016.556] (-1020.587) * (-1019.889) [-1019.926] (-1018.350) (-1016.638) -- 0:00:48
186000 -- (-1017.393) [-1015.936] (-1016.258) (-1019.644) * (-1019.927) (-1016.813) (-1020.189) [-1019.069] -- 0:00:48
186500 -- [-1016.328] (-1016.595) (-1018.688) (-1020.023) * [-1017.392] (-1016.606) (-1019.559) (-1018.760) -- 0:00:47
187000 -- [-1016.204] (-1016.032) (-1024.000) (-1018.592) * (-1019.261) [-1018.000] (-1021.866) (-1022.020) -- 0:00:47
187500 -- (-1017.477) (-1018.214) (-1017.308) [-1016.923] * (-1016.053) [-1022.399] (-1015.898) (-1024.771) -- 0:00:47
188000 -- (-1022.669) (-1018.555) [-1022.019] (-1016.357) * (-1017.749) [-1019.298] (-1015.781) (-1023.250) -- 0:00:47
188500 -- (-1017.779) [-1016.873] (-1017.126) (-1015.902) * (-1017.815) [-1016.983] (-1016.300) (-1018.178) -- 0:00:47
189000 -- (-1020.980) [-1018.254] (-1018.161) (-1016.766) * (-1017.629) [-1016.635] (-1018.566) (-1019.689) -- 0:00:47
189500 -- (-1021.363) [-1020.214] (-1017.637) (-1021.659) * (-1015.643) [-1016.528] (-1020.681) (-1016.492) -- 0:00:47
190000 -- (-1021.831) (-1016.206) [-1015.667] (-1023.121) * (-1017.376) (-1016.189) [-1019.500] (-1016.985) -- 0:00:46
Average standard deviation of split frequencies: 0.014444
190500 -- (-1017.676) (-1022.838) [-1016.258] (-1020.251) * (-1016.977) [-1017.607] (-1019.966) (-1021.058) -- 0:00:46
191000 -- (-1017.351) [-1018.398] (-1016.933) (-1018.027) * (-1023.485) [-1017.732] (-1016.175) (-1016.779) -- 0:00:46
191500 -- (-1016.640) (-1016.557) (-1017.450) [-1016.643] * (-1020.330) (-1017.133) (-1015.828) [-1017.788] -- 0:00:46
192000 -- (-1016.989) (-1021.166) [-1021.380] (-1020.470) * [-1016.672] (-1026.272) (-1017.637) (-1017.557) -- 0:00:46
192500 -- (-1020.814) [-1016.374] (-1017.039) (-1020.006) * (-1015.490) (-1018.712) [-1021.750] (-1017.477) -- 0:00:46
193000 -- (-1019.024) (-1016.485) (-1019.390) [-1017.993] * [-1015.448] (-1022.830) (-1020.114) (-1015.757) -- 0:00:45
193500 -- (-1017.680) [-1017.289] (-1019.155) (-1018.299) * (-1018.097) [-1017.930] (-1017.669) (-1016.588) -- 0:00:45
194000 -- [-1017.335] (-1017.824) (-1020.364) (-1018.176) * (-1018.519) [-1018.884] (-1016.135) (-1017.869) -- 0:00:45
194500 -- (-1016.940) (-1016.877) (-1017.430) [-1018.123] * (-1022.443) (-1017.949) [-1017.892] (-1016.576) -- 0:00:45
195000 -- (-1023.651) (-1017.657) (-1017.123) [-1018.565] * (-1016.794) [-1021.521] (-1017.516) (-1016.059) -- 0:00:49
Average standard deviation of split frequencies: 0.014684
195500 -- (-1017.430) [-1016.538] (-1017.536) (-1017.830) * (-1016.571) (-1020.156) [-1017.376] (-1017.812) -- 0:00:49
196000 -- (-1017.674) (-1017.901) (-1019.931) [-1018.234] * (-1019.049) (-1019.955) (-1018.034) [-1018.097] -- 0:00:49
196500 -- [-1016.805] (-1019.974) (-1022.975) (-1018.740) * (-1016.270) (-1018.746) [-1016.738] (-1017.053) -- 0:00:49
197000 -- [-1017.214] (-1019.157) (-1022.479) (-1017.716) * (-1016.436) (-1018.170) (-1018.482) [-1018.503] -- 0:00:48
197500 -- (-1016.196) (-1021.358) (-1019.119) [-1015.990] * [-1016.515] (-1019.859) (-1017.478) (-1016.953) -- 0:00:48
198000 -- (-1017.808) (-1021.960) [-1018.295] (-1017.574) * [-1016.616] (-1019.874) (-1017.813) (-1019.853) -- 0:00:48
198500 -- (-1017.127) (-1017.012) [-1019.563] (-1017.197) * [-1016.831] (-1023.759) (-1017.253) (-1019.304) -- 0:00:48
199000 -- (-1016.188) (-1016.262) [-1016.538] (-1016.497) * [-1016.579] (-1021.712) (-1017.939) (-1015.525) -- 0:00:48
199500 -- [-1016.983] (-1016.150) (-1020.504) (-1018.650) * (-1015.430) [-1015.718] (-1017.560) (-1016.482) -- 0:00:48
200000 -- (-1020.448) (-1016.463) [-1019.612] (-1018.551) * (-1016.293) (-1015.581) (-1019.129) [-1017.056] -- 0:00:48
Average standard deviation of split frequencies: 0.014342
200500 -- (-1021.966) (-1016.360) (-1016.136) [-1016.534] * (-1018.631) [-1019.515] (-1018.974) (-1016.692) -- 0:00:47
201000 -- [-1018.879] (-1021.618) (-1015.452) (-1016.223) * (-1017.963) (-1019.483) (-1020.323) [-1023.304] -- 0:00:47
201500 -- (-1019.929) (-1016.656) [-1015.452] (-1018.203) * (-1017.835) [-1017.355] (-1020.937) (-1019.916) -- 0:00:47
202000 -- (-1015.881) (-1017.856) (-1017.143) [-1018.798] * [-1018.910] (-1018.641) (-1016.686) (-1018.815) -- 0:00:47
202500 -- (-1021.473) [-1018.952] (-1016.137) (-1020.594) * (-1018.619) (-1018.495) [-1017.650] (-1016.762) -- 0:00:47
203000 -- (-1020.696) [-1017.260] (-1016.271) (-1017.773) * (-1019.209) [-1016.869] (-1015.935) (-1017.636) -- 0:00:47
203500 -- (-1017.271) (-1020.315) (-1018.339) [-1020.612] * [-1017.385] (-1017.993) (-1016.971) (-1018.472) -- 0:00:46
204000 -- (-1019.354) (-1020.782) [-1016.455] (-1017.086) * (-1016.916) [-1015.737] (-1016.469) (-1016.349) -- 0:00:46
204500 -- [-1017.045] (-1018.072) (-1018.642) (-1016.536) * (-1017.066) (-1018.754) [-1019.754] (-1017.635) -- 0:00:46
205000 -- [-1018.091] (-1022.074) (-1016.865) (-1017.344) * (-1017.066) [-1019.845] (-1017.296) (-1021.314) -- 0:00:46
Average standard deviation of split frequencies: 0.013008
205500 -- [-1017.130] (-1017.783) (-1016.326) (-1018.269) * [-1017.090] (-1019.640) (-1016.423) (-1017.922) -- 0:00:46
206000 -- [-1016.950] (-1017.549) (-1015.976) (-1017.814) * (-1017.832) (-1024.357) (-1016.299) [-1016.112] -- 0:00:46
206500 -- [-1017.190] (-1017.469) (-1016.518) (-1016.736) * (-1018.364) [-1020.058] (-1019.852) (-1016.102) -- 0:00:46
207000 -- (-1017.069) (-1018.565) (-1020.602) [-1018.683] * [-1017.101] (-1020.864) (-1016.303) (-1015.804) -- 0:00:45
207500 -- (-1016.394) (-1024.526) (-1021.195) [-1018.305] * (-1017.451) (-1021.387) (-1019.171) [-1015.516] -- 0:00:45
208000 -- (-1017.870) (-1016.324) (-1022.282) [-1016.828] * [-1019.245] (-1021.870) (-1015.950) (-1015.502) -- 0:00:45
208500 -- [-1016.690] (-1015.853) (-1020.849) (-1016.439) * (-1016.612) (-1020.586) (-1018.327) [-1017.618] -- 0:00:45
209000 -- (-1022.092) (-1017.292) (-1018.242) [-1015.584] * (-1016.995) [-1017.491] (-1016.401) (-1017.967) -- 0:00:45
209500 -- (-1023.294) [-1016.744] (-1018.596) (-1016.904) * [-1021.306] (-1018.927) (-1015.810) (-1017.257) -- 0:00:45
210000 -- (-1019.701) [-1019.456] (-1016.976) (-1018.639) * (-1015.620) (-1017.549) [-1016.080] (-1016.669) -- 0:00:45
Average standard deviation of split frequencies: 0.012556
210500 -- [-1018.406] (-1019.922) (-1017.500) (-1015.899) * (-1015.590) (-1018.360) [-1015.367] (-1020.956) -- 0:00:45
211000 -- (-1018.360) [-1017.943] (-1017.108) (-1016.153) * [-1017.152] (-1016.322) (-1016.853) (-1020.765) -- 0:00:44
211500 -- (-1016.472) (-1020.082) (-1017.536) [-1017.072] * [-1015.899] (-1016.172) (-1016.120) (-1018.555) -- 0:00:48
212000 -- [-1018.603] (-1018.793) (-1016.619) (-1015.550) * (-1020.318) [-1016.024] (-1015.847) (-1018.708) -- 0:00:48
212500 -- (-1019.330) [-1017.520] (-1017.740) (-1019.180) * (-1018.222) [-1016.614] (-1016.529) (-1021.367) -- 0:00:48
213000 -- [-1015.891] (-1018.656) (-1018.965) (-1023.956) * (-1018.944) (-1015.747) [-1020.609] (-1021.415) -- 0:00:48
213500 -- (-1017.151) [-1017.037] (-1017.826) (-1018.049) * (-1019.736) (-1016.160) [-1017.429] (-1018.754) -- 0:00:47
214000 -- (-1018.425) (-1019.689) (-1017.507) [-1018.454] * (-1016.881) (-1017.369) (-1018.775) [-1018.413] -- 0:00:47
214500 -- (-1018.213) (-1018.752) [-1017.793] (-1018.089) * (-1016.447) [-1017.243] (-1016.307) (-1017.982) -- 0:00:47
215000 -- (-1018.695) (-1018.386) [-1016.646] (-1016.458) * (-1019.366) (-1018.490) [-1020.271] (-1016.396) -- 0:00:47
Average standard deviation of split frequencies: 0.012246
215500 -- (-1020.955) [-1018.620] (-1019.437) (-1016.341) * (-1017.790) [-1018.905] (-1019.215) (-1020.414) -- 0:00:47
216000 -- (-1018.356) [-1019.858] (-1018.726) (-1020.587) * (-1023.173) (-1017.243) (-1020.024) [-1019.095] -- 0:00:47
216500 -- [-1016.920] (-1022.807) (-1018.554) (-1016.607) * [-1016.279] (-1017.768) (-1017.053) (-1016.731) -- 0:00:47
217000 -- (-1016.268) [-1023.314] (-1019.349) (-1017.585) * (-1016.624) (-1018.246) (-1015.856) [-1015.906] -- 0:00:46
217500 -- (-1016.204) (-1019.689) (-1019.483) [-1017.573] * (-1017.557) (-1016.298) (-1019.622) [-1016.075] -- 0:00:46
218000 -- (-1016.411) (-1021.259) [-1018.039] (-1017.209) * (-1016.386) [-1018.038] (-1015.719) (-1018.529) -- 0:00:46
218500 -- [-1015.486] (-1022.393) (-1019.930) (-1017.544) * (-1016.215) [-1019.976] (-1016.768) (-1016.539) -- 0:00:46
219000 -- (-1019.833) (-1016.984) (-1015.873) [-1019.544] * (-1017.450) (-1017.288) (-1018.670) [-1017.678] -- 0:00:46
219500 -- (-1018.338) (-1018.957) (-1016.887) [-1019.167] * (-1019.137) [-1020.963] (-1016.770) (-1017.259) -- 0:00:46
220000 -- (-1016.903) [-1019.954] (-1017.591) (-1021.152) * (-1019.125) [-1021.239] (-1019.944) (-1015.846) -- 0:00:46
Average standard deviation of split frequencies: 0.011468
220500 -- (-1018.931) (-1017.179) [-1016.314] (-1019.376) * (-1018.072) [-1019.577] (-1018.541) (-1020.196) -- 0:00:45
221000 -- (-1019.865) (-1021.083) [-1016.789] (-1017.965) * (-1017.920) [-1017.180] (-1017.433) (-1023.116) -- 0:00:45
221500 -- [-1016.843] (-1016.457) (-1018.870) (-1019.215) * (-1017.211) (-1016.378) [-1021.994] (-1020.083) -- 0:00:45
222000 -- [-1016.027] (-1016.187) (-1019.270) (-1018.575) * (-1016.962) (-1015.953) [-1017.034] (-1020.399) -- 0:00:45
222500 -- [-1016.526] (-1017.121) (-1020.838) (-1019.429) * (-1018.504) (-1016.015) (-1021.347) [-1017.689] -- 0:00:45
223000 -- (-1019.449) [-1017.845] (-1018.000) (-1019.637) * [-1017.910] (-1018.827) (-1018.755) (-1021.123) -- 0:00:45
223500 -- (-1019.000) [-1017.543] (-1018.489) (-1016.983) * [-1017.350] (-1016.152) (-1021.187) (-1021.031) -- 0:00:45
224000 -- (-1017.264) (-1017.386) [-1016.155] (-1017.858) * (-1018.316) (-1017.216) (-1020.921) [-1017.167] -- 0:00:45
224500 -- (-1018.327) (-1016.375) (-1016.767) [-1019.336] * (-1016.018) [-1017.013] (-1019.565) (-1016.366) -- 0:00:44
225000 -- [-1017.086] (-1018.222) (-1017.380) (-1017.851) * (-1017.750) (-1017.715) (-1018.528) [-1015.800] -- 0:00:44
Average standard deviation of split frequencies: 0.010429
225500 -- (-1017.127) [-1016.924] (-1016.174) (-1018.723) * (-1021.232) [-1017.790] (-1018.782) (-1016.224) -- 0:00:44
226000 -- (-1017.796) (-1016.835) (-1018.875) [-1019.656] * (-1020.076) (-1017.793) [-1018.978] (-1019.888) -- 0:00:44
226500 -- (-1019.366) (-1016.599) [-1016.521] (-1016.087) * (-1017.476) (-1017.898) [-1019.010] (-1017.117) -- 0:00:44
227000 -- (-1016.137) (-1017.251) [-1016.789] (-1015.975) * [-1020.788] (-1017.503) (-1019.814) (-1016.575) -- 0:00:44
227500 -- (-1016.631) (-1015.943) [-1021.873] (-1016.742) * [-1016.359] (-1017.618) (-1019.421) (-1017.519) -- 0:00:44
228000 -- [-1018.180] (-1016.557) (-1019.837) (-1020.362) * [-1016.299] (-1017.221) (-1016.465) (-1016.809) -- 0:00:47
228500 -- [-1020.716] (-1020.636) (-1019.402) (-1016.484) * (-1017.627) (-1016.673) [-1017.910] (-1018.879) -- 0:00:47
229000 -- [-1022.429] (-1019.122) (-1017.775) (-1016.153) * (-1016.527) (-1017.285) [-1016.351] (-1017.849) -- 0:00:47
229500 -- (-1017.659) (-1017.537) (-1016.867) [-1015.760] * (-1020.973) (-1018.346) (-1016.943) [-1017.034] -- 0:00:47
230000 -- (-1020.874) (-1017.583) (-1017.933) [-1015.722] * (-1017.635) (-1016.340) (-1017.682) [-1017.562] -- 0:00:46
Average standard deviation of split frequencies: 0.010971
230500 -- (-1019.036) (-1017.574) [-1017.950] (-1017.551) * (-1019.419) (-1020.344) [-1018.420] (-1017.882) -- 0:00:46
231000 -- (-1016.374) (-1016.382) [-1017.898] (-1018.092) * [-1019.979] (-1016.830) (-1019.382) (-1018.187) -- 0:00:46
231500 -- (-1016.556) [-1018.073] (-1018.352) (-1017.153) * [-1017.048] (-1016.721) (-1018.334) (-1018.070) -- 0:00:46
232000 -- (-1016.710) (-1017.007) [-1019.381] (-1017.103) * (-1022.452) (-1017.071) [-1019.125] (-1020.890) -- 0:00:46
232500 -- (-1017.913) (-1016.641) [-1017.684] (-1017.781) * (-1017.447) (-1016.234) (-1017.083) [-1017.059] -- 0:00:46
233000 -- (-1015.729) (-1016.432) (-1016.437) [-1017.155] * [-1016.380] (-1017.416) (-1018.117) (-1017.003) -- 0:00:46
233500 -- (-1015.831) [-1016.189] (-1018.809) (-1023.989) * (-1016.853) (-1017.497) (-1019.073) [-1019.240] -- 0:00:45
234000 -- (-1016.151) (-1016.222) (-1017.291) [-1020.176] * [-1017.834] (-1018.279) (-1018.348) (-1015.461) -- 0:00:45
234500 -- (-1015.983) (-1026.305) [-1017.840] (-1020.101) * (-1016.923) (-1023.229) (-1017.988) [-1016.005] -- 0:00:45
235000 -- (-1016.003) [-1017.525] (-1016.895) (-1021.817) * (-1015.823) (-1016.859) (-1016.733) [-1015.545] -- 0:00:45
Average standard deviation of split frequencies: 0.011564
235500 -- (-1015.973) (-1016.526) (-1016.347) [-1018.067] * [-1015.813] (-1019.450) (-1017.510) (-1015.687) -- 0:00:45
236000 -- (-1015.801) (-1016.621) [-1017.591] (-1017.704) * (-1015.930) [-1017.562] (-1016.233) (-1017.752) -- 0:00:45
236500 -- (-1015.749) [-1016.993] (-1016.807) (-1017.364) * (-1015.798) [-1015.820] (-1016.654) (-1017.106) -- 0:00:45
237000 -- [-1017.958] (-1020.209) (-1017.544) (-1020.381) * (-1021.403) (-1021.021) [-1017.002] (-1016.873) -- 0:00:45
237500 -- (-1021.209) (-1019.809) (-1016.407) [-1016.986] * (-1019.005) [-1017.953] (-1016.221) (-1015.986) -- 0:00:44
238000 -- (-1021.026) [-1016.778] (-1019.103) (-1020.161) * (-1015.840) (-1021.295) [-1018.209] (-1016.367) -- 0:00:44
238500 -- [-1019.749] (-1019.509) (-1020.845) (-1020.119) * (-1017.725) (-1018.718) (-1019.270) [-1016.373] -- 0:00:44
239000 -- [-1016.642] (-1018.225) (-1017.987) (-1016.535) * (-1017.706) (-1016.918) [-1018.953] (-1015.935) -- 0:00:44
239500 -- (-1020.128) (-1018.237) (-1016.694) [-1016.730] * (-1017.937) (-1018.167) (-1018.274) [-1016.060] -- 0:00:44
240000 -- (-1019.971) (-1016.419) [-1016.840] (-1018.344) * (-1018.263) (-1022.329) (-1017.768) [-1016.058] -- 0:00:44
Average standard deviation of split frequencies: 0.011649
240500 -- (-1021.870) (-1017.339) (-1017.615) [-1017.865] * (-1017.684) (-1018.516) (-1017.111) [-1020.694] -- 0:00:44
241000 -- (-1020.207) [-1018.380] (-1017.694) (-1017.616) * (-1016.843) (-1016.896) [-1017.037] (-1017.518) -- 0:00:44
241500 -- [-1017.746] (-1021.061) (-1018.992) (-1017.941) * (-1017.631) [-1020.404] (-1017.362) (-1016.576) -- 0:00:43
242000 -- [-1016.245] (-1017.882) (-1018.818) (-1017.035) * (-1017.014) (-1017.429) [-1018.906] (-1016.274) -- 0:00:43
242500 -- (-1017.830) (-1022.008) [-1016.119] (-1019.896) * (-1019.779) (-1016.649) (-1018.055) [-1016.830] -- 0:00:43
243000 -- [-1017.569] (-1023.996) (-1016.401) (-1022.609) * (-1021.262) (-1017.176) (-1017.197) [-1015.994] -- 0:00:43
243500 -- (-1017.802) [-1016.337] (-1017.798) (-1018.865) * (-1015.706) [-1018.928] (-1016.703) (-1017.563) -- 0:00:43
244000 -- (-1018.487) (-1016.467) [-1017.621] (-1016.638) * (-1018.877) (-1018.051) [-1016.992] (-1024.311) -- 0:00:43
244500 -- (-1019.431) (-1017.881) (-1019.428) [-1019.158] * [-1015.948] (-1019.407) (-1016.230) (-1017.363) -- 0:00:46
245000 -- (-1018.802) (-1017.461) (-1018.366) [-1016.559] * (-1021.962) [-1018.598] (-1017.452) (-1020.123) -- 0:00:46
Average standard deviation of split frequencies: 0.011296
245500 -- (-1021.214) [-1016.583] (-1018.305) (-1016.815) * (-1021.368) [-1017.972] (-1017.047) (-1016.380) -- 0:00:46
246000 -- (-1022.364) (-1016.869) (-1018.424) [-1017.299] * [-1018.244] (-1019.035) (-1015.665) (-1018.094) -- 0:00:45
246500 -- (-1018.479) [-1015.925] (-1021.354) (-1016.165) * [-1016.700] (-1018.055) (-1015.662) (-1019.070) -- 0:00:45
247000 -- (-1022.567) [-1017.134] (-1020.213) (-1017.896) * (-1016.872) (-1017.014) [-1015.549] (-1018.551) -- 0:00:45
247500 -- [-1017.782] (-1022.694) (-1019.997) (-1017.300) * (-1017.476) (-1017.133) (-1015.520) [-1017.529] -- 0:00:45
248000 -- [-1020.156] (-1016.325) (-1019.537) (-1018.265) * (-1020.452) (-1016.556) (-1019.527) [-1018.922] -- 0:00:45
248500 -- [-1020.762] (-1019.036) (-1018.600) (-1016.449) * [-1020.103] (-1017.236) (-1020.890) (-1017.587) -- 0:00:45
249000 -- [-1016.352] (-1016.886) (-1017.284) (-1018.610) * (-1018.540) (-1017.611) (-1018.123) [-1016.278] -- 0:00:45
249500 -- [-1015.698] (-1017.369) (-1021.811) (-1018.545) * (-1017.356) (-1019.117) [-1017.448] (-1015.663) -- 0:00:45
250000 -- (-1017.510) [-1016.302] (-1018.646) (-1016.769) * [-1016.637] (-1016.473) (-1015.894) (-1018.615) -- 0:00:45
Average standard deviation of split frequencies: 0.011680
250500 -- (-1016.507) (-1017.576) (-1017.116) [-1019.165] * (-1016.066) (-1017.651) [-1015.840] (-1016.299) -- 0:00:44
251000 -- [-1018.947] (-1020.168) (-1019.398) (-1016.941) * (-1016.983) (-1016.401) (-1020.472) [-1016.103] -- 0:00:44
251500 -- [-1018.465] (-1021.985) (-1016.255) (-1017.229) * (-1017.555) (-1017.438) (-1018.713) [-1017.749] -- 0:00:44
252000 -- [-1017.330] (-1020.358) (-1016.786) (-1020.013) * (-1016.092) [-1020.482] (-1020.483) (-1018.058) -- 0:00:44
252500 -- [-1016.660] (-1017.441) (-1018.791) (-1018.599) * (-1016.090) (-1016.905) (-1018.060) [-1017.557] -- 0:00:44
253000 -- (-1017.823) (-1016.473) [-1016.834] (-1017.013) * (-1015.482) (-1016.761) [-1020.203] (-1020.293) -- 0:00:44
253500 -- [-1017.019] (-1017.304) (-1016.423) (-1016.937) * (-1015.489) (-1016.139) [-1017.521] (-1026.297) -- 0:00:44
254000 -- (-1017.921) (-1017.184) [-1017.895] (-1023.291) * (-1016.810) (-1016.870) [-1016.833] (-1017.384) -- 0:00:44
254500 -- (-1018.809) (-1016.531) [-1017.203] (-1019.695) * (-1015.664) (-1020.553) [-1017.008] (-1018.764) -- 0:00:43
255000 -- (-1016.692) [-1016.974] (-1016.279) (-1019.439) * (-1015.365) (-1015.615) [-1017.062] (-1017.210) -- 0:00:43
Average standard deviation of split frequencies: 0.011145
255500 -- (-1016.463) (-1016.975) [-1015.892] (-1016.722) * [-1019.947] (-1016.054) (-1016.931) (-1018.324) -- 0:00:43
256000 -- [-1016.170] (-1018.211) (-1020.477) (-1017.000) * (-1016.401) [-1017.838] (-1016.792) (-1016.352) -- 0:00:43
256500 -- [-1016.461] (-1021.320) (-1025.367) (-1023.638) * (-1017.493) [-1019.244] (-1019.145) (-1018.795) -- 0:00:43
257000 -- (-1017.599) (-1017.360) [-1016.285] (-1019.772) * (-1016.463) [-1017.978] (-1016.073) (-1019.431) -- 0:00:43
257500 -- (-1016.156) [-1016.940] (-1018.611) (-1017.210) * (-1016.440) (-1017.023) [-1016.564] (-1017.745) -- 0:00:43
258000 -- [-1016.638] (-1018.683) (-1018.297) (-1017.707) * [-1017.045] (-1018.673) (-1020.206) (-1018.993) -- 0:00:43
258500 -- (-1017.849) [-1018.273] (-1016.775) (-1016.149) * (-1020.925) (-1017.285) [-1017.488] (-1017.492) -- 0:00:43
259000 -- [-1018.624] (-1017.136) (-1017.441) (-1019.729) * (-1016.841) [-1017.880] (-1016.983) (-1016.013) -- 0:00:42
259500 -- (-1018.051) (-1016.703) [-1019.441] (-1017.427) * (-1018.245) (-1017.851) [-1016.884] (-1015.727) -- 0:00:42
260000 -- (-1021.919) (-1024.044) [-1017.747] (-1019.696) * (-1018.535) [-1017.318] (-1016.320) (-1018.204) -- 0:00:42
Average standard deviation of split frequencies: 0.011253
260500 -- (-1016.318) (-1018.560) (-1016.201) [-1018.882] * (-1017.010) [-1017.447] (-1019.109) (-1019.920) -- 0:00:42
261000 -- (-1017.270) [-1019.040] (-1016.601) (-1017.210) * (-1016.861) [-1017.160] (-1017.776) (-1018.070) -- 0:00:45
261500 -- (-1018.307) (-1019.130) (-1015.841) [-1016.230] * [-1019.622] (-1017.849) (-1016.807) (-1018.371) -- 0:00:45
262000 -- (-1018.964) (-1020.494) (-1015.896) [-1017.147] * (-1017.699) (-1016.968) (-1018.268) [-1017.098] -- 0:00:45
262500 -- (-1018.035) [-1016.957] (-1020.038) (-1016.347) * (-1016.211) [-1016.232] (-1018.410) (-1018.892) -- 0:00:44
263000 -- (-1019.048) [-1017.435] (-1018.029) (-1016.248) * (-1015.805) [-1017.723] (-1018.487) (-1025.136) -- 0:00:44
263500 -- (-1016.167) (-1019.473) [-1016.531] (-1019.321) * [-1018.235] (-1019.231) (-1017.556) (-1021.881) -- 0:00:44
264000 -- [-1018.819] (-1017.191) (-1017.619) (-1018.231) * (-1018.247) [-1018.245] (-1018.290) (-1019.763) -- 0:00:44
264500 -- (-1016.930) (-1019.683) [-1015.976] (-1017.045) * [-1017.032] (-1016.049) (-1021.248) (-1017.724) -- 0:00:44
265000 -- [-1017.387] (-1019.692) (-1017.662) (-1018.107) * [-1017.139] (-1017.225) (-1017.297) (-1019.285) -- 0:00:44
Average standard deviation of split frequencies: 0.010042
265500 -- (-1017.911) [-1020.754] (-1017.544) (-1021.668) * (-1017.569) (-1016.495) (-1017.381) [-1022.893] -- 0:00:44
266000 -- [-1018.877] (-1018.562) (-1017.334) (-1019.178) * (-1015.592) (-1016.080) (-1019.310) [-1017.697] -- 0:00:44
266500 -- [-1019.939] (-1019.432) (-1018.468) (-1017.371) * (-1018.592) (-1016.472) (-1019.472) [-1017.049] -- 0:00:44
267000 -- (-1017.073) (-1018.959) (-1016.514) [-1018.164] * [-1016.969] (-1017.015) (-1018.329) (-1017.225) -- 0:00:43
267500 -- [-1019.701] (-1018.774) (-1016.857) (-1016.480) * [-1018.379] (-1018.013) (-1022.846) (-1018.385) -- 0:00:43
268000 -- (-1017.531) [-1017.240] (-1016.203) (-1016.550) * (-1020.890) (-1018.125) (-1018.880) [-1017.389] -- 0:00:43
268500 -- [-1016.965] (-1017.800) (-1016.122) (-1017.453) * [-1019.328] (-1016.486) (-1018.717) (-1017.314) -- 0:00:43
269000 -- (-1020.257) (-1018.359) [-1016.352] (-1020.139) * (-1019.123) (-1020.138) (-1016.906) [-1016.611] -- 0:00:43
269500 -- (-1024.253) (-1017.587) (-1017.339) [-1016.447] * [-1019.704] (-1020.972) (-1018.496) (-1017.800) -- 0:00:43
270000 -- (-1025.216) (-1018.603) (-1017.668) [-1016.531] * (-1016.604) [-1019.820] (-1018.348) (-1017.052) -- 0:00:43
Average standard deviation of split frequencies: 0.011367
270500 -- [-1018.065] (-1017.415) (-1016.119) (-1023.383) * [-1017.461] (-1020.238) (-1021.952) (-1018.205) -- 0:00:43
271000 -- (-1017.834) (-1016.869) (-1017.548) [-1017.914] * (-1018.166) (-1019.455) (-1018.062) [-1017.693] -- 0:00:43
271500 -- (-1021.434) (-1017.648) (-1017.007) [-1018.024] * (-1015.925) [-1018.324] (-1016.357) (-1018.631) -- 0:00:42
272000 -- (-1016.779) (-1017.047) [-1023.279] (-1017.216) * (-1019.699) [-1015.840] (-1016.238) (-1020.388) -- 0:00:42
272500 -- (-1019.026) [-1015.806] (-1018.467) (-1020.752) * (-1021.005) (-1015.414) [-1017.727] (-1017.376) -- 0:00:42
273000 -- (-1018.771) (-1020.485) [-1015.385] (-1018.212) * (-1020.566) (-1018.652) [-1017.150] (-1017.094) -- 0:00:42
273500 -- (-1020.062) (-1017.894) (-1017.109) [-1018.164] * (-1021.286) (-1017.833) (-1017.134) [-1018.197] -- 0:00:42
274000 -- (-1017.527) [-1018.589] (-1017.109) (-1016.714) * (-1024.153) (-1016.696) (-1017.672) [-1021.802] -- 0:00:42
274500 -- (-1017.127) [-1019.161] (-1016.154) (-1015.771) * (-1018.080) (-1021.107) [-1015.681] (-1019.390) -- 0:00:42
275000 -- (-1018.808) (-1018.612) (-1017.128) [-1017.098] * (-1017.889) (-1022.232) [-1015.672] (-1017.616) -- 0:00:42
Average standard deviation of split frequencies: 0.011506
275500 -- (-1022.702) (-1017.378) [-1017.335] (-1016.278) * (-1015.584) (-1024.446) [-1016.935] (-1017.708) -- 0:00:42
276000 -- (-1019.143) [-1016.154] (-1018.333) (-1020.610) * (-1018.061) (-1021.368) [-1016.798] (-1017.542) -- 0:00:41
276500 -- (-1019.977) [-1016.428] (-1017.174) (-1018.510) * (-1019.595) (-1016.305) [-1016.332] (-1017.763) -- 0:00:41
277000 -- (-1019.074) [-1016.818] (-1019.676) (-1021.126) * [-1017.688] (-1019.443) (-1017.200) (-1016.273) -- 0:00:41
277500 -- (-1017.865) (-1019.024) (-1017.795) [-1016.368] * (-1016.992) (-1019.648) (-1018.113) [-1015.622] -- 0:00:44
278000 -- (-1018.089) [-1019.798] (-1017.225) (-1018.650) * (-1016.559) (-1016.430) (-1016.731) [-1018.399] -- 0:00:44
278500 -- [-1016.621] (-1015.659) (-1017.685) (-1018.256) * [-1018.586] (-1017.177) (-1018.911) (-1016.966) -- 0:00:44
279000 -- (-1017.261) (-1016.399) (-1019.908) [-1018.538] * [-1019.635] (-1018.495) (-1022.570) (-1016.347) -- 0:00:43
279500 -- (-1016.938) [-1017.446] (-1018.371) (-1015.768) * [-1021.606] (-1015.652) (-1020.205) (-1016.786) -- 0:00:43
280000 -- [-1016.231] (-1024.512) (-1020.413) (-1016.500) * (-1019.431) [-1016.354] (-1018.579) (-1017.127) -- 0:00:43
Average standard deviation of split frequencies: 0.013810
280500 -- (-1021.323) [-1018.381] (-1016.867) (-1017.723) * (-1025.012) (-1017.263) [-1021.636] (-1017.171) -- 0:00:43
281000 -- [-1016.222] (-1019.341) (-1016.867) (-1017.731) * (-1021.185) [-1016.656] (-1018.983) (-1017.542) -- 0:00:43
281500 -- [-1021.054] (-1022.321) (-1016.691) (-1016.029) * (-1017.262) (-1017.978) (-1018.029) [-1017.767] -- 0:00:43
282000 -- (-1024.949) (-1018.560) [-1015.924] (-1015.884) * (-1017.279) (-1017.543) [-1016.264] (-1016.444) -- 0:00:43
282500 -- (-1018.687) (-1017.685) [-1016.928] (-1017.638) * (-1018.381) (-1017.059) [-1020.309] (-1016.742) -- 0:00:43
283000 -- (-1016.931) [-1017.717] (-1018.842) (-1017.174) * (-1017.809) (-1016.469) (-1017.334) [-1016.895] -- 0:00:43
283500 -- (-1016.010) [-1015.631] (-1016.386) (-1018.522) * [-1017.679] (-1017.805) (-1016.591) (-1018.044) -- 0:00:42
284000 -- (-1019.223) (-1015.751) [-1016.898] (-1017.680) * (-1022.700) [-1020.158] (-1016.519) (-1017.400) -- 0:00:42
284500 -- (-1018.710) [-1016.732] (-1017.358) (-1019.731) * (-1024.638) (-1018.788) [-1016.765] (-1019.446) -- 0:00:42
285000 -- [-1020.725] (-1017.000) (-1017.024) (-1017.385) * [-1015.806] (-1019.058) (-1018.289) (-1016.778) -- 0:00:42
Average standard deviation of split frequencies: 0.014401
285500 -- (-1016.926) (-1016.781) (-1020.698) [-1017.088] * (-1015.663) (-1020.436) [-1017.955] (-1015.633) -- 0:00:42
286000 -- (-1016.266) [-1019.467] (-1016.445) (-1017.153) * [-1017.717] (-1015.988) (-1017.708) (-1016.749) -- 0:00:42
286500 -- [-1016.505] (-1016.771) (-1020.767) (-1016.546) * (-1018.467) (-1020.453) (-1020.526) [-1016.567] -- 0:00:42
287000 -- (-1015.455) (-1016.751) (-1017.972) [-1017.730] * (-1017.991) (-1020.524) (-1017.126) [-1017.415] -- 0:00:42
287500 -- (-1015.830) [-1019.126] (-1019.097) (-1022.561) * [-1017.836] (-1019.733) (-1018.387) (-1016.324) -- 0:00:42
288000 -- (-1015.961) [-1017.179] (-1019.539) (-1024.902) * [-1017.195] (-1016.843) (-1020.557) (-1018.490) -- 0:00:42
288500 -- (-1018.658) [-1016.146] (-1021.918) (-1018.730) * (-1023.392) [-1017.331] (-1020.673) (-1017.598) -- 0:00:41
289000 -- (-1018.287) [-1016.233] (-1020.960) (-1019.028) * [-1017.931] (-1016.092) (-1016.867) (-1016.954) -- 0:00:41
289500 -- (-1018.533) (-1018.204) (-1019.167) [-1018.322] * (-1020.874) (-1015.979) [-1017.206] (-1017.134) -- 0:00:41
290000 -- (-1016.059) (-1020.355) (-1022.708) [-1016.910] * (-1016.914) [-1017.768] (-1018.712) (-1015.898) -- 0:00:41
Average standard deviation of split frequencies: 0.014169
290500 -- (-1016.519) (-1021.350) (-1021.081) [-1018.463] * (-1016.059) (-1021.634) [-1018.892] (-1017.177) -- 0:00:41
291000 -- (-1019.605) (-1018.232) (-1020.237) [-1016.423] * (-1019.155) (-1020.219) (-1020.390) [-1016.886] -- 0:00:41
291500 -- (-1017.526) (-1016.130) (-1017.561) [-1015.952] * (-1021.133) (-1017.559) (-1017.925) [-1018.051] -- 0:00:41
292000 -- (-1017.372) [-1016.254] (-1016.191) (-1015.799) * [-1015.887] (-1016.914) (-1018.178) (-1018.314) -- 0:00:41
292500 -- [-1016.826] (-1016.240) (-1016.563) (-1018.743) * (-1017.638) [-1016.427] (-1017.416) (-1018.295) -- 0:00:41
293000 -- [-1016.110] (-1018.042) (-1017.022) (-1019.117) * (-1019.455) (-1015.997) [-1019.078] (-1019.229) -- 0:00:41
293500 -- [-1017.017] (-1019.138) (-1019.074) (-1019.928) * [-1019.392] (-1017.679) (-1020.059) (-1019.309) -- 0:00:40
294000 -- (-1019.083) (-1018.262) [-1017.686] (-1022.944) * (-1017.154) (-1015.922) [-1019.580] (-1017.795) -- 0:00:43
294500 -- (-1018.704) (-1018.138) (-1022.355) [-1019.233] * [-1022.934] (-1018.552) (-1018.481) (-1018.091) -- 0:00:43
295000 -- (-1016.840) (-1017.074) [-1018.760] (-1018.126) * (-1019.023) (-1017.600) [-1020.880] (-1018.422) -- 0:00:43
Average standard deviation of split frequencies: 0.014413
295500 -- [-1017.455] (-1015.776) (-1018.426) (-1018.197) * (-1017.813) (-1019.977) [-1018.678] (-1018.398) -- 0:00:42
296000 -- (-1017.064) (-1016.508) [-1021.078] (-1017.337) * (-1017.565) (-1016.655) [-1017.215] (-1019.500) -- 0:00:42
296500 -- [-1017.179] (-1018.615) (-1019.398) (-1017.377) * (-1018.091) (-1018.051) [-1016.726] (-1019.825) -- 0:00:42
297000 -- (-1017.272) (-1018.172) (-1019.503) [-1015.959] * (-1019.576) (-1020.409) (-1016.026) [-1020.687] -- 0:00:42
297500 -- [-1017.066] (-1016.911) (-1016.190) (-1016.060) * (-1017.353) (-1022.104) (-1021.684) [-1019.416] -- 0:00:42
298000 -- (-1015.993) (-1023.236) (-1016.234) [-1016.648] * [-1016.233] (-1017.434) (-1023.202) (-1019.688) -- 0:00:42
298500 -- (-1015.589) (-1017.710) [-1017.084] (-1016.932) * (-1017.716) [-1020.147] (-1019.722) (-1017.839) -- 0:00:42
299000 -- [-1020.337] (-1017.879) (-1017.884) (-1017.218) * (-1018.818) (-1015.762) [-1016.899] (-1021.515) -- 0:00:42
299500 -- (-1020.005) (-1016.078) (-1016.874) [-1016.193] * (-1023.975) (-1021.414) [-1018.378] (-1019.318) -- 0:00:42
300000 -- (-1019.188) (-1019.814) (-1018.045) [-1019.211] * (-1020.781) [-1016.131] (-1018.279) (-1016.265) -- 0:00:42
Average standard deviation of split frequencies: 0.015069
300500 -- [-1019.891] (-1019.646) (-1017.438) (-1017.140) * (-1021.012) (-1017.951) (-1018.439) [-1016.198] -- 0:00:41
301000 -- (-1017.238) (-1018.104) [-1019.885] (-1018.702) * (-1022.535) [-1017.370] (-1015.571) (-1018.916) -- 0:00:41
301500 -- [-1016.734] (-1020.906) (-1020.126) (-1016.975) * [-1017.866] (-1018.276) (-1018.560) (-1017.098) -- 0:00:41
302000 -- (-1016.046) [-1019.070] (-1019.774) (-1018.411) * (-1017.583) [-1017.033] (-1016.919) (-1019.853) -- 0:00:41
302500 -- [-1016.376] (-1019.734) (-1021.196) (-1020.759) * (-1017.190) (-1021.916) (-1017.800) [-1022.183] -- 0:00:41
303000 -- (-1016.477) (-1019.033) (-1023.983) [-1019.228] * (-1019.885) (-1017.628) [-1016.671] (-1018.040) -- 0:00:41
303500 -- [-1018.796] (-1019.717) (-1022.949) (-1023.006) * [-1018.417] (-1015.683) (-1015.907) (-1017.643) -- 0:00:41
304000 -- (-1019.858) [-1016.942] (-1017.293) (-1020.665) * (-1016.630) (-1018.071) [-1017.121] (-1018.236) -- 0:00:41
304500 -- [-1016.983] (-1018.667) (-1017.286) (-1017.970) * [-1017.960] (-1017.829) (-1016.125) (-1016.459) -- 0:00:41
305000 -- (-1018.053) [-1022.156] (-1017.644) (-1022.341) * (-1017.325) (-1017.821) [-1016.836] (-1016.513) -- 0:00:41
Average standard deviation of split frequencies: 0.014464
305500 -- [-1017.427] (-1021.073) (-1017.795) (-1019.397) * (-1016.844) (-1016.444) (-1016.480) [-1016.416] -- 0:00:40
306000 -- (-1020.721) (-1015.858) (-1016.846) [-1019.466] * (-1016.557) (-1016.444) (-1017.281) [-1018.310] -- 0:00:40
306500 -- (-1020.241) [-1018.387] (-1016.571) (-1017.947) * [-1017.549] (-1016.664) (-1021.004) (-1017.336) -- 0:00:40
307000 -- (-1018.250) (-1017.327) [-1016.644] (-1021.418) * [-1017.884] (-1016.015) (-1019.347) (-1017.846) -- 0:00:40
307500 -- [-1018.858] (-1018.561) (-1016.854) (-1016.005) * [-1017.936] (-1019.448) (-1017.418) (-1018.206) -- 0:00:40
308000 -- [-1015.728] (-1022.456) (-1015.706) (-1022.385) * (-1016.146) [-1017.733] (-1020.202) (-1017.166) -- 0:00:40
308500 -- [-1015.890] (-1018.585) (-1017.035) (-1021.201) * (-1017.296) [-1017.853] (-1020.244) (-1017.048) -- 0:00:40
309000 -- (-1019.328) (-1019.398) [-1016.199] (-1016.246) * (-1017.856) (-1022.840) [-1018.213] (-1020.029) -- 0:00:40
309500 -- [-1017.276] (-1022.173) (-1023.258) (-1015.845) * (-1017.512) (-1018.501) (-1018.287) [-1016.695] -- 0:00:40
310000 -- [-1016.628] (-1020.494) (-1021.236) (-1017.536) * (-1017.943) [-1017.973] (-1021.833) (-1015.775) -- 0:00:40
Average standard deviation of split frequencies: 0.014078
310500 -- (-1017.642) (-1015.951) [-1017.022] (-1017.172) * [-1015.854] (-1018.623) (-1017.847) (-1016.063) -- 0:00:42
311000 -- (-1017.475) [-1015.943] (-1020.421) (-1019.657) * (-1018.611) [-1017.678] (-1021.293) (-1015.982) -- 0:00:42
311500 -- [-1017.287] (-1015.604) (-1015.912) (-1016.276) * (-1016.637) [-1019.469] (-1021.158) (-1016.551) -- 0:00:41
312000 -- (-1020.625) [-1018.261] (-1016.823) (-1017.058) * (-1018.626) (-1017.820) [-1015.978] (-1017.824) -- 0:00:41
312500 -- [-1018.414] (-1019.762) (-1016.776) (-1017.574) * (-1020.709) (-1016.968) (-1016.782) [-1015.779] -- 0:00:41
313000 -- (-1021.422) (-1018.863) [-1016.698] (-1019.983) * [-1020.464] (-1016.264) (-1017.577) (-1018.967) -- 0:00:41
313500 -- (-1018.809) (-1016.878) [-1017.727] (-1018.143) * (-1019.366) [-1016.125] (-1021.288) (-1019.353) -- 0:00:41
314000 -- (-1017.347) (-1016.893) (-1017.893) [-1017.726] * (-1021.833) [-1018.385] (-1021.199) (-1017.180) -- 0:00:41
314500 -- (-1016.322) [-1016.496] (-1018.614) (-1018.593) * (-1018.066) (-1016.001) (-1017.991) [-1016.294] -- 0:00:41
315000 -- (-1017.130) [-1017.388] (-1019.421) (-1022.392) * (-1017.971) (-1017.874) (-1016.653) [-1015.936] -- 0:00:41
Average standard deviation of split frequencies: 0.014918
315500 -- (-1017.486) (-1017.462) [-1015.723] (-1019.109) * (-1018.930) [-1018.275] (-1017.200) (-1015.923) -- 0:00:41
316000 -- (-1020.505) (-1017.164) [-1015.874] (-1016.774) * (-1016.706) (-1017.997) (-1016.993) [-1016.130] -- 0:00:41
316500 -- (-1018.326) (-1015.930) (-1015.656) [-1020.514] * (-1016.537) (-1015.928) (-1021.082) [-1017.792] -- 0:00:41
317000 -- (-1022.677) (-1015.679) [-1017.050] (-1017.539) * (-1016.498) (-1020.232) [-1018.357] (-1017.197) -- 0:00:40
317500 -- (-1018.057) (-1019.607) (-1017.193) [-1017.942] * (-1016.529) (-1021.181) [-1015.657] (-1016.650) -- 0:00:40
318000 -- (-1022.594) (-1019.064) [-1017.004] (-1022.637) * (-1016.607) [-1019.154] (-1015.844) (-1015.783) -- 0:00:40
318500 -- (-1018.000) (-1020.261) (-1018.151) [-1020.344] * (-1018.001) (-1016.696) [-1018.466] (-1016.662) -- 0:00:40
319000 -- [-1020.504] (-1016.828) (-1016.252) (-1017.146) * (-1018.125) (-1019.000) [-1018.603] (-1016.516) -- 0:00:40
319500 -- (-1018.691) (-1016.951) (-1018.314) [-1015.897] * (-1019.050) (-1020.237) (-1020.060) [-1017.231] -- 0:00:40
320000 -- (-1017.353) [-1016.535] (-1018.418) (-1016.220) * (-1017.814) [-1015.583] (-1019.878) (-1018.857) -- 0:00:40
Average standard deviation of split frequencies: 0.014211
320500 -- (-1017.903) [-1016.789] (-1018.238) (-1017.802) * [-1016.135] (-1015.983) (-1021.303) (-1019.041) -- 0:00:40
321000 -- (-1017.618) (-1024.129) (-1019.018) [-1020.498] * (-1019.387) (-1016.116) [-1023.483] (-1017.438) -- 0:00:40
321500 -- (-1017.718) (-1019.541) [-1018.028] (-1018.211) * (-1016.318) [-1018.985] (-1020.063) (-1017.508) -- 0:00:40
322000 -- (-1019.426) [-1022.800] (-1018.359) (-1019.214) * (-1016.878) (-1017.071) (-1017.093) [-1016.790] -- 0:00:40
322500 -- (-1019.310) [-1019.878] (-1019.866) (-1017.158) * (-1019.529) [-1016.692] (-1016.577) (-1016.406) -- 0:00:39
323000 -- [-1018.640] (-1017.390) (-1020.124) (-1018.570) * [-1019.469] (-1015.638) (-1016.529) (-1017.230) -- 0:00:39
323500 -- (-1016.909) (-1018.122) [-1018.825] (-1017.739) * (-1017.620) (-1015.623) (-1018.310) [-1017.725] -- 0:00:39
324000 -- [-1017.439] (-1017.556) (-1016.771) (-1017.542) * (-1017.647) (-1017.738) [-1016.495] (-1020.120) -- 0:00:39
324500 -- (-1016.008) (-1017.199) (-1015.901) [-1017.712] * [-1017.235] (-1016.354) (-1017.723) (-1018.335) -- 0:00:39
325000 -- (-1015.643) [-1017.566] (-1017.262) (-1019.085) * (-1019.582) [-1017.197] (-1018.017) (-1018.182) -- 0:00:39
Average standard deviation of split frequencies: 0.014460
325500 -- (-1015.636) [-1017.682] (-1015.824) (-1019.516) * [-1019.072] (-1017.883) (-1017.797) (-1016.190) -- 0:00:39
326000 -- [-1018.347] (-1018.188) (-1018.377) (-1018.523) * (-1016.739) (-1016.802) (-1018.673) [-1017.370] -- 0:00:39
326500 -- (-1016.191) [-1018.908] (-1019.312) (-1016.847) * (-1019.045) [-1016.261] (-1019.342) (-1021.331) -- 0:00:41
327000 -- (-1016.381) (-1020.842) [-1018.984] (-1019.610) * [-1015.980] (-1016.429) (-1022.093) (-1019.522) -- 0:00:41
327500 -- (-1018.393) (-1016.966) [-1019.087] (-1023.035) * (-1017.360) [-1017.122] (-1018.178) (-1016.797) -- 0:00:41
328000 -- (-1020.300) [-1016.325] (-1019.675) (-1016.649) * (-1015.666) (-1017.043) [-1015.421] (-1017.154) -- 0:00:40
328500 -- (-1016.724) [-1020.000] (-1017.127) (-1015.534) * [-1017.810] (-1018.980) (-1018.641) (-1019.512) -- 0:00:40
329000 -- (-1016.896) (-1018.636) [-1015.898] (-1016.564) * [-1017.831] (-1020.351) (-1018.876) (-1019.081) -- 0:00:40
329500 -- (-1016.558) (-1020.732) [-1015.935] (-1016.961) * [-1017.125] (-1017.933) (-1019.356) (-1015.917) -- 0:00:40
330000 -- (-1020.679) [-1020.378] (-1016.084) (-1018.560) * [-1016.370] (-1019.199) (-1019.479) (-1016.927) -- 0:00:40
Average standard deviation of split frequencies: 0.014019
330500 -- [-1016.613] (-1017.270) (-1016.499) (-1016.980) * [-1015.833] (-1019.081) (-1018.460) (-1017.592) -- 0:00:40
331000 -- [-1016.661] (-1017.263) (-1017.450) (-1017.580) * (-1016.490) (-1018.571) (-1019.566) [-1017.880] -- 0:00:40
331500 -- (-1017.001) (-1019.564) (-1023.689) [-1018.790] * (-1017.977) [-1016.383] (-1019.369) (-1016.301) -- 0:00:40
332000 -- (-1017.775) (-1021.495) (-1019.463) [-1017.704] * (-1018.978) (-1020.267) (-1020.656) [-1016.991] -- 0:00:40
332500 -- (-1017.772) (-1020.882) (-1018.230) [-1017.897] * [-1016.390] (-1019.888) (-1015.974) (-1015.668) -- 0:00:40
333000 -- (-1016.991) (-1020.377) (-1017.958) [-1016.563] * (-1021.233) (-1017.973) [-1016.409] (-1015.703) -- 0:00:40
333500 -- [-1016.702] (-1016.503) (-1017.662) (-1017.178) * (-1019.509) (-1019.228) [-1016.381] (-1017.478) -- 0:00:39
334000 -- (-1016.201) (-1016.772) (-1018.192) [-1018.002] * (-1017.304) [-1018.895] (-1015.772) (-1017.203) -- 0:00:39
334500 -- [-1020.923] (-1015.956) (-1024.154) (-1019.363) * (-1017.224) (-1016.877) [-1016.729] (-1020.503) -- 0:00:39
335000 -- (-1016.558) (-1017.405) [-1016.306] (-1018.744) * (-1018.297) (-1017.248) [-1015.627] (-1018.310) -- 0:00:39
Average standard deviation of split frequencies: 0.013587
335500 -- (-1016.527) [-1018.542] (-1019.491) (-1018.043) * (-1019.090) (-1017.088) (-1018.387) [-1022.288] -- 0:00:39
336000 -- [-1015.526] (-1017.047) (-1017.056) (-1021.313) * (-1018.826) (-1018.472) [-1019.041] (-1017.700) -- 0:00:39
336500 -- (-1016.862) (-1016.271) (-1016.479) [-1016.825] * (-1020.920) (-1018.142) (-1018.342) [-1016.857] -- 0:00:39
337000 -- (-1017.887) (-1018.887) (-1015.938) [-1016.077] * (-1017.371) (-1016.989) [-1022.283] (-1016.436) -- 0:00:39
337500 -- (-1016.778) (-1015.969) [-1015.711] (-1019.425) * [-1021.733] (-1017.615) (-1015.806) (-1017.626) -- 0:00:39
338000 -- [-1015.718] (-1018.708) (-1015.997) (-1019.425) * [-1022.442] (-1020.045) (-1016.329) (-1015.497) -- 0:00:39
338500 -- (-1015.739) (-1020.225) [-1016.263] (-1016.566) * [-1017.163] (-1018.502) (-1021.585) (-1015.406) -- 0:00:39
339000 -- (-1017.787) (-1018.166) [-1016.322] (-1017.243) * (-1017.421) [-1016.653] (-1022.391) (-1018.952) -- 0:00:38
339500 -- (-1016.693) (-1017.671) [-1017.120] (-1016.449) * (-1017.044) (-1016.605) (-1022.468) [-1015.832] -- 0:00:38
340000 -- (-1018.575) (-1018.614) [-1018.034] (-1015.750) * (-1018.098) [-1016.127] (-1017.042) (-1016.149) -- 0:00:38
Average standard deviation of split frequencies: 0.013069
340500 -- (-1019.982) (-1018.351) (-1019.569) [-1015.876] * (-1021.638) [-1016.345] (-1017.540) (-1018.302) -- 0:00:38
341000 -- (-1017.390) (-1018.443) (-1019.803) [-1015.748] * [-1017.034] (-1016.332) (-1016.896) (-1016.953) -- 0:00:38
341500 -- (-1020.483) [-1016.912] (-1019.155) (-1018.254) * [-1016.036] (-1018.317) (-1018.896) (-1022.522) -- 0:00:38
342000 -- [-1018.423] (-1015.973) (-1019.989) (-1018.862) * [-1015.822] (-1017.895) (-1017.239) (-1016.125) -- 0:00:38
342500 -- (-1017.526) (-1021.287) [-1018.814] (-1017.652) * [-1016.995] (-1017.688) (-1017.923) (-1015.979) -- 0:00:38
343000 -- (-1020.609) (-1017.626) [-1016.948] (-1017.010) * (-1018.837) (-1016.350) [-1017.622] (-1017.419) -- 0:00:40
343500 -- (-1017.041) [-1019.536] (-1015.767) (-1021.453) * (-1017.538) [-1016.380] (-1016.748) (-1021.247) -- 0:00:40
344000 -- (-1016.197) (-1021.055) [-1015.803] (-1019.060) * (-1018.538) (-1015.883) (-1016.730) [-1021.437] -- 0:00:40
344500 -- (-1017.388) (-1020.226) (-1017.051) [-1016.408] * [-1017.206] (-1017.448) (-1020.471) (-1021.709) -- 0:00:39
345000 -- (-1016.866) [-1018.521] (-1017.075) (-1016.361) * (-1019.152) [-1018.213] (-1017.669) (-1031.148) -- 0:00:39
Average standard deviation of split frequencies: 0.012836
345500 -- (-1017.967) (-1020.676) (-1017.133) [-1016.361] * (-1019.525) (-1016.364) (-1018.248) [-1016.453] -- 0:00:39
346000 -- (-1016.951) (-1017.022) [-1015.732] (-1017.544) * (-1017.045) (-1018.427) [-1017.009] (-1015.895) -- 0:00:39
346500 -- (-1016.711) [-1016.642] (-1018.298) (-1017.694) * (-1023.311) (-1019.612) (-1016.898) [-1017.689] -- 0:00:39
347000 -- (-1020.662) (-1016.938) (-1016.654) [-1017.090] * (-1016.325) [-1022.465] (-1015.597) (-1019.260) -- 0:00:39
347500 -- (-1017.439) (-1016.770) (-1022.422) [-1017.803] * (-1016.591) [-1018.558] (-1015.947) (-1018.865) -- 0:00:39
348000 -- (-1018.108) [-1017.630] (-1016.006) (-1017.145) * [-1017.932] (-1023.495) (-1019.615) (-1017.373) -- 0:00:39
348500 -- (-1016.247) (-1016.788) [-1017.115] (-1022.415) * (-1019.628) (-1022.296) (-1017.065) [-1016.995] -- 0:00:39
349000 -- [-1015.844] (-1019.108) (-1017.095) (-1017.233) * (-1019.395) (-1016.422) (-1016.302) [-1017.353] -- 0:00:39
349500 -- [-1017.592] (-1017.227) (-1017.991) (-1019.372) * (-1017.432) (-1018.575) [-1017.907] (-1016.964) -- 0:00:39
350000 -- (-1017.574) (-1018.427) (-1018.320) [-1019.210] * (-1017.518) (-1016.389) [-1019.987] (-1018.576) -- 0:00:39
Average standard deviation of split frequencies: 0.014080
350500 -- [-1018.164] (-1018.946) (-1018.054) (-1018.701) * [-1017.518] (-1016.170) (-1016.990) (-1020.477) -- 0:00:38
351000 -- (-1016.859) (-1018.452) [-1017.804] (-1018.052) * (-1020.925) [-1017.100] (-1018.278) (-1015.660) -- 0:00:38
351500 -- (-1018.451) (-1022.381) (-1017.445) [-1016.702] * (-1016.683) (-1017.599) [-1017.293] (-1016.168) -- 0:00:38
352000 -- (-1016.061) (-1020.744) [-1020.255] (-1017.105) * (-1018.236) (-1019.886) [-1018.118] (-1016.764) -- 0:00:38
352500 -- (-1015.983) (-1017.048) [-1019.070] (-1017.103) * [-1015.427] (-1016.527) (-1016.509) (-1019.058) -- 0:00:38
353000 -- (-1016.812) [-1015.890] (-1020.271) (-1018.598) * [-1018.847] (-1016.266) (-1022.451) (-1019.132) -- 0:00:38
353500 -- (-1020.415) [-1016.044] (-1017.006) (-1017.257) * (-1019.360) (-1017.111) (-1019.588) [-1018.199] -- 0:00:38
354000 -- (-1017.379) [-1016.117] (-1017.673) (-1016.360) * (-1018.212) (-1016.389) (-1016.526) [-1015.606] -- 0:00:38
354500 -- (-1019.536) [-1020.269] (-1022.491) (-1016.554) * (-1017.434) (-1015.446) (-1018.268) [-1018.490] -- 0:00:38
355000 -- (-1016.941) (-1017.094) (-1017.493) [-1015.458] * (-1016.551) [-1016.557] (-1018.074) (-1018.012) -- 0:00:38
Average standard deviation of split frequencies: 0.013939
355500 -- (-1018.788) (-1018.136) [-1016.776] (-1016.494) * (-1017.913) (-1016.661) (-1018.855) [-1015.296] -- 0:00:38
356000 -- (-1016.487) (-1019.344) [-1018.015] (-1016.257) * (-1017.092) [-1019.150] (-1017.349) (-1015.482) -- 0:00:37
356500 -- (-1016.603) [-1017.976] (-1015.810) (-1016.694) * (-1016.870) (-1015.758) (-1017.196) [-1015.609] -- 0:00:37
357000 -- (-1020.463) [-1016.269] (-1016.801) (-1017.379) * [-1017.513] (-1020.265) (-1018.194) (-1016.673) -- 0:00:37
357500 -- (-1016.770) (-1018.480) [-1016.196] (-1016.696) * [-1016.554] (-1017.742) (-1016.530) (-1016.701) -- 0:00:37
358000 -- (-1017.446) (-1017.101) [-1016.018] (-1020.615) * (-1023.403) (-1015.504) [-1020.174] (-1023.464) -- 0:00:37
358500 -- (-1016.106) [-1016.114] (-1016.765) (-1022.168) * (-1019.838) (-1015.512) (-1018.622) [-1019.384] -- 0:00:37
359000 -- [-1017.130] (-1016.393) (-1021.722) (-1019.336) * (-1017.063) (-1017.430) [-1015.461] (-1017.878) -- 0:00:37
359500 -- (-1017.218) (-1016.721) (-1020.432) [-1018.872] * (-1017.558) [-1017.549] (-1018.984) (-1017.059) -- 0:00:39
360000 -- (-1017.424) (-1016.962) [-1022.204] (-1020.600) * (-1016.380) (-1017.417) [-1015.960] (-1015.779) -- 0:00:39
Average standard deviation of split frequencies: 0.012998
360500 -- [-1017.102] (-1017.072) (-1022.810) (-1017.979) * [-1019.761] (-1018.358) (-1017.564) (-1017.238) -- 0:00:39
361000 -- (-1017.350) [-1017.159] (-1021.830) (-1019.459) * (-1020.086) (-1018.834) [-1017.425] (-1016.836) -- 0:00:38
361500 -- [-1016.852] (-1016.240) (-1021.840) (-1015.932) * (-1017.182) [-1018.145] (-1019.234) (-1018.761) -- 0:00:38
362000 -- (-1015.799) [-1016.667] (-1017.966) (-1017.196) * (-1019.169) (-1018.456) [-1018.843] (-1022.053) -- 0:00:38
362500 -- [-1015.885] (-1015.614) (-1018.825) (-1016.755) * (-1017.379) (-1016.503) [-1017.847] (-1017.864) -- 0:00:38
363000 -- (-1017.385) [-1016.540] (-1017.203) (-1015.633) * (-1016.667) (-1018.669) (-1018.493) [-1015.731] -- 0:00:38
363500 -- (-1020.831) (-1016.535) (-1017.845) [-1020.161] * (-1016.289) [-1016.587] (-1018.481) (-1016.016) -- 0:00:38
364000 -- (-1020.744) (-1019.308) (-1019.131) [-1019.019] * [-1015.638] (-1017.170) (-1025.971) (-1017.880) -- 0:00:38
364500 -- [-1020.166] (-1018.458) (-1023.235) (-1015.770) * (-1016.003) (-1029.032) [-1016.255] (-1016.750) -- 0:00:38
365000 -- (-1018.554) [-1016.712] (-1016.510) (-1015.982) * (-1016.563) (-1019.546) [-1016.524] (-1016.398) -- 0:00:38
Average standard deviation of split frequencies: 0.013015
365500 -- (-1019.868) (-1016.676) [-1018.219] (-1016.822) * (-1018.485) [-1017.634] (-1016.502) (-1017.030) -- 0:00:38
366000 -- (-1022.708) [-1015.864] (-1022.237) (-1016.738) * [-1015.521] (-1019.452) (-1017.997) (-1016.248) -- 0:00:38
366500 -- (-1016.342) (-1015.925) [-1017.896] (-1016.645) * [-1017.041] (-1019.747) (-1019.503) (-1015.881) -- 0:00:38
367000 -- (-1017.506) (-1017.812) [-1015.952] (-1016.655) * [-1017.984] (-1016.170) (-1020.637) (-1016.363) -- 0:00:37
367500 -- (-1016.556) [-1016.450] (-1016.337) (-1018.147) * (-1018.787) (-1018.697) (-1018.776) [-1016.116] -- 0:00:37
368000 -- (-1016.840) [-1016.450] (-1015.721) (-1016.648) * [-1015.950] (-1021.481) (-1017.525) (-1018.288) -- 0:00:37
368500 -- (-1027.689) (-1017.046) [-1019.065] (-1016.571) * (-1016.937) (-1019.719) (-1021.661) [-1017.786] -- 0:00:37
369000 -- [-1021.227] (-1018.382) (-1025.719) (-1016.968) * (-1016.964) [-1018.206] (-1021.922) (-1017.485) -- 0:00:37
369500 -- (-1018.561) [-1021.107] (-1020.055) (-1019.680) * (-1017.415) (-1018.052) (-1022.503) [-1017.977] -- 0:00:37
370000 -- [-1019.445] (-1019.887) (-1017.200) (-1018.727) * (-1017.481) (-1019.836) (-1018.674) [-1018.521] -- 0:00:37
Average standard deviation of split frequencies: 0.012269
370500 -- [-1018.500] (-1017.857) (-1018.985) (-1016.406) * (-1017.124) (-1019.048) [-1018.682] (-1020.383) -- 0:00:37
371000 -- [-1016.666] (-1017.967) (-1020.682) (-1019.235) * (-1017.549) [-1016.209] (-1020.454) (-1020.418) -- 0:00:37
371500 -- (-1016.615) (-1017.339) (-1020.224) [-1017.584] * (-1017.326) (-1019.073) (-1020.779) [-1020.708] -- 0:00:37
372000 -- [-1016.544] (-1016.793) (-1022.105) (-1026.100) * [-1024.573] (-1017.335) (-1020.243) (-1016.745) -- 0:00:37
372500 -- [-1016.753] (-1017.031) (-1016.483) (-1018.565) * (-1019.353) [-1016.333] (-1021.629) (-1016.229) -- 0:00:37
373000 -- (-1018.866) (-1017.474) (-1016.183) [-1017.315] * [-1018.556] (-1016.162) (-1018.582) (-1020.373) -- 0:00:36
373500 -- (-1018.149) [-1017.292] (-1016.836) (-1018.972) * (-1016.234) (-1017.912) (-1016.645) [-1020.282] -- 0:00:36
374000 -- (-1016.293) (-1018.040) [-1016.949] (-1015.718) * (-1016.304) (-1016.704) [-1017.041] (-1018.339) -- 0:00:36
374500 -- (-1016.444) (-1016.475) [-1018.037] (-1019.281) * (-1016.851) [-1016.340] (-1019.046) (-1017.305) -- 0:00:36
375000 -- (-1016.238) (-1020.806) (-1018.607) [-1019.502] * [-1016.558] (-1019.335) (-1019.790) (-1019.322) -- 0:00:36
Average standard deviation of split frequencies: 0.012390
375500 -- (-1015.959) (-1018.514) (-1018.884) [-1017.021] * (-1018.267) [-1016.755] (-1018.075) (-1018.613) -- 0:00:36
376000 -- (-1016.629) [-1018.381] (-1019.083) (-1015.694) * (-1021.305) (-1016.934) (-1020.697) [-1018.701] -- 0:00:38
376500 -- [-1018.693] (-1017.005) (-1016.586) (-1016.325) * (-1019.175) (-1016.900) [-1015.688] (-1022.681) -- 0:00:38
377000 -- [-1018.723] (-1017.005) (-1017.258) (-1017.970) * (-1019.510) (-1019.179) (-1015.998) [-1021.913] -- 0:00:38
377500 -- (-1018.219) (-1017.799) [-1017.421] (-1017.775) * (-1017.852) [-1020.411] (-1017.474) (-1015.917) -- 0:00:37
378000 -- [-1018.990] (-1021.913) (-1019.193) (-1016.876) * (-1018.267) (-1020.093) [-1017.821] (-1017.426) -- 0:00:37
378500 -- (-1018.846) (-1021.269) (-1018.095) [-1019.961] * (-1018.577) (-1018.324) [-1016.253] (-1018.969) -- 0:00:37
379000 -- (-1020.572) (-1017.293) (-1017.288) [-1018.557] * (-1017.836) (-1019.091) [-1017.887] (-1017.229) -- 0:00:37
379500 -- [-1017.358] (-1019.658) (-1018.403) (-1019.419) * [-1016.851] (-1019.033) (-1016.766) (-1016.860) -- 0:00:37
380000 -- [-1018.075] (-1016.536) (-1018.317) (-1021.263) * (-1020.291) (-1016.618) [-1018.044] (-1017.538) -- 0:00:37
Average standard deviation of split frequencies: 0.012457
380500 -- (-1017.860) [-1017.445] (-1018.236) (-1020.266) * (-1017.148) [-1015.852] (-1017.345) (-1018.626) -- 0:00:37
381000 -- (-1017.550) (-1021.551) [-1016.354] (-1020.885) * (-1016.353) (-1017.928) (-1019.248) [-1018.002] -- 0:00:37
381500 -- (-1018.063) (-1019.465) (-1016.252) [-1018.451] * [-1015.985] (-1017.432) (-1019.637) (-1018.459) -- 0:00:37
382000 -- (-1016.019) (-1016.223) (-1019.696) [-1020.454] * (-1018.477) (-1015.881) (-1017.323) [-1018.808] -- 0:00:37
382500 -- [-1018.206] (-1016.280) (-1018.032) (-1022.184) * [-1017.190] (-1016.850) (-1015.982) (-1017.556) -- 0:00:37
383000 -- (-1019.304) (-1016.764) (-1020.548) [-1018.460] * (-1017.544) [-1017.224] (-1022.157) (-1020.441) -- 0:00:37
383500 -- (-1016.642) [-1017.335] (-1016.346) (-1017.031) * (-1019.199) [-1016.705] (-1021.084) (-1019.383) -- 0:00:36
384000 -- (-1019.109) (-1017.652) (-1017.773) [-1017.807] * (-1015.859) [-1020.954] (-1020.484) (-1021.451) -- 0:00:36
384500 -- (-1022.131) [-1017.271] (-1021.915) (-1019.303) * [-1016.654] (-1021.419) (-1017.639) (-1020.286) -- 0:00:36
385000 -- (-1017.982) (-1017.547) [-1016.331] (-1018.720) * (-1016.661) (-1022.725) (-1016.475) [-1019.975] -- 0:00:36
Average standard deviation of split frequencies: 0.011997
385500 -- (-1018.066) (-1018.005) [-1016.133] (-1022.743) * (-1018.400) (-1019.787) (-1018.807) [-1020.525] -- 0:00:36
386000 -- (-1016.412) (-1016.416) [-1017.767] (-1020.448) * (-1016.392) (-1016.698) [-1018.897] (-1027.256) -- 0:00:36
386500 -- [-1017.417] (-1016.933) (-1017.548) (-1020.465) * [-1018.360] (-1018.332) (-1017.723) (-1018.935) -- 0:00:36
387000 -- [-1019.930] (-1017.844) (-1018.211) (-1016.752) * (-1018.581) [-1016.944] (-1016.351) (-1015.889) -- 0:00:36
387500 -- (-1019.661) [-1017.770] (-1021.130) (-1016.685) * (-1019.020) [-1017.269] (-1016.688) (-1016.974) -- 0:00:36
388000 -- [-1021.516] (-1024.569) (-1021.231) (-1016.600) * [-1023.622] (-1016.997) (-1017.267) (-1017.937) -- 0:00:36
388500 -- [-1020.558] (-1018.512) (-1018.440) (-1017.337) * [-1018.286] (-1016.893) (-1017.637) (-1018.794) -- 0:00:36
389000 -- (-1025.468) (-1022.916) (-1017.087) [-1017.335] * (-1018.909) [-1016.505] (-1019.298) (-1016.973) -- 0:00:36
389500 -- (-1018.572) [-1021.360] (-1016.737) (-1018.580) * (-1017.745) (-1017.776) (-1016.909) [-1018.534] -- 0:00:36
390000 -- (-1017.048) [-1018.416] (-1020.230) (-1018.620) * (-1022.194) (-1018.647) [-1016.242] (-1016.256) -- 0:00:35
Average standard deviation of split frequencies: 0.011925
390500 -- (-1020.000) (-1019.158) (-1018.207) [-1016.097] * [-1019.337] (-1017.194) (-1016.585) (-1016.425) -- 0:00:35
391000 -- [-1020.369] (-1019.335) (-1016.883) (-1018.793) * (-1015.478) (-1016.218) (-1020.486) [-1017.324] -- 0:00:35
391500 -- (-1016.688) (-1017.039) (-1020.373) [-1016.050] * (-1017.567) (-1016.456) [-1017.722] (-1019.023) -- 0:00:35
392000 -- (-1018.578) [-1018.769] (-1019.419) (-1017.749) * (-1017.209) (-1016.139) [-1017.211] (-1020.346) -- 0:00:37
392500 -- (-1018.196) (-1018.375) [-1019.543] (-1019.067) * (-1018.359) (-1017.020) [-1017.164] (-1017.533) -- 0:00:37
393000 -- (-1017.561) [-1015.995] (-1020.165) (-1016.979) * (-1020.252) (-1017.175) (-1017.693) [-1018.128] -- 0:00:37
393500 -- [-1021.402] (-1016.635) (-1016.367) (-1016.425) * (-1019.578) (-1018.242) (-1017.514) [-1017.077] -- 0:00:36
394000 -- (-1019.477) (-1016.814) (-1016.975) [-1016.520] * (-1022.929) (-1018.162) (-1021.346) [-1016.611] -- 0:00:36
394500 -- (-1019.685) [-1021.184] (-1018.902) (-1016.845) * (-1017.349) (-1020.253) (-1020.683) [-1017.421] -- 0:00:36
395000 -- (-1020.450) (-1018.483) [-1018.615] (-1019.375) * (-1017.998) (-1020.695) (-1024.450) [-1018.653] -- 0:00:36
Average standard deviation of split frequencies: 0.012648
395500 -- (-1017.175) [-1017.578] (-1018.046) (-1017.156) * (-1016.076) (-1018.706) [-1019.168] (-1018.908) -- 0:00:36
396000 -- [-1017.546] (-1017.253) (-1018.251) (-1015.855) * (-1016.516) [-1015.778] (-1016.163) (-1019.215) -- 0:00:36
396500 -- (-1016.725) (-1017.202) [-1015.721] (-1015.828) * (-1020.067) [-1018.381] (-1020.563) (-1022.400) -- 0:00:36
397000 -- [-1016.782] (-1017.575) (-1017.260) (-1016.523) * [-1016.383] (-1020.666) (-1017.431) (-1019.071) -- 0:00:36
397500 -- (-1016.427) (-1021.587) (-1017.251) [-1017.768] * (-1020.828) (-1016.762) [-1015.712] (-1019.536) -- 0:00:36
398000 -- (-1016.015) (-1024.705) (-1015.793) [-1016.013] * (-1019.501) (-1018.480) (-1019.356) [-1015.397] -- 0:00:36
398500 -- (-1018.009) (-1018.238) [-1017.446] (-1022.397) * (-1023.271) (-1016.972) (-1018.134) [-1020.650] -- 0:00:36
399000 -- (-1016.476) [-1017.358] (-1017.804) (-1021.962) * (-1018.560) (-1017.040) (-1018.387) [-1016.379] -- 0:00:36
399500 -- [-1019.676] (-1016.175) (-1019.149) (-1021.844) * (-1022.758) (-1018.012) [-1019.156] (-1018.483) -- 0:00:36
400000 -- (-1019.951) (-1017.409) (-1019.187) [-1018.134] * (-1016.480) [-1017.266] (-1020.121) (-1020.705) -- 0:00:36
Average standard deviation of split frequencies: 0.012427
400500 -- (-1020.774) [-1016.621] (-1018.225) (-1018.622) * (-1018.748) (-1016.071) (-1017.195) [-1017.652] -- 0:00:35
401000 -- (-1017.668) [-1023.260] (-1016.560) (-1016.888) * (-1020.778) [-1016.090] (-1016.767) (-1016.675) -- 0:00:35
401500 -- (-1015.795) [-1020.529] (-1016.442) (-1017.290) * [-1017.217] (-1015.993) (-1018.908) (-1018.595) -- 0:00:35
402000 -- (-1017.374) [-1017.908] (-1017.755) (-1019.100) * (-1020.903) (-1016.152) (-1016.151) [-1016.432] -- 0:00:35
402500 -- (-1015.481) [-1017.911] (-1019.190) (-1016.285) * (-1016.473) (-1016.840) [-1018.754] (-1018.478) -- 0:00:35
403000 -- (-1019.978) (-1019.205) (-1017.853) [-1016.615] * (-1017.589) (-1015.908) (-1017.128) [-1018.678] -- 0:00:35
403500 -- (-1016.978) (-1017.353) (-1017.288) [-1017.782] * [-1017.496] (-1016.708) (-1017.647) (-1017.707) -- 0:00:35
404000 -- (-1017.653) (-1017.723) [-1020.923] (-1021.537) * [-1020.179] (-1018.083) (-1019.307) (-1018.419) -- 0:00:35
404500 -- (-1017.582) [-1016.648] (-1021.149) (-1021.485) * (-1019.711) (-1019.188) [-1018.082] (-1019.432) -- 0:00:35
405000 -- (-1019.195) (-1016.141) [-1015.480] (-1017.463) * (-1019.387) (-1018.215) [-1017.801] (-1016.318) -- 0:00:35
Average standard deviation of split frequencies: 0.012772
405500 -- (-1017.372) (-1018.261) (-1019.741) [-1018.611] * (-1016.874) (-1018.419) [-1017.984] (-1016.254) -- 0:00:35
406000 -- (-1018.233) (-1016.922) [-1017.080] (-1016.563) * (-1017.722) (-1018.804) [-1017.204] (-1016.285) -- 0:00:35
406500 -- (-1020.165) [-1018.265] (-1017.368) (-1015.765) * (-1016.236) [-1016.928] (-1015.999) (-1021.140) -- 0:00:35
407000 -- [-1016.543] (-1019.908) (-1018.498) (-1015.737) * (-1016.092) [-1017.149] (-1017.164) (-1017.214) -- 0:00:34
407500 -- (-1017.861) [-1016.969] (-1018.535) (-1023.147) * (-1016.107) (-1015.658) [-1018.157] (-1015.913) -- 0:00:34
408000 -- (-1016.974) [-1016.531] (-1019.879) (-1020.854) * (-1016.328) (-1015.815) [-1019.520] (-1017.979) -- 0:00:34
408500 -- (-1016.447) [-1018.376] (-1016.347) (-1023.939) * (-1019.727) [-1017.725] (-1017.125) (-1018.768) -- 0:00:36
409000 -- (-1017.521) (-1015.849) (-1015.973) [-1019.894] * (-1018.032) (-1017.487) (-1016.631) [-1019.157] -- 0:00:36
409500 -- [-1017.096] (-1017.424) (-1017.384) (-1020.835) * (-1020.127) [-1018.360] (-1016.916) (-1018.615) -- 0:00:36
410000 -- (-1018.386) [-1016.140] (-1016.866) (-1020.608) * (-1016.419) [-1016.031] (-1015.530) (-1018.275) -- 0:00:35
Average standard deviation of split frequencies: 0.012986
410500 -- [-1017.320] (-1015.989) (-1015.751) (-1019.657) * (-1015.739) (-1019.754) (-1016.411) [-1016.984] -- 0:00:35
411000 -- (-1016.854) (-1015.995) [-1018.163] (-1018.716) * (-1018.127) (-1021.497) [-1016.632] (-1019.958) -- 0:00:35
411500 -- (-1016.811) [-1016.639] (-1017.376) (-1016.406) * (-1017.828) [-1017.214] (-1015.574) (-1017.822) -- 0:00:35
412000 -- [-1015.837] (-1017.834) (-1024.127) (-1016.081) * (-1016.158) (-1019.344) (-1015.677) [-1018.282] -- 0:00:35
412500 -- (-1019.355) (-1017.268) (-1019.179) [-1020.546] * (-1016.257) (-1018.090) [-1017.653] (-1019.060) -- 0:00:35
413000 -- (-1018.008) (-1016.307) (-1016.066) [-1018.361] * (-1017.543) (-1018.108) (-1015.819) [-1018.658] -- 0:00:35
413500 -- [-1017.095] (-1017.839) (-1017.615) (-1018.849) * (-1018.205) (-1019.545) [-1016.709] (-1016.239) -- 0:00:35
414000 -- (-1017.091) [-1015.718] (-1018.886) (-1017.579) * (-1017.873) (-1018.516) (-1020.931) [-1015.766] -- 0:00:35
414500 -- (-1017.500) (-1015.961) [-1016.346] (-1017.834) * [-1016.249] (-1017.920) (-1018.105) (-1017.488) -- 0:00:35
415000 -- (-1018.913) (-1017.206) [-1017.348] (-1016.471) * (-1019.638) [-1016.379] (-1025.641) (-1016.088) -- 0:00:35
Average standard deviation of split frequencies: 0.012253
415500 -- (-1016.569) (-1017.534) [-1019.723] (-1022.930) * (-1018.097) [-1020.289] (-1017.498) (-1019.924) -- 0:00:35
416000 -- (-1017.417) (-1016.557) (-1020.645) [-1015.822] * (-1015.718) [-1021.745] (-1017.116) (-1019.271) -- 0:00:35
416500 -- (-1016.986) [-1015.813] (-1018.169) (-1019.030) * (-1017.058) (-1016.793) [-1015.847] (-1017.373) -- 0:00:35
417000 -- (-1017.016) (-1018.968) [-1017.561] (-1018.832) * (-1019.528) (-1016.153) [-1017.140] (-1020.223) -- 0:00:34
417500 -- (-1016.064) (-1017.843) [-1018.129] (-1017.175) * (-1016.653) [-1020.091] (-1020.602) (-1017.477) -- 0:00:34
418000 -- (-1021.002) [-1018.541] (-1017.733) (-1016.286) * (-1017.121) (-1021.953) [-1020.277] (-1016.699) -- 0:00:34
418500 -- (-1019.548) [-1017.663] (-1017.554) (-1018.397) * (-1018.617) (-1018.412) (-1017.489) [-1018.137] -- 0:00:34
419000 -- (-1019.443) (-1020.828) (-1018.268) [-1017.424] * (-1020.146) (-1018.265) [-1018.302] (-1018.142) -- 0:00:34
419500 -- (-1020.862) (-1023.220) [-1018.774] (-1018.277) * [-1017.950] (-1018.121) (-1016.795) (-1019.078) -- 0:00:34
420000 -- (-1019.020) (-1016.626) [-1015.604] (-1018.232) * (-1019.715) (-1022.967) (-1015.382) [-1018.174] -- 0:00:34
Average standard deviation of split frequencies: 0.011766
420500 -- (-1020.018) (-1018.683) [-1016.022] (-1017.229) * [-1016.906] (-1025.147) (-1016.212) (-1017.045) -- 0:00:34
421000 -- (-1018.497) (-1017.101) (-1015.612) [-1018.895] * (-1019.579) [-1017.579] (-1016.926) (-1017.765) -- 0:00:34
421500 -- (-1016.627) (-1017.092) [-1017.524] (-1018.701) * (-1019.458) (-1019.874) (-1016.097) [-1017.620] -- 0:00:34
422000 -- [-1017.920] (-1017.232) (-1017.266) (-1017.143) * (-1017.830) (-1017.942) [-1016.397] (-1020.381) -- 0:00:34
422500 -- (-1019.796) (-1017.080) [-1019.524] (-1018.216) * (-1021.572) (-1019.967) (-1019.284) [-1018.037] -- 0:00:34
423000 -- (-1017.890) (-1018.505) [-1018.878] (-1017.223) * [-1019.537] (-1018.356) (-1020.856) (-1017.410) -- 0:00:34
423500 -- (-1016.392) (-1018.875) [-1019.729] (-1019.036) * (-1018.455) (-1016.531) [-1018.384] (-1018.992) -- 0:00:34
424000 -- [-1015.764] (-1017.532) (-1022.326) (-1017.556) * [-1018.629] (-1015.546) (-1018.449) (-1019.905) -- 0:00:33
424500 -- (-1019.740) (-1018.077) (-1023.808) [-1017.696] * (-1021.294) (-1015.592) (-1021.474) [-1020.255] -- 0:00:33
425000 -- [-1016.850] (-1016.970) (-1020.166) (-1018.824) * (-1020.049) (-1017.360) (-1016.464) [-1018.098] -- 0:00:33
Average standard deviation of split frequencies: 0.011135
425500 -- (-1022.668) (-1016.159) [-1020.242] (-1019.141) * (-1019.996) (-1016.971) (-1016.239) [-1020.215] -- 0:00:35
426000 -- (-1022.193) [-1016.520] (-1018.895) (-1017.838) * [-1018.142] (-1017.161) (-1017.173) (-1018.397) -- 0:00:35
426500 -- (-1017.240) (-1016.396) [-1018.717] (-1018.894) * [-1019.077] (-1018.535) (-1017.274) (-1017.025) -- 0:00:34
427000 -- (-1019.125) [-1017.211] (-1021.520) (-1021.016) * [-1019.459] (-1018.332) (-1021.524) (-1017.619) -- 0:00:34
427500 -- [-1015.850] (-1016.908) (-1017.220) (-1018.840) * (-1020.157) (-1018.093) (-1019.821) [-1018.553] -- 0:00:34
428000 -- (-1020.293) (-1016.670) [-1017.999] (-1017.732) * (-1018.812) (-1017.419) [-1020.880] (-1019.696) -- 0:00:34
428500 -- (-1016.218) (-1017.521) (-1015.712) [-1016.102] * (-1019.443) [-1020.942] (-1019.068) (-1016.449) -- 0:00:34
429000 -- [-1017.711] (-1016.474) (-1016.550) (-1015.986) * [-1018.539] (-1018.887) (-1016.351) (-1021.290) -- 0:00:34
429500 -- (-1019.541) (-1019.265) [-1015.566] (-1024.169) * (-1016.279) (-1020.131) [-1016.037] (-1017.589) -- 0:00:34
430000 -- (-1021.323) (-1021.223) [-1017.963] (-1017.880) * (-1020.052) (-1017.299) [-1016.263] (-1017.673) -- 0:00:34
Average standard deviation of split frequencies: 0.011332
430500 -- (-1020.127) [-1017.370] (-1018.003) (-1017.388) * (-1024.521) (-1019.406) (-1016.244) [-1018.597] -- 0:00:34
431000 -- (-1019.788) (-1018.070) [-1016.577] (-1019.328) * (-1018.866) (-1018.826) [-1017.717] (-1016.949) -- 0:00:34
431500 -- (-1015.641) (-1017.624) (-1016.816) [-1018.203] * (-1019.688) (-1023.849) (-1017.400) [-1015.664] -- 0:00:34
432000 -- (-1017.298) (-1020.469) [-1017.092] (-1017.781) * (-1019.069) (-1017.389) (-1016.416) [-1016.075] -- 0:00:34
432500 -- (-1017.999) (-1024.117) [-1016.846] (-1015.943) * [-1019.230] (-1015.666) (-1016.289) (-1017.955) -- 0:00:34
433000 -- [-1018.435] (-1022.726) (-1017.975) (-1018.091) * (-1017.614) (-1021.016) (-1016.507) [-1018.260] -- 0:00:34
433500 -- [-1020.217] (-1020.697) (-1018.879) (-1018.441) * (-1030.060) (-1018.775) (-1017.067) [-1015.559] -- 0:00:33
434000 -- (-1019.814) (-1022.901) [-1018.454] (-1015.715) * (-1019.447) (-1016.883) (-1018.806) [-1017.745] -- 0:00:33
434500 -- (-1018.966) (-1017.594) (-1016.820) [-1016.518] * [-1021.124] (-1018.141) (-1017.099) (-1017.773) -- 0:00:33
435000 -- (-1021.468) (-1019.389) (-1017.866) [-1016.752] * (-1018.626) [-1019.609] (-1018.388) (-1017.878) -- 0:00:33
Average standard deviation of split frequencies: 0.011488
435500 -- (-1016.399) (-1018.209) (-1017.481) [-1016.949] * (-1017.349) [-1015.748] (-1018.595) (-1016.513) -- 0:00:33
436000 -- (-1016.143) (-1017.338) (-1015.776) [-1016.925] * (-1018.297) (-1018.545) (-1018.654) [-1016.926] -- 0:00:33
436500 -- [-1016.718] (-1016.635) (-1016.337) (-1016.561) * (-1019.805) (-1018.516) (-1018.302) [-1017.188] -- 0:00:33
437000 -- [-1016.430] (-1015.722) (-1017.036) (-1016.512) * (-1019.448) (-1016.569) [-1021.899] (-1017.323) -- 0:00:33
437500 -- (-1017.090) (-1016.143) [-1016.706] (-1016.336) * (-1021.410) [-1018.036] (-1020.611) (-1019.029) -- 0:00:33
438000 -- [-1017.036] (-1016.648) (-1017.015) (-1016.634) * (-1019.665) (-1020.142) (-1017.430) [-1016.368] -- 0:00:33
438500 -- (-1018.279) (-1017.074) [-1016.252] (-1018.250) * (-1016.430) (-1021.166) (-1019.251) [-1020.787] -- 0:00:33
439000 -- [-1018.120] (-1018.439) (-1016.885) (-1016.822) * [-1017.201] (-1018.705) (-1019.349) (-1021.712) -- 0:00:33
439500 -- [-1015.946] (-1016.692) (-1016.700) (-1016.665) * [-1021.817] (-1018.905) (-1022.960) (-1016.685) -- 0:00:33
440000 -- (-1017.033) [-1015.955] (-1020.198) (-1016.139) * (-1018.474) (-1018.556) [-1021.959] (-1017.851) -- 0:00:33
Average standard deviation of split frequencies: 0.010898
440500 -- (-1016.606) (-1017.321) (-1017.435) [-1017.447] * (-1019.377) (-1017.960) (-1019.089) [-1015.895] -- 0:00:33
441000 -- (-1017.144) [-1016.056] (-1020.003) (-1017.417) * [-1017.997] (-1018.628) (-1017.174) (-1018.404) -- 0:00:32
441500 -- (-1019.051) (-1015.811) [-1016.750] (-1021.615) * (-1015.293) (-1018.369) [-1021.170] (-1018.537) -- 0:00:32
442000 -- (-1017.955) (-1016.407) (-1016.945) [-1018.093] * (-1017.537) (-1020.487) (-1018.007) [-1016.108] -- 0:00:34
442500 -- (-1018.400) (-1018.715) [-1018.075] (-1018.125) * (-1021.138) (-1021.606) [-1017.067] (-1016.725) -- 0:00:34
443000 -- (-1019.403) (-1019.297) (-1015.943) [-1016.399] * [-1022.894] (-1020.714) (-1017.104) (-1017.905) -- 0:00:33
443500 -- (-1019.878) (-1017.504) (-1018.970) [-1018.158] * (-1019.135) (-1017.701) [-1017.938] (-1018.872) -- 0:00:33
444000 -- (-1019.355) (-1016.190) (-1025.429) [-1017.665] * [-1019.510] (-1019.153) (-1018.058) (-1022.451) -- 0:00:33
444500 -- (-1016.793) (-1017.819) (-1016.751) [-1016.179] * (-1017.457) (-1016.935) [-1020.420] (-1017.851) -- 0:00:33
445000 -- (-1019.490) (-1019.116) (-1017.232) [-1017.833] * (-1018.108) (-1015.927) (-1016.795) [-1015.749] -- 0:00:33
Average standard deviation of split frequencies: 0.010834
445500 -- (-1021.970) (-1017.731) [-1017.407] (-1017.645) * [-1019.986] (-1020.797) (-1017.661) (-1015.861) -- 0:00:33
446000 -- (-1021.315) (-1016.376) (-1017.568) [-1017.742] * (-1016.316) (-1017.201) (-1016.377) [-1016.910] -- 0:00:33
446500 -- (-1019.417) (-1017.083) (-1016.037) [-1021.169] * [-1016.647] (-1016.399) (-1016.468) (-1019.371) -- 0:00:33
447000 -- (-1017.123) (-1016.531) [-1015.735] (-1019.429) * (-1018.080) (-1015.782) (-1019.982) [-1016.072] -- 0:00:33
447500 -- (-1018.830) (-1021.453) [-1016.630] (-1019.324) * (-1019.607) (-1018.148) (-1017.426) [-1016.483] -- 0:00:33
448000 -- (-1018.725) (-1017.521) [-1015.883] (-1017.238) * (-1019.245) (-1018.793) [-1017.323] (-1016.239) -- 0:00:33
448500 -- (-1017.640) (-1016.600) (-1019.614) [-1016.943] * (-1020.477) (-1017.900) (-1020.358) [-1016.971] -- 0:00:33
449000 -- (-1016.740) (-1016.829) [-1015.918] (-1016.902) * (-1021.524) (-1016.426) [-1015.677] (-1020.535) -- 0:00:33
449500 -- (-1016.137) (-1016.972) [-1017.356] (-1019.236) * (-1018.475) (-1018.528) [-1016.801] (-1019.407) -- 0:00:33
450000 -- (-1019.569) [-1017.203] (-1016.452) (-1016.570) * (-1018.393) [-1019.456] (-1017.691) (-1019.315) -- 0:00:33
Average standard deviation of split frequencies: 0.010852
450500 -- (-1019.108) (-1019.815) [-1018.638] (-1016.589) * (-1017.255) (-1017.694) (-1019.396) [-1021.277] -- 0:00:32
451000 -- [-1017.624] (-1016.698) (-1015.946) (-1018.755) * (-1017.357) (-1018.777) (-1016.234) [-1018.848] -- 0:00:32
451500 -- (-1021.651) (-1017.318) [-1015.891] (-1016.164) * [-1018.427] (-1018.490) (-1016.372) (-1020.112) -- 0:00:32
452000 -- (-1020.246) (-1016.397) [-1016.287] (-1016.032) * (-1016.496) (-1017.532) [-1015.727] (-1018.634) -- 0:00:32
452500 -- [-1020.218] (-1021.889) (-1016.757) (-1015.933) * (-1016.360) (-1020.823) (-1015.997) [-1016.786] -- 0:00:32
453000 -- (-1021.394) (-1016.985) (-1023.215) [-1017.791] * (-1018.302) (-1019.697) (-1016.658) [-1017.053] -- 0:00:32
453500 -- (-1019.704) [-1016.844] (-1017.325) (-1019.890) * (-1015.806) (-1017.098) (-1019.380) [-1017.300] -- 0:00:32
454000 -- [-1016.983] (-1017.598) (-1022.697) (-1016.808) * [-1015.534] (-1018.129) (-1018.176) (-1017.008) -- 0:00:32
454500 -- (-1018.662) [-1018.195] (-1017.491) (-1016.219) * (-1017.597) [-1017.365] (-1016.927) (-1017.790) -- 0:00:32
455000 -- (-1019.733) (-1016.648) (-1018.921) [-1019.004] * (-1018.228) [-1018.478] (-1017.752) (-1018.440) -- 0:00:32
Average standard deviation of split frequencies: 0.010725
455500 -- (-1018.087) (-1019.222) [-1016.897] (-1021.093) * (-1016.565) (-1017.475) [-1017.665] (-1019.710) -- 0:00:32
456000 -- (-1016.140) (-1018.320) (-1015.442) [-1018.644] * [-1016.717] (-1017.722) (-1025.163) (-1020.348) -- 0:00:32
456500 -- (-1016.773) [-1016.200] (-1016.201) (-1015.979) * (-1017.101) (-1017.427) (-1016.565) [-1018.882] -- 0:00:32
457000 -- (-1016.955) (-1018.578) [-1017.179] (-1017.259) * (-1017.213) (-1020.923) (-1017.525) [-1017.540] -- 0:00:32
457500 -- (-1016.566) [-1017.513] (-1017.093) (-1019.239) * (-1017.752) (-1022.388) [-1016.718] (-1021.123) -- 0:00:32
458000 -- (-1017.202) (-1018.828) (-1016.776) [-1018.857] * (-1017.343) (-1018.386) (-1018.583) [-1019.297] -- 0:00:31
458500 -- (-1020.758) (-1019.721) [-1019.175] (-1016.216) * [-1017.680] (-1016.036) (-1018.131) (-1018.616) -- 0:00:33
459000 -- (-1020.206) [-1017.602] (-1016.156) (-1020.376) * (-1019.531) (-1016.728) (-1016.596) [-1018.417] -- 0:00:33
459500 -- [-1019.276] (-1016.521) (-1017.355) (-1016.304) * (-1017.400) (-1016.243) [-1018.153] (-1016.219) -- 0:00:32
460000 -- (-1021.339) (-1018.499) [-1018.716] (-1015.757) * (-1016.270) (-1018.061) [-1019.215] (-1017.051) -- 0:00:32
Average standard deviation of split frequencies: 0.010873
460500 -- (-1016.266) (-1018.431) [-1016.132] (-1018.267) * (-1017.785) (-1017.462) (-1016.486) [-1017.627] -- 0:00:32
461000 -- (-1017.405) (-1017.498) [-1017.439] (-1023.851) * (-1017.758) (-1018.261) (-1017.793) [-1016.954] -- 0:00:32
461500 -- [-1015.769] (-1017.269) (-1016.586) (-1018.967) * (-1017.168) (-1017.192) (-1016.180) [-1016.887] -- 0:00:32
462000 -- [-1015.862] (-1018.205) (-1017.397) (-1021.016) * (-1016.052) [-1018.135] (-1017.587) (-1015.875) -- 0:00:32
462500 -- [-1019.000] (-1016.782) (-1017.029) (-1018.325) * (-1016.432) (-1017.499) [-1018.499] (-1017.042) -- 0:00:32
463000 -- (-1020.944) (-1017.010) (-1015.260) [-1017.369] * (-1017.362) [-1017.703] (-1016.197) (-1017.263) -- 0:00:32
463500 -- [-1021.019] (-1015.348) (-1017.468) (-1016.425) * (-1017.152) (-1019.306) [-1016.884] (-1017.073) -- 0:00:32
464000 -- (-1021.432) [-1015.765] (-1018.862) (-1020.464) * (-1017.087) (-1016.558) [-1017.040] (-1020.083) -- 0:00:32
464500 -- (-1018.364) (-1015.594) (-1023.687) [-1018.603] * (-1018.185) (-1015.984) (-1023.092) [-1020.192] -- 0:00:32
465000 -- (-1018.521) (-1015.926) [-1019.261] (-1018.825) * (-1016.004) (-1019.132) (-1017.264) [-1018.834] -- 0:00:32
Average standard deviation of split frequencies: 0.009937
465500 -- (-1017.549) (-1016.959) (-1019.724) [-1018.554] * [-1015.913] (-1018.836) (-1017.397) (-1021.921) -- 0:00:32
466000 -- (-1019.194) [-1016.309] (-1020.791) (-1017.566) * (-1023.275) (-1018.308) [-1016.470] (-1016.806) -- 0:00:32
466500 -- (-1020.147) (-1015.733) [-1016.062] (-1020.502) * [-1016.149] (-1016.051) (-1017.377) (-1016.291) -- 0:00:32
467000 -- (-1017.144) [-1018.192] (-1019.227) (-1017.009) * (-1016.984) (-1019.822) (-1016.016) [-1016.296] -- 0:00:31
467500 -- (-1016.996) [-1016.896] (-1017.698) (-1016.832) * (-1016.881) [-1017.187] (-1017.783) (-1017.375) -- 0:00:31
468000 -- (-1022.404) (-1018.265) (-1017.475) [-1020.376] * [-1018.913] (-1019.751) (-1016.513) (-1019.388) -- 0:00:31
468500 -- [-1020.103] (-1020.282) (-1017.396) (-1021.922) * (-1020.563) [-1016.784] (-1017.117) (-1021.122) -- 0:00:31
469000 -- (-1019.598) (-1019.354) [-1017.714] (-1017.690) * (-1018.450) [-1016.889] (-1016.909) (-1020.083) -- 0:00:31
469500 -- (-1017.527) [-1018.212] (-1018.790) (-1017.959) * (-1017.127) (-1017.274) [-1016.948] (-1018.593) -- 0:00:31
470000 -- (-1018.951) (-1021.215) (-1019.091) [-1017.478] * (-1015.457) [-1018.331] (-1017.914) (-1017.499) -- 0:00:31
Average standard deviation of split frequencies: 0.010078
470500 -- [-1015.480] (-1018.502) (-1022.222) (-1017.618) * (-1015.324) (-1018.026) [-1017.883] (-1018.103) -- 0:00:31
471000 -- [-1019.089] (-1017.401) (-1018.950) (-1019.731) * [-1016.319] (-1016.241) (-1018.504) (-1017.889) -- 0:00:31
471500 -- (-1017.945) (-1016.510) (-1018.116) [-1016.936] * (-1020.701) [-1016.466] (-1016.917) (-1019.569) -- 0:00:31
472000 -- [-1018.284] (-1016.961) (-1017.862) (-1017.566) * (-1021.729) [-1016.692] (-1018.656) (-1018.736) -- 0:00:31
472500 -- (-1018.363) (-1021.287) [-1022.323] (-1017.323) * [-1015.887] (-1018.050) (-1018.269) (-1020.355) -- 0:00:31
473000 -- (-1016.505) [-1017.637] (-1018.415) (-1017.744) * [-1017.415] (-1019.465) (-1017.644) (-1022.834) -- 0:00:31
473500 -- (-1018.829) (-1016.913) [-1015.974] (-1019.316) * (-1019.475) [-1018.668] (-1017.535) (-1018.419) -- 0:00:31
474000 -- (-1018.181) [-1018.313] (-1017.401) (-1018.340) * (-1016.802) (-1017.755) [-1018.383] (-1019.245) -- 0:00:31
474500 -- (-1017.503) [-1017.230] (-1018.205) (-1016.880) * (-1016.827) (-1019.429) (-1016.843) [-1017.303] -- 0:00:31
475000 -- (-1021.048) (-1017.291) (-1020.794) [-1017.543] * (-1018.680) (-1017.258) (-1019.145) [-1019.956] -- 0:00:32
Average standard deviation of split frequencies: 0.010078
475500 -- (-1017.182) [-1020.863] (-1018.241) (-1021.159) * (-1018.175) [-1019.571] (-1016.694) (-1017.412) -- 0:00:31
476000 -- [-1017.071] (-1020.853) (-1016.940) (-1019.438) * [-1022.517] (-1019.951) (-1015.637) (-1016.642) -- 0:00:31
476500 -- (-1015.606) (-1015.977) (-1018.304) [-1018.301] * [-1016.186] (-1019.379) (-1016.042) (-1019.654) -- 0:00:31
477000 -- (-1016.845) (-1018.942) (-1019.518) [-1017.980] * (-1021.327) [-1017.480] (-1020.898) (-1019.417) -- 0:00:31
477500 -- (-1018.157) (-1015.691) [-1019.217] (-1020.124) * (-1020.719) (-1020.540) (-1019.501) [-1017.012] -- 0:00:31
478000 -- (-1021.365) [-1016.194] (-1019.899) (-1019.098) * (-1017.964) (-1019.128) [-1018.183] (-1019.246) -- 0:00:31
478500 -- (-1016.273) [-1017.373] (-1023.544) (-1019.015) * (-1021.453) [-1018.552] (-1016.950) (-1018.835) -- 0:00:31
479000 -- (-1018.126) (-1017.040) [-1015.808] (-1018.595) * (-1018.323) (-1016.867) [-1016.684] (-1017.860) -- 0:00:31
479500 -- [-1017.819] (-1016.676) (-1018.080) (-1018.004) * (-1018.589) (-1016.596) (-1015.970) [-1018.514] -- 0:00:31
480000 -- (-1016.841) (-1016.801) (-1018.289) [-1019.039] * (-1018.758) (-1017.263) (-1017.634) [-1016.280] -- 0:00:31
Average standard deviation of split frequencies: 0.010153
480500 -- [-1018.469] (-1018.192) (-1020.430) (-1017.477) * [-1019.018] (-1016.194) (-1017.651) (-1019.444) -- 0:00:31
481000 -- (-1016.954) (-1022.980) [-1018.180] (-1019.723) * (-1018.356) (-1016.533) (-1016.031) [-1016.523] -- 0:00:31
481500 -- [-1018.468] (-1017.348) (-1016.832) (-1021.210) * (-1017.698) [-1021.184] (-1016.300) (-1017.907) -- 0:00:31
482000 -- [-1016.592] (-1018.012) (-1022.058) (-1017.842) * (-1018.502) (-1019.838) (-1016.325) [-1016.213] -- 0:00:31
482500 -- (-1017.662) [-1017.366] (-1018.100) (-1016.399) * [-1016.762] (-1022.153) (-1016.325) (-1018.841) -- 0:00:31
483000 -- (-1017.628) (-1016.134) [-1017.774] (-1017.661) * (-1020.141) (-1018.117) (-1018.603) [-1017.815] -- 0:00:31
483500 -- [-1019.904] (-1016.253) (-1017.709) (-1016.352) * (-1017.727) (-1019.230) (-1017.030) [-1017.640] -- 0:00:30
484000 -- (-1025.336) (-1017.057) [-1018.604] (-1020.440) * (-1016.300) [-1016.668] (-1017.933) (-1015.768) -- 0:00:30
484500 -- (-1022.698) (-1016.946) (-1019.600) [-1016.805] * (-1016.783) (-1015.868) (-1017.797) [-1016.802] -- 0:00:30
485000 -- (-1018.549) (-1016.911) (-1022.019) [-1018.142] * (-1017.567) (-1016.605) [-1016.453] (-1017.939) -- 0:00:30
Average standard deviation of split frequencies: 0.010239
485500 -- (-1018.421) [-1017.829] (-1017.614) (-1015.772) * (-1018.829) (-1016.901) [-1018.843] (-1017.764) -- 0:00:30
486000 -- [-1016.577] (-1019.690) (-1017.263) (-1016.848) * [-1016.894] (-1020.317) (-1017.421) (-1020.841) -- 0:00:30
486500 -- (-1016.911) (-1017.790) (-1018.709) [-1019.838] * (-1019.811) [-1017.266] (-1020.652) (-1019.520) -- 0:00:30
487000 -- (-1017.030) [-1016.657] (-1018.084) (-1020.100) * (-1019.605) (-1017.643) [-1017.230] (-1016.945) -- 0:00:30
487500 -- (-1017.030) (-1015.828) [-1018.341] (-1019.417) * (-1021.528) (-1019.485) [-1017.053] (-1019.086) -- 0:00:30
488000 -- (-1017.223) (-1020.371) (-1019.833) [-1017.597] * [-1021.136] (-1018.738) (-1016.907) (-1016.877) -- 0:00:30
488500 -- (-1016.002) (-1018.508) (-1025.413) [-1016.478] * (-1021.237) (-1020.300) (-1017.817) [-1019.430] -- 0:00:30
489000 -- (-1016.778) (-1018.224) [-1017.343] (-1016.435) * (-1017.438) (-1016.675) (-1018.320) [-1016.849] -- 0:00:30
489500 -- (-1016.860) (-1024.340) (-1018.990) [-1017.338] * [-1016.189] (-1016.198) (-1016.610) (-1017.582) -- 0:00:30
490000 -- [-1019.329] (-1018.409) (-1017.574) (-1017.574) * (-1016.498) (-1017.244) (-1019.597) [-1017.708] -- 0:00:30
Average standard deviation of split frequencies: 0.010835
490500 -- (-1015.721) (-1020.054) (-1016.580) [-1020.867] * (-1018.588) (-1017.419) (-1016.421) [-1018.580] -- 0:00:30
491000 -- (-1016.797) (-1020.119) [-1018.496] (-1024.172) * [-1016.688] (-1017.733) (-1017.213) (-1016.228) -- 0:00:30
491500 -- (-1016.116) [-1015.595] (-1016.359) (-1018.810) * [-1020.251] (-1017.842) (-1016.936) (-1017.431) -- 0:00:31
492000 -- [-1018.387] (-1016.675) (-1016.446) (-1017.176) * (-1017.453) [-1018.331] (-1019.861) (-1016.917) -- 0:00:30
492500 -- (-1018.581) [-1019.030] (-1016.184) (-1016.799) * (-1016.713) (-1018.547) (-1020.042) [-1018.221] -- 0:00:30
493000 -- (-1018.044) [-1016.708] (-1017.786) (-1018.239) * (-1022.029) (-1019.014) (-1016.109) [-1019.949] -- 0:00:30
493500 -- (-1018.603) (-1018.840) (-1016.878) [-1018.136] * (-1020.325) (-1017.183) (-1016.102) [-1016.866] -- 0:00:30
494000 -- (-1019.346) (-1017.645) [-1018.893] (-1021.001) * [-1016.017] (-1017.140) (-1017.212) (-1017.371) -- 0:00:30
494500 -- (-1017.318) [-1017.222] (-1016.607) (-1020.620) * [-1015.883] (-1020.246) (-1019.763) (-1018.668) -- 0:00:30
495000 -- [-1019.199] (-1016.449) (-1015.836) (-1018.559) * (-1018.051) (-1017.568) (-1018.689) [-1020.410] -- 0:00:30
Average standard deviation of split frequencies: 0.010007
495500 -- (-1018.216) (-1021.408) (-1015.778) [-1016.230] * (-1019.911) (-1016.838) [-1020.598] (-1019.102) -- 0:00:30
496000 -- (-1020.169) [-1020.068] (-1017.906) (-1017.712) * (-1018.886) (-1017.413) (-1022.684) [-1017.910] -- 0:00:30
496500 -- [-1020.142] (-1018.958) (-1016.662) (-1018.053) * (-1017.406) (-1018.460) [-1017.084] (-1017.868) -- 0:00:30
497000 -- (-1016.721) (-1018.359) [-1017.503] (-1015.787) * (-1017.594) (-1018.374) (-1018.534) [-1016.963] -- 0:00:30
497500 -- (-1016.418) [-1018.115] (-1016.772) (-1016.888) * (-1016.895) [-1022.220] (-1016.440) (-1019.259) -- 0:00:30
498000 -- [-1016.791] (-1016.612) (-1016.397) (-1016.897) * [-1016.086] (-1017.752) (-1017.871) (-1022.330) -- 0:00:30
498500 -- (-1019.115) [-1016.259] (-1016.465) (-1016.222) * (-1018.587) (-1017.383) (-1015.441) [-1021.039] -- 0:00:30
499000 -- [-1016.122] (-1017.962) (-1016.777) (-1016.317) * (-1018.684) [-1018.644] (-1016.459) (-1018.124) -- 0:00:30
499500 -- (-1016.042) (-1016.366) [-1017.061] (-1016.611) * (-1024.089) [-1016.156] (-1016.474) (-1018.218) -- 0:00:30
500000 -- (-1016.167) (-1016.359) [-1015.972] (-1018.969) * (-1020.800) [-1015.996] (-1017.336) (-1016.770) -- 0:00:30
Average standard deviation of split frequencies: 0.010566
500500 -- [-1018.777] (-1021.030) (-1021.710) (-1021.717) * (-1022.083) (-1019.747) [-1016.799] (-1020.284) -- 0:00:29
501000 -- (-1017.391) [-1019.912] (-1019.300) (-1020.848) * (-1021.382) (-1018.468) (-1017.036) [-1015.946] -- 0:00:29
501500 -- (-1017.451) (-1017.684) [-1017.502] (-1021.361) * (-1018.196) (-1020.631) (-1017.036) [-1018.719] -- 0:00:29
502000 -- (-1017.492) (-1018.502) [-1018.247] (-1021.242) * (-1016.927) (-1016.761) (-1019.264) [-1017.813] -- 0:00:29
502500 -- [-1019.067] (-1018.100) (-1016.380) (-1018.806) * (-1018.078) (-1017.886) [-1020.656] (-1016.900) -- 0:00:29
503000 -- (-1019.650) (-1017.455) [-1018.513] (-1017.168) * (-1017.380) (-1020.595) (-1015.791) [-1017.621] -- 0:00:29
503500 -- (-1020.715) (-1018.669) (-1017.392) [-1018.145] * (-1015.994) (-1015.987) (-1018.943) [-1017.539] -- 0:00:29
504000 -- (-1018.161) (-1016.229) [-1017.288] (-1019.877) * (-1016.342) (-1015.718) [-1017.004] (-1023.813) -- 0:00:29
504500 -- (-1018.451) [-1016.647] (-1018.635) (-1017.681) * (-1017.491) (-1017.552) (-1020.205) [-1017.993] -- 0:00:29
505000 -- [-1015.904] (-1017.118) (-1017.551) (-1018.401) * (-1016.145) [-1017.193] (-1018.769) (-1017.853) -- 0:00:29
Average standard deviation of split frequencies: 0.010662
505500 -- (-1017.166) (-1017.058) (-1017.873) [-1016.518] * (-1019.322) (-1017.126) (-1017.801) [-1017.611] -- 0:00:29
506000 -- (-1017.421) (-1016.843) (-1019.183) [-1016.461] * (-1019.570) (-1017.042) (-1016.512) [-1017.604] -- 0:00:29
506500 -- (-1016.414) [-1016.999] (-1020.471) (-1017.142) * (-1020.214) (-1016.267) [-1020.042] (-1018.555) -- 0:00:29
507000 -- [-1017.523] (-1017.412) (-1018.559) (-1020.043) * (-1017.561) [-1016.098] (-1020.970) (-1019.069) -- 0:00:29
507500 -- (-1017.410) [-1018.262] (-1017.234) (-1016.451) * [-1016.272] (-1016.028) (-1016.982) (-1018.648) -- 0:00:29
508000 -- [-1016.447] (-1019.309) (-1016.340) (-1016.263) * (-1016.558) (-1015.729) [-1017.618] (-1018.897) -- 0:00:30
508500 -- (-1017.486) (-1017.639) [-1016.345] (-1016.399) * (-1017.458) (-1016.786) [-1017.674] (-1019.770) -- 0:00:29
509000 -- [-1016.449] (-1016.737) (-1016.072) (-1017.039) * (-1022.505) [-1017.816] (-1016.656) (-1017.665) -- 0:00:29
509500 -- (-1016.458) (-1020.372) [-1018.606] (-1018.971) * [-1018.732] (-1016.557) (-1018.368) (-1021.301) -- 0:00:29
510000 -- [-1018.149] (-1018.425) (-1016.721) (-1018.756) * [-1021.925] (-1019.327) (-1017.084) (-1024.189) -- 0:00:29
Average standard deviation of split frequencies: 0.011180
510500 -- (-1018.756) (-1018.172) (-1020.524) [-1019.255] * (-1020.461) [-1018.290] (-1017.427) (-1019.631) -- 0:00:29
511000 -- (-1019.214) (-1017.173) [-1017.361] (-1024.252) * [-1016.100] (-1017.383) (-1022.002) (-1019.191) -- 0:00:29
511500 -- (-1017.646) [-1019.963] (-1017.634) (-1018.247) * (-1017.119) [-1018.067] (-1017.984) (-1022.238) -- 0:00:29
512000 -- (-1017.220) [-1018.255] (-1016.451) (-1018.115) * [-1017.781] (-1019.110) (-1018.307) (-1018.190) -- 0:00:29
512500 -- [-1015.933] (-1017.296) (-1017.362) (-1016.269) * [-1016.398] (-1016.544) (-1016.754) (-1019.848) -- 0:00:29
513000 -- (-1015.978) [-1016.725] (-1022.027) (-1015.940) * [-1019.577] (-1017.973) (-1021.642) (-1017.884) -- 0:00:29
513500 -- [-1015.760] (-1017.595) (-1017.748) (-1017.554) * (-1018.624) (-1016.053) (-1017.104) [-1017.504] -- 0:00:29
514000 -- (-1018.064) (-1018.528) [-1018.556] (-1019.203) * [-1016.210] (-1017.523) (-1017.440) (-1018.403) -- 0:00:29
514500 -- (-1021.373) [-1017.637] (-1017.949) (-1017.871) * (-1017.059) [-1017.834] (-1017.033) (-1017.417) -- 0:00:29
515000 -- (-1017.325) (-1016.749) (-1019.186) [-1017.859] * (-1015.895) (-1016.171) [-1017.044] (-1018.077) -- 0:00:29
Average standard deviation of split frequencies: 0.011470
515500 -- (-1016.366) (-1017.885) (-1021.390) [-1017.613] * [-1017.790] (-1016.604) (-1015.872) (-1018.476) -- 0:00:29
516000 -- (-1016.837) (-1018.630) [-1020.148] (-1018.121) * (-1018.405) (-1015.460) (-1017.009) [-1016.303] -- 0:00:29
516500 -- (-1016.259) [-1019.789] (-1017.094) (-1016.172) * (-1019.040) (-1016.614) (-1025.042) [-1017.144] -- 0:00:29
517000 -- [-1016.867] (-1017.757) (-1018.139) (-1017.755) * (-1019.771) (-1015.452) [-1018.766] (-1018.715) -- 0:00:28
517500 -- (-1020.071) (-1018.016) [-1021.206] (-1017.274) * (-1019.975) (-1016.772) (-1018.913) [-1017.826] -- 0:00:28
518000 -- [-1017.233] (-1016.772) (-1019.033) (-1020.058) * (-1018.409) (-1020.055) (-1021.139) [-1017.293] -- 0:00:28
518500 -- [-1016.972] (-1018.367) (-1018.483) (-1017.979) * (-1017.320) (-1017.504) (-1018.757) [-1018.005] -- 0:00:28
519000 -- (-1018.925) [-1019.176] (-1019.085) (-1017.645) * (-1016.913) [-1019.664] (-1017.808) (-1016.512) -- 0:00:28
519500 -- (-1020.146) (-1018.923) [-1018.227] (-1020.350) * (-1016.731) [-1016.964] (-1017.116) (-1016.208) -- 0:00:28
520000 -- (-1017.266) [-1016.492] (-1017.468) (-1017.608) * (-1018.177) (-1021.137) (-1020.051) [-1016.342] -- 0:00:28
Average standard deviation of split frequencies: 0.011519
520500 -- (-1018.281) (-1017.062) [-1017.292] (-1016.609) * (-1016.832) (-1018.729) (-1018.424) [-1015.929] -- 0:00:28
521000 -- (-1018.007) (-1018.681) (-1018.839) [-1018.354] * (-1016.602) (-1018.578) (-1020.030) [-1018.802] -- 0:00:28
521500 -- (-1017.975) [-1017.280] (-1022.023) (-1019.616) * (-1019.120) [-1015.998] (-1017.897) (-1016.379) -- 0:00:28
522000 -- (-1019.087) (-1017.856) (-1019.326) [-1017.878] * (-1019.044) (-1015.959) [-1018.577] (-1016.896) -- 0:00:28
522500 -- (-1017.251) (-1017.843) (-1016.341) [-1017.940] * (-1016.784) (-1016.281) [-1015.945] (-1016.441) -- 0:00:28
523000 -- (-1017.172) (-1018.341) (-1017.582) [-1021.805] * (-1018.260) (-1015.797) (-1018.653) [-1016.787] -- 0:00:28
523500 -- (-1017.538) (-1017.557) [-1017.363] (-1015.868) * (-1022.648) (-1019.210) [-1015.937] (-1015.692) -- 0:00:28
524000 -- (-1025.578) (-1017.802) (-1016.521) [-1018.912] * [-1018.667] (-1016.125) (-1017.649) (-1016.157) -- 0:00:28
524500 -- (-1020.385) (-1016.451) (-1020.526) [-1018.227] * (-1019.644) [-1017.132] (-1019.752) (-1015.873) -- 0:00:29
525000 -- (-1018.103) [-1017.855] (-1018.604) (-1016.933) * (-1017.394) (-1016.804) (-1017.850) [-1016.684] -- 0:00:28
Average standard deviation of split frequencies: 0.011153
525500 -- (-1016.903) (-1016.318) [-1018.659] (-1015.975) * [-1016.829] (-1020.407) (-1017.202) (-1017.802) -- 0:00:28
526000 -- (-1020.079) (-1019.616) [-1016.396] (-1020.653) * (-1017.839) [-1020.955] (-1022.462) (-1019.748) -- 0:00:28
526500 -- (-1016.338) (-1019.861) [-1016.428] (-1015.859) * (-1018.226) (-1018.269) [-1020.679] (-1021.254) -- 0:00:28
527000 -- (-1018.284) (-1020.409) (-1019.086) [-1016.942] * (-1017.580) [-1016.242] (-1020.463) (-1018.481) -- 0:00:28
527500 -- [-1017.726] (-1017.881) (-1021.148) (-1016.872) * (-1018.027) [-1016.142] (-1016.473) (-1022.056) -- 0:00:28
528000 -- (-1019.964) [-1017.871] (-1022.759) (-1019.480) * (-1018.463) (-1017.140) [-1016.756] (-1019.790) -- 0:00:28
528500 -- (-1018.927) [-1016.086] (-1016.496) (-1021.263) * (-1018.704) (-1023.905) [-1016.325] (-1016.356) -- 0:00:28
529000 -- (-1015.822) (-1016.573) [-1017.617] (-1016.022) * (-1016.805) (-1024.405) (-1022.077) [-1018.390] -- 0:00:28
529500 -- (-1018.324) [-1016.522] (-1016.925) (-1016.227) * [-1016.264] (-1017.829) (-1019.247) (-1018.130) -- 0:00:28
530000 -- (-1018.467) (-1016.744) (-1019.805) [-1017.539] * (-1016.531) [-1019.834] (-1016.731) (-1018.085) -- 0:00:28
Average standard deviation of split frequencies: 0.011301
530500 -- (-1017.943) [-1015.986] (-1017.016) (-1019.423) * (-1018.018) (-1017.163) [-1017.584] (-1023.121) -- 0:00:28
531000 -- (-1021.348) [-1017.014] (-1016.737) (-1017.646) * (-1017.339) [-1017.657] (-1015.695) (-1020.618) -- 0:00:28
531500 -- (-1020.793) [-1018.448] (-1024.842) (-1019.865) * [-1017.530] (-1020.321) (-1015.788) (-1017.793) -- 0:00:28
532000 -- [-1020.320] (-1021.416) (-1017.735) (-1018.554) * (-1017.741) (-1015.925) [-1016.828] (-1021.500) -- 0:00:28
532500 -- (-1017.101) (-1021.061) [-1017.794] (-1021.466) * [-1018.085] (-1018.389) (-1016.397) (-1017.410) -- 0:00:28
533000 -- [-1015.871] (-1019.295) (-1017.431) (-1020.287) * (-1020.793) (-1019.685) (-1017.809) [-1017.333] -- 0:00:28
533500 -- [-1018.045] (-1017.516) (-1017.748) (-1017.510) * (-1021.374) [-1020.040] (-1022.542) (-1016.171) -- 0:00:27
534000 -- (-1018.339) (-1016.903) [-1019.562] (-1019.846) * (-1019.036) [-1017.247] (-1023.240) (-1017.559) -- 0:00:27
534500 -- [-1020.357] (-1016.184) (-1017.014) (-1020.197) * (-1020.240) (-1019.645) (-1018.467) [-1021.660] -- 0:00:27
535000 -- (-1018.064) [-1015.599] (-1020.144) (-1018.395) * [-1016.750] (-1016.355) (-1019.863) (-1017.568) -- 0:00:27
Average standard deviation of split frequencies: 0.011238
535500 -- (-1016.831) (-1020.353) (-1018.363) [-1018.127] * (-1017.278) (-1015.717) (-1019.410) [-1020.645] -- 0:00:27
536000 -- (-1019.202) (-1021.337) (-1017.713) [-1018.091] * (-1017.013) [-1016.109] (-1017.331) (-1017.045) -- 0:00:27
536500 -- [-1017.375] (-1019.197) (-1019.077) (-1015.717) * (-1015.617) [-1016.523] (-1020.192) (-1016.385) -- 0:00:27
537000 -- (-1022.993) (-1018.135) (-1019.737) [-1016.684] * (-1017.713) (-1015.747) (-1021.504) [-1017.157] -- 0:00:27
537500 -- (-1027.336) (-1019.804) (-1020.028) [-1017.233] * (-1017.483) (-1017.574) (-1015.875) [-1017.390] -- 0:00:27
538000 -- (-1018.960) (-1018.251) [-1021.777] (-1016.977) * (-1017.587) [-1022.335] (-1016.899) (-1017.726) -- 0:00:27
538500 -- (-1017.090) [-1017.091] (-1018.011) (-1016.690) * (-1016.052) (-1022.351) (-1018.501) [-1018.806] -- 0:00:27
539000 -- (-1016.054) [-1016.877] (-1016.173) (-1015.445) * (-1017.346) [-1024.026] (-1019.950) (-1017.453) -- 0:00:27
539500 -- (-1016.581) (-1017.552) [-1016.219] (-1016.265) * (-1017.956) [-1023.164] (-1018.687) (-1016.911) -- 0:00:27
540000 -- (-1015.920) (-1020.345) (-1016.328) [-1017.972] * [-1016.585] (-1019.883) (-1016.538) (-1016.428) -- 0:00:27
Average standard deviation of split frequencies: 0.011129
540500 -- (-1015.572) (-1016.824) (-1016.537) [-1016.412] * [-1016.093] (-1019.651) (-1018.874) (-1018.579) -- 0:00:28
541000 -- (-1016.764) (-1019.085) (-1018.197) [-1016.594] * [-1016.802] (-1018.041) (-1016.707) (-1019.054) -- 0:00:27
541500 -- [-1016.070] (-1018.252) (-1018.419) (-1019.036) * [-1017.271] (-1017.512) (-1019.413) (-1018.248) -- 0:00:27
542000 -- (-1017.796) (-1019.909) [-1020.943] (-1017.571) * (-1016.958) [-1017.701] (-1016.425) (-1016.177) -- 0:00:27
542500 -- [-1016.882] (-1015.874) (-1018.739) (-1019.476) * (-1021.934) (-1018.664) [-1016.674] (-1016.549) -- 0:00:27
543000 -- (-1017.704) (-1016.107) (-1019.995) [-1019.875] * (-1016.938) [-1017.160] (-1016.817) (-1018.442) -- 0:00:27
543500 -- [-1017.018] (-1016.181) (-1020.778) (-1018.749) * (-1017.128) [-1017.125] (-1015.784) (-1017.888) -- 0:00:27
544000 -- [-1016.832] (-1016.980) (-1030.371) (-1018.353) * (-1017.075) [-1016.662] (-1018.326) (-1018.837) -- 0:00:27
544500 -- (-1016.252) (-1023.143) [-1018.054] (-1022.300) * (-1017.703) [-1018.568] (-1017.934) (-1018.344) -- 0:00:27
545000 -- (-1019.598) (-1020.004) [-1018.399] (-1021.536) * [-1016.039] (-1018.591) (-1015.921) (-1017.579) -- 0:00:27
Average standard deviation of split frequencies: 0.010552
545500 -- (-1024.898) (-1018.568) [-1017.169] (-1019.390) * (-1020.270) (-1017.994) (-1019.069) [-1019.187] -- 0:00:27
546000 -- [-1019.272] (-1016.708) (-1017.335) (-1017.454) * [-1017.156] (-1017.042) (-1018.182) (-1015.906) -- 0:00:27
546500 -- (-1016.675) (-1015.564) [-1022.416] (-1015.815) * (-1020.206) (-1018.924) (-1017.603) [-1017.592] -- 0:00:27
547000 -- (-1016.360) [-1016.729] (-1017.788) (-1015.810) * [-1018.451] (-1018.596) (-1016.428) (-1017.452) -- 0:00:27
547500 -- [-1017.915] (-1016.210) (-1015.739) (-1018.644) * (-1016.767) (-1019.139) (-1016.856) [-1017.339] -- 0:00:27
548000 -- [-1016.823] (-1018.720) (-1017.516) (-1018.852) * [-1016.731] (-1017.503) (-1017.323) (-1020.180) -- 0:00:27
548500 -- (-1020.821) [-1015.928] (-1017.186) (-1015.911) * [-1017.672] (-1015.951) (-1017.215) (-1016.205) -- 0:00:27
549000 -- (-1019.234) [-1017.399] (-1019.605) (-1016.827) * (-1018.776) (-1017.262) (-1019.161) [-1016.803] -- 0:00:27
549500 -- (-1018.461) [-1016.831] (-1018.045) (-1016.987) * (-1016.763) (-1017.436) [-1016.192] (-1021.444) -- 0:00:27
550000 -- (-1019.796) (-1019.552) [-1020.390] (-1016.793) * (-1015.660) [-1017.002] (-1019.970) (-1021.536) -- 0:00:27
Average standard deviation of split frequencies: 0.010178
550500 -- (-1018.822) (-1019.300) [-1019.054] (-1019.933) * [-1018.718] (-1020.632) (-1016.604) (-1019.029) -- 0:00:26
551000 -- [-1017.322] (-1016.697) (-1023.453) (-1019.017) * (-1016.870) (-1020.929) (-1021.875) [-1018.952] -- 0:00:26
551500 -- (-1017.735) (-1016.134) [-1016.031] (-1019.048) * [-1016.472] (-1017.439) (-1017.436) (-1018.330) -- 0:00:26
552000 -- (-1017.105) (-1019.230) [-1017.932] (-1018.867) * (-1018.533) [-1020.032] (-1016.630) (-1022.325) -- 0:00:26
552500 -- (-1022.666) [-1019.230] (-1015.719) (-1016.452) * (-1017.585) (-1019.476) [-1016.082] (-1021.092) -- 0:00:26
553000 -- (-1017.152) (-1017.250) (-1017.867) [-1021.024] * (-1016.551) (-1017.458) (-1025.437) [-1016.891] -- 0:00:26
553500 -- [-1020.590] (-1017.365) (-1018.304) (-1016.805) * (-1019.664) (-1016.957) (-1021.021) [-1023.735] -- 0:00:26
554000 -- [-1018.345] (-1016.641) (-1017.279) (-1016.691) * [-1017.736] (-1016.715) (-1015.976) (-1017.508) -- 0:00:26
554500 -- [-1016.046] (-1022.627) (-1017.559) (-1020.583) * (-1018.264) [-1015.753] (-1015.823) (-1015.981) -- 0:00:26
555000 -- [-1019.417] (-1018.139) (-1018.560) (-1016.220) * (-1021.303) (-1016.861) (-1016.099) [-1016.063] -- 0:00:26
Average standard deviation of split frequencies: 0.010410
555500 -- [-1016.215] (-1018.763) (-1020.272) (-1017.906) * (-1021.456) [-1018.193] (-1016.007) (-1016.998) -- 0:00:26
556000 -- (-1020.641) (-1017.126) (-1020.261) [-1018.782] * (-1021.226) (-1017.476) (-1020.475) [-1019.787] -- 0:00:26
556500 -- [-1016.457] (-1017.425) (-1016.933) (-1022.441) * (-1020.459) (-1017.296) (-1016.793) [-1016.612] -- 0:00:26
557000 -- [-1017.472] (-1017.863) (-1017.057) (-1021.688) * (-1020.271) (-1018.388) [-1017.959] (-1018.666) -- 0:00:27
557500 -- [-1016.817] (-1018.841) (-1017.885) (-1016.959) * [-1016.784] (-1020.097) (-1021.060) (-1018.830) -- 0:00:26
558000 -- (-1019.159) [-1018.904] (-1017.478) (-1016.677) * (-1023.715) (-1019.494) (-1018.341) [-1023.594] -- 0:00:26
558500 -- [-1017.970] (-1022.891) (-1018.456) (-1017.114) * (-1017.772) (-1018.847) (-1019.802) [-1020.648] -- 0:00:26
559000 -- (-1019.983) (-1021.762) (-1016.326) [-1018.349] * (-1017.419) (-1018.207) [-1016.824] (-1022.479) -- 0:00:26
559500 -- (-1021.602) [-1021.710] (-1016.581) (-1021.796) * (-1020.214) [-1015.787] (-1015.566) (-1020.304) -- 0:00:26
560000 -- [-1016.689] (-1019.268) (-1018.910) (-1016.194) * (-1019.547) (-1015.772) (-1017.429) [-1020.155] -- 0:00:26
Average standard deviation of split frequencies: 0.010930
560500 -- [-1016.666] (-1018.960) (-1018.925) (-1016.838) * (-1019.126) (-1017.614) [-1017.850] (-1016.275) -- 0:00:26
561000 -- (-1018.317) (-1018.767) (-1017.565) [-1017.624] * (-1016.320) [-1017.335] (-1018.017) (-1018.329) -- 0:00:26
561500 -- (-1017.898) (-1017.181) [-1016.375] (-1018.175) * [-1018.001] (-1016.916) (-1021.165) (-1016.721) -- 0:00:26
562000 -- (-1018.422) [-1018.423] (-1018.879) (-1015.947) * [-1021.243] (-1019.393) (-1023.010) (-1016.735) -- 0:00:26
562500 -- (-1019.037) (-1016.815) [-1017.196] (-1016.517) * (-1016.920) [-1016.002] (-1019.026) (-1016.663) -- 0:00:26
563000 -- (-1016.822) [-1017.457] (-1018.227) (-1016.794) * (-1018.172) (-1019.664) (-1017.137) [-1017.034] -- 0:00:26
563500 -- [-1016.586] (-1017.345) (-1020.926) (-1020.979) * (-1016.671) (-1021.134) [-1016.380] (-1016.801) -- 0:00:26
564000 -- (-1017.524) [-1016.422] (-1018.781) (-1016.857) * (-1018.632) (-1018.642) (-1016.370) [-1016.233] -- 0:00:26
564500 -- (-1016.608) (-1017.839) (-1018.781) [-1017.553] * [-1017.249] (-1015.883) (-1019.912) (-1017.082) -- 0:00:26
565000 -- (-1020.361) (-1021.057) [-1019.971] (-1016.404) * (-1021.998) [-1019.646] (-1020.359) (-1018.435) -- 0:00:26
Average standard deviation of split frequencies: 0.011290
565500 -- (-1017.469) (-1016.819) (-1018.786) [-1016.196] * (-1017.105) (-1022.626) [-1018.948] (-1018.850) -- 0:00:26
566000 -- (-1019.401) (-1018.797) [-1019.148] (-1016.826) * (-1018.886) (-1016.729) (-1021.097) [-1018.975] -- 0:00:26
566500 -- (-1019.380) (-1017.638) [-1018.718] (-1016.618) * (-1017.366) [-1016.928] (-1017.571) (-1018.354) -- 0:00:26
567000 -- (-1020.802) [-1017.346] (-1017.116) (-1015.620) * [-1016.560] (-1016.733) (-1017.356) (-1017.243) -- 0:00:25
567500 -- (-1017.163) [-1016.288] (-1017.380) (-1016.671) * [-1016.736] (-1018.147) (-1017.585) (-1017.229) -- 0:00:25
568000 -- (-1018.116) [-1021.506] (-1017.424) (-1018.738) * [-1015.487] (-1019.809) (-1018.522) (-1016.195) -- 0:00:25
568500 -- (-1019.229) [-1016.851] (-1016.017) (-1019.698) * (-1015.535) (-1020.792) (-1017.352) [-1016.536] -- 0:00:25
569000 -- (-1016.414) (-1018.087) [-1017.980] (-1019.692) * (-1016.279) [-1016.734] (-1016.643) (-1016.065) -- 0:00:25
569500 -- (-1017.076) (-1015.800) [-1017.305] (-1016.579) * (-1016.392) [-1016.801] (-1018.168) (-1018.137) -- 0:00:25
570000 -- (-1016.289) (-1015.918) [-1020.513] (-1017.317) * [-1016.372] (-1018.689) (-1018.730) (-1016.184) -- 0:00:25
Average standard deviation of split frequencies: 0.011106
570500 -- (-1018.059) (-1020.877) (-1019.359) [-1018.063] * (-1017.110) [-1018.306] (-1021.442) (-1018.099) -- 0:00:25
571000 -- [-1019.441] (-1020.264) (-1018.475) (-1017.367) * (-1018.640) (-1019.538) [-1015.798] (-1016.449) -- 0:00:25
571500 -- (-1018.960) (-1016.993) [-1020.205] (-1019.559) * (-1017.867) (-1018.516) (-1017.846) [-1016.483] -- 0:00:25
572000 -- (-1016.708) (-1017.451) [-1022.905] (-1018.571) * (-1018.430) (-1016.332) (-1017.098) [-1017.120] -- 0:00:25
572500 -- [-1016.840] (-1017.169) (-1017.783) (-1018.438) * (-1016.440) [-1020.252] (-1017.616) (-1018.689) -- 0:00:25
573000 -- (-1017.876) [-1019.443] (-1019.221) (-1016.269) * (-1017.284) (-1017.908) (-1019.116) [-1019.467] -- 0:00:25
573500 -- [-1017.309] (-1018.138) (-1019.868) (-1016.991) * (-1015.706) [-1016.161] (-1017.300) (-1021.139) -- 0:00:26
574000 -- (-1018.426) (-1021.003) [-1019.428] (-1016.947) * (-1016.759) [-1017.813] (-1018.207) (-1016.454) -- 0:00:25
574500 -- [-1016.536] (-1019.184) (-1019.418) (-1017.791) * (-1018.956) (-1016.576) (-1017.450) [-1017.821] -- 0:00:25
575000 -- [-1019.312] (-1017.342) (-1019.543) (-1017.211) * [-1016.770] (-1022.385) (-1017.402) (-1018.934) -- 0:00:25
Average standard deviation of split frequencies: 0.010350
575500 -- (-1016.898) (-1026.763) (-1020.647) [-1018.391] * (-1017.203) (-1023.193) [-1016.565] (-1018.697) -- 0:00:25
576000 -- (-1016.406) (-1022.213) (-1016.054) [-1017.468] * (-1016.860) (-1019.418) [-1018.044] (-1017.720) -- 0:00:25
576500 -- (-1016.747) [-1016.083] (-1022.952) (-1018.939) * (-1018.240) (-1019.732) (-1016.378) [-1016.300] -- 0:00:25
577000 -- (-1023.478) (-1016.602) [-1020.366] (-1016.626) * [-1019.246] (-1017.791) (-1018.248) (-1019.709) -- 0:00:25
577500 -- [-1019.277] (-1019.089) (-1018.798) (-1021.398) * (-1015.501) (-1018.304) [-1019.127] (-1018.287) -- 0:00:25
578000 -- (-1022.849) (-1018.432) (-1017.049) [-1016.364] * (-1019.867) (-1023.827) (-1018.388) [-1015.866] -- 0:00:25
578500 -- (-1022.368) (-1019.985) (-1017.376) [-1015.473] * (-1016.677) (-1017.563) (-1017.362) [-1016.541] -- 0:00:25
579000 -- (-1023.171) (-1017.851) [-1020.202] (-1017.957) * [-1016.362] (-1019.232) (-1015.517) (-1020.005) -- 0:00:25
579500 -- (-1018.052) (-1016.227) (-1020.149) [-1015.916] * (-1016.430) (-1016.925) [-1015.498] (-1019.460) -- 0:00:25
580000 -- (-1019.112) (-1016.705) [-1019.804] (-1016.499) * (-1019.056) [-1016.818] (-1016.733) (-1018.744) -- 0:00:25
Average standard deviation of split frequencies: 0.010793
580500 -- (-1019.767) (-1016.115) (-1016.418) [-1017.636] * [-1017.140] (-1019.835) (-1017.673) (-1017.513) -- 0:00:25
581000 -- [-1017.583] (-1019.404) (-1016.501) (-1018.265) * (-1017.381) (-1021.314) (-1016.846) [-1016.783] -- 0:00:25
581500 -- (-1018.821) (-1019.154) (-1015.759) [-1018.830] * (-1021.164) (-1017.407) [-1016.811] (-1016.805) -- 0:00:25
582000 -- [-1017.386] (-1020.134) (-1017.118) (-1019.241) * (-1017.131) (-1016.267) (-1017.223) [-1016.290] -- 0:00:25
582500 -- (-1015.852) (-1016.633) [-1017.801] (-1018.556) * (-1016.724) (-1016.942) (-1021.116) [-1017.079] -- 0:00:25
583000 -- [-1016.559] (-1016.694) (-1016.683) (-1018.066) * [-1019.350] (-1018.023) (-1023.102) (-1016.779) -- 0:00:25
583500 -- (-1015.354) (-1017.117) (-1016.639) [-1016.776] * (-1017.011) (-1016.033) [-1018.393] (-1018.203) -- 0:00:24
584000 -- (-1017.531) (-1018.347) [-1016.668] (-1021.473) * (-1019.894) [-1015.891] (-1017.814) (-1019.106) -- 0:00:24
584500 -- [-1018.120] (-1017.217) (-1018.666) (-1019.414) * (-1017.420) [-1015.994] (-1016.691) (-1018.108) -- 0:00:24
585000 -- (-1020.611) [-1015.631] (-1015.827) (-1017.130) * (-1016.230) [-1017.422] (-1015.935) (-1018.355) -- 0:00:24
Average standard deviation of split frequencies: 0.010127
585500 -- (-1017.771) (-1017.649) [-1015.979] (-1017.540) * (-1017.827) [-1016.410] (-1016.514) (-1017.270) -- 0:00:24
586000 -- [-1019.121] (-1018.940) (-1015.843) (-1018.606) * (-1017.915) [-1015.976] (-1016.781) (-1017.713) -- 0:00:24
586500 -- (-1020.650) [-1016.609] (-1016.943) (-1015.569) * (-1016.235) (-1017.430) (-1020.553) [-1019.570] -- 0:00:24
587000 -- (-1018.797) (-1019.144) [-1015.952] (-1016.437) * (-1016.474) (-1015.696) [-1017.219] (-1017.864) -- 0:00:24
587500 -- (-1017.575) (-1017.403) (-1016.929) [-1015.505] * [-1018.601] (-1018.364) (-1017.581) (-1018.070) -- 0:00:24
588000 -- [-1016.827] (-1016.388) (-1017.204) (-1016.967) * [-1016.135] (-1018.451) (-1016.791) (-1016.636) -- 0:00:24
588500 -- [-1017.041] (-1020.068) (-1015.829) (-1016.210) * (-1015.540) [-1019.605] (-1016.580) (-1016.539) -- 0:00:24
589000 -- (-1016.380) (-1021.104) [-1017.539] (-1017.457) * (-1016.451) (-1019.757) (-1016.619) [-1016.120] -- 0:00:24
589500 -- [-1018.154] (-1023.381) (-1016.523) (-1017.028) * (-1018.857) (-1017.396) [-1017.292] (-1016.108) -- 0:00:25
590000 -- (-1017.094) [-1022.526] (-1018.062) (-1019.678) * (-1015.780) (-1018.193) [-1017.504] (-1017.961) -- 0:00:25
Average standard deviation of split frequencies: 0.009624
590500 -- (-1020.974) (-1022.520) [-1016.503] (-1016.526) * (-1020.133) [-1025.852] (-1016.098) (-1016.038) -- 0:00:24
591000 -- (-1017.809) (-1023.385) [-1019.645] (-1018.794) * (-1022.043) (-1024.508) (-1017.314) [-1016.425] -- 0:00:24
591500 -- (-1017.851) (-1021.429) [-1021.033] (-1021.548) * (-1018.739) (-1017.941) [-1017.524] (-1016.458) -- 0:00:24
592000 -- (-1019.836) (-1016.544) [-1017.832] (-1018.738) * (-1018.459) (-1015.722) [-1016.488] (-1018.188) -- 0:00:24
592500 -- (-1016.809) (-1018.677) (-1020.265) [-1017.848] * (-1018.912) (-1017.519) [-1018.123] (-1019.835) -- 0:00:24
593000 -- (-1016.443) (-1016.924) (-1020.446) [-1016.562] * (-1018.822) [-1019.777] (-1018.918) (-1021.957) -- 0:00:24
593500 -- [-1017.030] (-1020.189) (-1016.830) (-1020.442) * (-1019.988) (-1017.006) [-1016.628] (-1018.498) -- 0:00:24
594000 -- (-1015.753) [-1016.542] (-1018.405) (-1021.376) * (-1016.946) (-1017.692) (-1017.105) [-1016.514] -- 0:00:24
594500 -- [-1018.650] (-1015.537) (-1018.946) (-1016.361) * (-1017.820) (-1019.694) (-1015.504) [-1018.556] -- 0:00:24
595000 -- (-1015.910) (-1017.654) (-1018.093) [-1018.161] * (-1018.435) (-1020.051) (-1017.169) [-1016.678] -- 0:00:24
Average standard deviation of split frequencies: 0.009398
595500 -- (-1016.586) [-1017.683] (-1017.222) (-1019.246) * (-1017.914) (-1019.117) (-1022.090) [-1018.807] -- 0:00:24
596000 -- (-1020.047) (-1016.358) (-1017.237) [-1017.128] * (-1022.000) (-1031.036) (-1018.553) [-1016.317] -- 0:00:24
596500 -- (-1018.168) (-1017.737) [-1017.714] (-1017.999) * (-1016.913) (-1021.650) [-1016.031] (-1016.239) -- 0:00:24
597000 -- (-1018.871) (-1019.442) (-1017.079) [-1018.959] * (-1017.088) (-1017.291) [-1015.974] (-1018.523) -- 0:00:24
597500 -- (-1021.362) [-1018.350] (-1018.974) (-1016.088) * (-1017.286) (-1018.011) [-1016.168] (-1018.140) -- 0:00:24
598000 -- (-1021.573) (-1017.413) (-1016.371) [-1016.025] * (-1018.563) (-1021.659) (-1019.468) [-1019.062] -- 0:00:24
598500 -- (-1017.240) (-1022.255) (-1016.591) [-1015.586] * (-1020.964) (-1020.634) [-1017.118] (-1017.260) -- 0:00:24
599000 -- [-1016.877] (-1022.152) (-1018.003) (-1015.784) * (-1020.232) [-1018.750] (-1017.203) (-1016.520) -- 0:00:24
599500 -- (-1018.024) (-1022.273) (-1016.006) [-1018.116] * (-1021.353) (-1018.539) (-1018.518) [-1016.594] -- 0:00:24
600000 -- (-1018.339) [-1016.322] (-1017.901) (-1017.408) * (-1018.211) (-1020.413) (-1020.640) [-1016.797] -- 0:00:24
Average standard deviation of split frequencies: 0.009156
600500 -- (-1023.039) (-1021.942) (-1023.465) [-1017.117] * [-1016.002] (-1018.505) (-1021.161) (-1018.184) -- 0:00:23
601000 -- [-1017.063] (-1020.619) (-1016.790) (-1017.885) * [-1017.465] (-1019.076) (-1021.648) (-1017.147) -- 0:00:23
601500 -- (-1017.750) (-1021.223) (-1017.813) [-1018.715] * (-1018.429) (-1022.898) [-1019.788] (-1017.209) -- 0:00:23
602000 -- (-1020.834) (-1024.328) (-1018.239) [-1018.009] * (-1021.966) (-1019.249) [-1021.904] (-1017.165) -- 0:00:23
602500 -- (-1016.610) [-1018.635] (-1018.648) (-1017.493) * (-1020.619) (-1019.536) [-1022.774] (-1017.542) -- 0:00:23
603000 -- (-1018.913) (-1016.370) (-1024.483) [-1016.410] * (-1020.331) [-1019.092] (-1018.020) (-1017.228) -- 0:00:23
603500 -- (-1019.023) (-1017.791) [-1016.430] (-1019.946) * (-1020.462) (-1018.488) [-1017.678] (-1016.086) -- 0:00:23
604000 -- [-1018.658] (-1018.609) (-1018.207) (-1018.390) * (-1017.750) [-1016.563] (-1018.580) (-1018.074) -- 0:00:23
604500 -- (-1020.190) [-1018.274] (-1020.057) (-1018.799) * (-1018.151) (-1015.641) [-1016.842] (-1018.988) -- 0:00:23
605000 -- (-1018.129) (-1019.075) (-1016.350) [-1023.505] * [-1017.012] (-1018.808) (-1018.858) (-1018.627) -- 0:00:23
Average standard deviation of split frequencies: 0.008903
605500 -- [-1017.427] (-1016.915) (-1017.343) (-1016.693) * (-1017.555) (-1018.722) [-1017.092] (-1017.490) -- 0:00:23
606000 -- (-1020.265) [-1015.910] (-1015.765) (-1019.332) * (-1019.505) (-1019.818) (-1018.577) [-1017.097] -- 0:00:24
606500 -- (-1018.828) (-1015.937) (-1021.505) [-1018.410] * (-1016.343) [-1017.976] (-1020.824) (-1016.080) -- 0:00:24
607000 -- [-1017.273] (-1018.984) (-1016.179) (-1018.804) * (-1019.068) (-1017.072) [-1016.901] (-1015.963) -- 0:00:23
607500 -- [-1017.345] (-1017.768) (-1015.437) (-1015.332) * [-1018.281] (-1017.025) (-1016.684) (-1018.334) -- 0:00:23
608000 -- [-1019.231] (-1016.109) (-1018.416) (-1017.417) * (-1016.956) (-1019.543) [-1016.091] (-1018.277) -- 0:00:23
608500 -- (-1018.757) [-1016.339] (-1019.041) (-1018.400) * [-1016.186] (-1020.625) (-1019.522) (-1018.285) -- 0:00:23
609000 -- (-1016.621) (-1022.080) (-1017.643) [-1018.638] * [-1016.187] (-1019.719) (-1018.335) (-1017.716) -- 0:00:23
609500 -- (-1017.413) [-1021.417] (-1022.638) (-1016.718) * [-1021.497] (-1017.378) (-1015.929) (-1016.249) -- 0:00:23
610000 -- (-1018.414) (-1018.518) (-1018.876) [-1017.123] * [-1018.045] (-1020.324) (-1019.866) (-1016.784) -- 0:00:23
Average standard deviation of split frequencies: 0.008154
610500 -- (-1017.972) (-1020.014) [-1016.354] (-1018.547) * (-1016.469) (-1022.931) (-1017.527) [-1015.719] -- 0:00:23
611000 -- (-1020.350) [-1017.427] (-1018.237) (-1016.888) * (-1015.818) (-1017.384) (-1018.030) [-1016.867] -- 0:00:23
611500 -- (-1017.988) (-1022.390) [-1016.720] (-1016.553) * [-1016.521] (-1016.980) (-1019.972) (-1017.161) -- 0:00:23
612000 -- [-1017.086] (-1020.664) (-1016.527) (-1016.561) * (-1019.935) (-1019.905) (-1019.686) [-1018.188] -- 0:00:23
612500 -- (-1017.472) [-1019.914] (-1017.939) (-1016.648) * (-1020.496) [-1017.030] (-1017.375) (-1019.594) -- 0:00:23
613000 -- [-1017.156] (-1017.404) (-1017.592) (-1016.593) * (-1023.411) (-1015.723) [-1016.345] (-1020.434) -- 0:00:23
613500 -- (-1018.973) (-1017.110) [-1018.837] (-1018.653) * (-1024.458) (-1017.409) (-1018.157) [-1015.559] -- 0:00:23
614000 -- (-1017.876) [-1015.640] (-1016.577) (-1018.872) * [-1016.183] (-1016.602) (-1021.429) (-1019.078) -- 0:00:23
614500 -- [-1018.558] (-1016.225) (-1017.548) (-1020.548) * [-1015.988] (-1017.841) (-1016.875) (-1023.205) -- 0:00:23
615000 -- (-1019.904) (-1017.945) [-1016.991] (-1018.334) * (-1019.983) (-1023.345) [-1015.708] (-1016.866) -- 0:00:23
Average standard deviation of split frequencies: 0.008035
615500 -- (-1020.759) [-1018.620] (-1016.623) (-1017.665) * [-1016.799] (-1021.106) (-1015.605) (-1015.936) -- 0:00:23
616000 -- (-1020.848) (-1016.290) [-1018.164] (-1018.718) * (-1017.760) (-1022.672) [-1016.147] (-1015.864) -- 0:00:23
616500 -- (-1019.212) (-1016.811) [-1019.966] (-1017.927) * [-1017.761] (-1017.395) (-1018.112) (-1017.955) -- 0:00:23
617000 -- (-1019.199) (-1015.777) [-1023.591] (-1017.606) * (-1017.994) [-1015.747] (-1017.380) (-1017.352) -- 0:00:22
617500 -- (-1016.349) (-1017.185) [-1019.906] (-1017.829) * (-1019.311) (-1018.053) [-1016.605] (-1021.406) -- 0:00:22
618000 -- (-1021.180) (-1022.660) (-1017.702) [-1017.911] * (-1016.942) (-1018.943) [-1021.016] (-1020.147) -- 0:00:22
618500 -- (-1018.873) (-1016.820) (-1021.032) [-1015.669] * [-1019.222] (-1021.285) (-1018.915) (-1020.223) -- 0:00:22
619000 -- [-1016.326] (-1020.024) (-1018.543) (-1015.640) * (-1017.534) [-1022.503] (-1016.022) (-1017.541) -- 0:00:22
619500 -- (-1018.443) [-1018.270] (-1019.716) (-1020.852) * (-1016.627) (-1016.027) [-1018.808] (-1018.330) -- 0:00:22
620000 -- [-1016.595] (-1017.686) (-1020.025) (-1017.931) * (-1019.379) [-1015.709] (-1017.439) (-1016.588) -- 0:00:22
Average standard deviation of split frequencies: 0.008307
620500 -- (-1016.406) [-1017.441] (-1020.846) (-1016.586) * [-1017.710] (-1015.610) (-1015.885) (-1020.769) -- 0:00:22
621000 -- (-1017.829) [-1017.690] (-1015.810) (-1017.642) * (-1016.996) (-1017.284) [-1017.600] (-1020.584) -- 0:00:22
621500 -- (-1020.506) (-1018.460) [-1016.864] (-1015.957) * (-1020.540) [-1017.868] (-1017.077) (-1019.337) -- 0:00:22
622000 -- (-1016.696) (-1016.861) (-1019.513) [-1016.353] * (-1016.482) [-1015.988] (-1019.309) (-1018.668) -- 0:00:22
622500 -- (-1016.915) (-1015.578) (-1020.446) [-1017.197] * (-1015.516) [-1018.061] (-1018.898) (-1018.162) -- 0:00:23
623000 -- (-1017.691) (-1016.763) [-1020.549] (-1019.444) * (-1018.156) (-1018.339) [-1018.952] (-1019.068) -- 0:00:22
623500 -- (-1019.658) [-1016.179] (-1020.615) (-1019.320) * (-1017.478) [-1017.047] (-1016.963) (-1017.598) -- 0:00:22
624000 -- [-1017.391] (-1016.224) (-1016.980) (-1018.497) * (-1018.259) (-1017.776) [-1016.826] (-1016.863) -- 0:00:22
624500 -- (-1019.302) (-1017.583) (-1016.226) [-1017.484] * (-1017.239) (-1016.377) [-1016.438] (-1017.798) -- 0:00:22
625000 -- (-1024.743) (-1019.595) (-1018.091) [-1021.141] * (-1019.220) [-1016.534] (-1016.631) (-1021.982) -- 0:00:22
Average standard deviation of split frequencies: 0.007813
625500 -- [-1018.105] (-1017.958) (-1020.872) (-1020.233) * [-1015.469] (-1018.576) (-1017.698) (-1017.059) -- 0:00:22
626000 -- (-1017.975) [-1017.886] (-1023.070) (-1019.029) * (-1023.047) (-1017.147) [-1016.018] (-1020.211) -- 0:00:22
626500 -- (-1017.868) [-1015.926] (-1017.819) (-1015.749) * (-1016.768) [-1019.474] (-1016.285) (-1018.845) -- 0:00:22
627000 -- (-1016.991) (-1017.151) (-1019.352) [-1015.910] * (-1017.410) (-1017.550) [-1016.150] (-1015.870) -- 0:00:22
627500 -- (-1017.660) (-1018.787) [-1018.427] (-1015.752) * (-1017.720) (-1017.715) (-1019.069) [-1017.455] -- 0:00:22
628000 -- (-1016.555) (-1020.333) [-1017.008] (-1015.752) * [-1016.760] (-1019.749) (-1016.337) (-1019.308) -- 0:00:22
628500 -- [-1018.965] (-1019.180) (-1017.843) (-1019.840) * (-1019.023) [-1016.881] (-1015.525) (-1025.159) -- 0:00:22
629000 -- [-1016.329] (-1018.004) (-1019.832) (-1020.298) * [-1018.694] (-1016.770) (-1024.728) (-1023.250) -- 0:00:22
629500 -- (-1016.157) [-1020.328] (-1022.402) (-1016.228) * (-1015.711) [-1015.626] (-1016.852) (-1019.530) -- 0:00:22
630000 -- (-1016.317) [-1017.278] (-1022.650) (-1016.600) * (-1020.177) [-1017.191] (-1019.741) (-1015.670) -- 0:00:22
Average standard deviation of split frequencies: 0.007624
630500 -- [-1016.542] (-1017.938) (-1016.313) (-1017.296) * (-1019.963) (-1017.535) (-1018.675) [-1017.349] -- 0:00:22
631000 -- (-1015.683) (-1017.796) [-1017.902] (-1017.280) * (-1017.854) (-1017.771) [-1017.847] (-1018.021) -- 0:00:22
631500 -- (-1016.704) (-1019.133) [-1017.304] (-1016.717) * (-1017.854) (-1017.464) [-1019.532] (-1016.589) -- 0:00:22
632000 -- (-1021.447) (-1017.512) (-1018.070) [-1016.730] * (-1017.710) [-1016.526] (-1021.958) (-1022.884) -- 0:00:22
632500 -- (-1017.446) [-1016.934] (-1022.451) (-1016.708) * [-1016.559] (-1017.262) (-1017.798) (-1017.563) -- 0:00:22
633000 -- (-1018.487) [-1016.633] (-1021.903) (-1019.251) * (-1017.773) (-1018.702) (-1018.833) [-1016.888] -- 0:00:22
633500 -- (-1018.822) [-1017.223] (-1017.791) (-1019.371) * [-1017.635] (-1016.415) (-1017.421) (-1018.707) -- 0:00:21
634000 -- (-1018.721) (-1017.599) (-1017.165) [-1019.061] * [-1017.026] (-1017.833) (-1016.636) (-1016.764) -- 0:00:21
634500 -- (-1018.481) [-1017.987] (-1017.572) (-1015.726) * (-1018.181) [-1017.705] (-1017.122) (-1016.685) -- 0:00:21
635000 -- (-1017.807) [-1017.987] (-1017.657) (-1019.362) * [-1017.330] (-1017.116) (-1016.500) (-1019.531) -- 0:00:21
Average standard deviation of split frequencies: 0.007313
635500 -- (-1015.923) [-1016.354] (-1020.655) (-1017.306) * (-1020.133) (-1021.428) [-1017.245] (-1015.604) -- 0:00:21
636000 -- (-1016.108) (-1016.889) [-1016.432] (-1019.784) * (-1016.189) (-1018.744) (-1016.016) [-1020.931] -- 0:00:21
636500 -- (-1016.321) (-1016.125) [-1017.325] (-1016.155) * (-1016.327) (-1020.549) (-1018.673) [-1020.496] -- 0:00:21
637000 -- (-1020.420) (-1016.392) [-1016.979] (-1018.548) * [-1021.756] (-1017.267) (-1019.012) (-1017.860) -- 0:00:21
637500 -- [-1016.384] (-1020.619) (-1016.608) (-1023.467) * (-1016.129) [-1020.828] (-1017.603) (-1021.538) -- 0:00:21
638000 -- (-1016.392) (-1018.076) (-1021.567) [-1018.016] * (-1016.402) (-1022.059) (-1017.593) [-1018.188] -- 0:00:21
638500 -- [-1016.715] (-1019.097) (-1018.267) (-1016.629) * (-1018.940) [-1018.962] (-1019.033) (-1015.847) -- 0:00:21
639000 -- (-1018.915) (-1016.613) [-1016.240] (-1018.311) * (-1018.522) (-1016.337) (-1020.499) [-1018.446] -- 0:00:22
639500 -- (-1016.970) (-1017.489) [-1018.151] (-1018.716) * (-1017.471) (-1020.551) (-1021.215) [-1019.539] -- 0:00:21
640000 -- [-1018.022] (-1017.823) (-1016.465) (-1018.260) * [-1018.466] (-1022.829) (-1018.144) (-1017.593) -- 0:00:21
Average standard deviation of split frequencies: 0.007603
640500 -- (-1018.327) [-1015.460] (-1021.948) (-1016.207) * (-1018.782) (-1017.725) [-1018.419] (-1016.007) -- 0:00:21
641000 -- [-1016.710] (-1016.636) (-1016.445) (-1016.949) * (-1018.733) [-1017.688] (-1017.944) (-1015.876) -- 0:00:21
641500 -- (-1016.147) (-1018.675) (-1020.241) [-1021.011] * (-1018.599) (-1018.453) [-1018.185] (-1017.262) -- 0:00:21
642000 -- [-1015.479] (-1017.109) (-1018.664) (-1016.644) * [-1018.469] (-1016.667) (-1024.896) (-1017.195) -- 0:00:21
642500 -- [-1017.761] (-1016.701) (-1016.506) (-1017.959) * [-1019.337] (-1017.795) (-1018.603) (-1018.872) -- 0:00:21
643000 -- (-1016.491) [-1016.328] (-1018.703) (-1017.750) * (-1016.284) (-1019.740) [-1019.457] (-1018.348) -- 0:00:21
643500 -- (-1016.859) [-1017.776] (-1019.557) (-1016.340) * [-1016.030] (-1016.693) (-1018.781) (-1018.995) -- 0:00:21
644000 -- [-1016.598] (-1018.532) (-1019.441) (-1016.783) * (-1016.719) (-1018.339) [-1017.404] (-1018.505) -- 0:00:21
644500 -- [-1016.520] (-1019.986) (-1019.891) (-1017.273) * (-1017.093) [-1017.210] (-1016.750) (-1018.878) -- 0:00:21
645000 -- (-1019.435) (-1017.244) [-1016.588] (-1020.840) * (-1018.437) (-1017.940) [-1018.879] (-1016.374) -- 0:00:21
Average standard deviation of split frequencies: 0.007297
645500 -- [-1016.583] (-1017.547) (-1017.872) (-1019.791) * [-1018.240] (-1016.947) (-1019.214) (-1018.185) -- 0:00:21
646000 -- (-1017.590) [-1017.212] (-1017.102) (-1016.527) * [-1017.402] (-1015.894) (-1017.899) (-1018.560) -- 0:00:21
646500 -- [-1016.384] (-1023.261) (-1021.460) (-1016.583) * (-1021.900) [-1016.917] (-1017.413) (-1017.590) -- 0:00:21
647000 -- [-1018.169] (-1021.867) (-1019.902) (-1019.831) * [-1017.081] (-1016.104) (-1020.541) (-1017.293) -- 0:00:21
647500 -- (-1018.739) (-1023.278) (-1023.581) [-1016.160] * (-1015.514) [-1016.830] (-1019.635) (-1017.678) -- 0:00:21
648000 -- (-1019.826) (-1017.335) (-1018.169) [-1016.571] * [-1016.759] (-1015.774) (-1018.527) (-1018.613) -- 0:00:21
648500 -- (-1020.455) (-1016.664) [-1019.095] (-1020.056) * (-1017.943) (-1015.907) (-1017.122) [-1016.584] -- 0:00:21
649000 -- (-1022.139) (-1018.125) (-1018.712) [-1017.203] * (-1020.934) [-1016.430] (-1018.021) (-1017.242) -- 0:00:21
649500 -- (-1016.183) (-1017.613) [-1017.022] (-1018.369) * [-1016.929] (-1019.761) (-1016.167) (-1016.231) -- 0:00:21
650000 -- [-1016.227] (-1018.200) (-1018.758) (-1016.377) * (-1017.270) (-1017.487) [-1015.947] (-1017.568) -- 0:00:21
Average standard deviation of split frequencies: 0.007607
650500 -- (-1018.152) (-1015.847) [-1018.559] (-1020.475) * (-1017.501) (-1016.900) (-1016.634) [-1016.602] -- 0:00:20
651000 -- (-1017.103) [-1017.406] (-1016.968) (-1018.913) * [-1015.722] (-1015.572) (-1019.442) (-1016.420) -- 0:00:20
651500 -- (-1017.123) (-1016.448) (-1018.150) [-1019.426] * (-1017.362) (-1016.640) [-1016.948] (-1017.049) -- 0:00:20
652000 -- (-1020.803) (-1018.562) [-1020.040] (-1020.404) * (-1019.436) [-1016.920] (-1016.539) (-1020.304) -- 0:00:20
652500 -- (-1022.516) [-1017.966] (-1020.021) (-1027.440) * [-1015.812] (-1017.024) (-1016.912) (-1017.017) -- 0:00:20
653000 -- (-1016.920) [-1019.293] (-1020.490) (-1018.373) * (-1017.883) [-1015.631] (-1016.913) (-1017.519) -- 0:00:20
653500 -- [-1019.686] (-1017.472) (-1020.837) (-1024.955) * (-1017.330) (-1019.419) [-1017.419] (-1016.965) -- 0:00:20
654000 -- [-1017.443] (-1016.035) (-1021.481) (-1021.434) * [-1016.334] (-1028.190) (-1016.389) (-1020.019) -- 0:00:20
654500 -- (-1016.086) (-1017.718) (-1017.396) [-1016.253] * (-1016.905) [-1019.588] (-1016.317) (-1020.606) -- 0:00:20
655000 -- (-1017.038) (-1019.816) [-1016.517] (-1018.092) * (-1019.647) (-1018.767) [-1015.456] (-1020.246) -- 0:00:20
Average standard deviation of split frequencies: 0.007231
655500 -- (-1017.024) (-1020.595) (-1016.209) [-1016.668] * (-1015.669) (-1020.033) (-1016.231) [-1020.320] -- 0:00:21
656000 -- (-1016.478) (-1017.001) [-1018.908] (-1016.479) * [-1017.468] (-1017.720) (-1018.425) (-1018.940) -- 0:00:20
656500 -- (-1018.676) (-1018.572) (-1016.285) [-1018.748] * [-1019.404] (-1017.505) (-1016.672) (-1022.461) -- 0:00:20
657000 -- (-1018.868) (-1018.511) [-1017.281] (-1020.688) * (-1018.468) [-1016.551] (-1022.805) (-1020.299) -- 0:00:20
657500 -- (-1019.814) (-1016.463) [-1016.988] (-1020.570) * (-1021.877) [-1016.725] (-1020.693) (-1021.686) -- 0:00:20
658000 -- (-1017.527) [-1019.674] (-1017.802) (-1019.761) * (-1019.667) [-1018.688] (-1017.653) (-1020.763) -- 0:00:20
658500 -- [-1017.031] (-1016.235) (-1019.176) (-1019.841) * (-1016.420) (-1017.333) [-1018.280] (-1022.706) -- 0:00:20
659000 -- [-1018.676] (-1018.083) (-1017.629) (-1016.963) * [-1017.756] (-1017.549) (-1017.068) (-1015.917) -- 0:00:20
659500 -- (-1016.152) [-1019.527] (-1017.026) (-1016.530) * (-1016.599) [-1017.204] (-1016.051) (-1015.709) -- 0:00:20
660000 -- [-1021.719] (-1018.292) (-1020.312) (-1016.685) * [-1018.369] (-1016.307) (-1016.228) (-1016.023) -- 0:00:20
Average standard deviation of split frequencies: 0.007326
660500 -- (-1025.077) (-1018.474) [-1016.438] (-1015.848) * (-1018.148) [-1017.528] (-1017.094) (-1016.095) -- 0:00:20
661000 -- [-1018.207] (-1019.102) (-1017.042) (-1016.681) * (-1016.396) [-1018.383] (-1017.469) (-1018.470) -- 0:00:20
661500 -- [-1017.753] (-1017.453) (-1018.823) (-1018.091) * (-1018.045) (-1017.785) [-1017.135] (-1019.796) -- 0:00:20
662000 -- (-1017.397) [-1016.929] (-1017.767) (-1017.303) * (-1017.165) [-1018.488] (-1016.170) (-1016.889) -- 0:00:20
662500 -- (-1017.403) (-1016.506) (-1017.744) [-1016.996] * (-1016.925) (-1018.150) [-1017.043] (-1018.004) -- 0:00:20
663000 -- (-1016.288) (-1018.497) [-1017.421] (-1019.194) * (-1016.822) (-1020.720) [-1016.196] (-1019.965) -- 0:00:20
663500 -- (-1018.150) (-1016.143) (-1015.644) [-1018.003] * [-1018.789] (-1018.236) (-1020.175) (-1017.921) -- 0:00:20
664000 -- (-1017.695) (-1017.161) (-1016.318) [-1018.950] * [-1016.201] (-1019.401) (-1015.822) (-1019.648) -- 0:00:20
664500 -- (-1019.428) (-1021.952) (-1019.271) [-1017.279] * (-1016.807) [-1019.215] (-1016.228) (-1016.200) -- 0:00:20
665000 -- (-1017.788) (-1017.472) [-1016.795] (-1017.633) * [-1015.598] (-1019.732) (-1018.942) (-1016.340) -- 0:00:20
Average standard deviation of split frequencies: 0.007122
665500 -- (-1017.136) [-1016.195] (-1017.950) (-1019.700) * (-1017.652) (-1017.560) (-1019.221) [-1016.984] -- 0:00:20
666000 -- (-1017.113) (-1016.140) [-1016.494] (-1016.855) * (-1018.865) [-1016.750] (-1019.524) (-1016.542) -- 0:00:20
666500 -- [-1019.085] (-1017.457) (-1020.375) (-1018.135) * (-1017.061) (-1018.198) [-1017.646] (-1016.497) -- 0:00:20
667000 -- (-1017.026) (-1018.504) [-1021.453] (-1017.776) * (-1019.197) (-1020.913) [-1017.221] (-1017.466) -- 0:00:19
667500 -- (-1015.927) [-1019.006] (-1017.397) (-1016.865) * (-1021.830) (-1019.917) (-1020.155) [-1017.994] -- 0:00:19
668000 -- [-1015.524] (-1015.668) (-1015.677) (-1016.522) * (-1021.963) (-1018.415) [-1017.298] (-1016.367) -- 0:00:19
668500 -- (-1016.438) [-1021.084] (-1015.490) (-1018.880) * [-1019.100] (-1015.734) (-1016.669) (-1019.167) -- 0:00:19
669000 -- (-1019.061) [-1018.005] (-1017.556) (-1016.564) * (-1018.404) (-1015.772) (-1018.539) [-1018.778] -- 0:00:19
669500 -- (-1018.693) [-1015.665] (-1016.411) (-1015.961) * (-1019.912) (-1017.534) (-1017.263) [-1018.244] -- 0:00:19
670000 -- (-1019.635) (-1017.293) [-1018.049] (-1017.180) * (-1019.549) (-1018.108) (-1016.626) [-1018.930] -- 0:00:19
Average standard deviation of split frequencies: 0.007117
670500 -- (-1016.770) [-1017.318] (-1016.964) (-1016.158) * (-1016.795) (-1021.982) [-1019.305] (-1017.701) -- 0:00:19
671000 -- (-1020.067) (-1017.614) [-1020.056] (-1020.006) * (-1018.366) (-1020.198) [-1018.251] (-1017.684) -- 0:00:19
671500 -- [-1018.984] (-1017.036) (-1020.685) (-1018.636) * (-1017.954) (-1019.398) (-1017.985) [-1018.461] -- 0:00:19
672000 -- (-1018.406) [-1017.061] (-1021.223) (-1019.633) * [-1017.120] (-1018.900) (-1016.270) (-1018.918) -- 0:00:20
672500 -- [-1017.092] (-1021.824) (-1017.084) (-1017.609) * (-1016.224) (-1018.134) [-1016.726] (-1017.997) -- 0:00:19
673000 -- (-1017.738) [-1018.602] (-1017.180) (-1021.392) * (-1017.408) [-1017.950] (-1016.810) (-1018.872) -- 0:00:19
673500 -- (-1017.520) (-1015.879) [-1019.051] (-1017.552) * (-1018.517) [-1018.855] (-1022.733) (-1017.990) -- 0:00:19
674000 -- (-1016.544) (-1017.140) (-1018.384) [-1016.904] * (-1017.480) (-1017.971) (-1026.970) [-1018.804] -- 0:00:19
674500 -- (-1018.571) (-1019.844) [-1015.956] (-1016.862) * [-1015.519] (-1018.130) (-1016.397) (-1018.826) -- 0:00:19
675000 -- (-1020.055) (-1021.575) [-1015.988] (-1016.101) * (-1016.159) [-1020.668] (-1019.002) (-1016.465) -- 0:00:19
Average standard deviation of split frequencies: 0.007540
675500 -- (-1016.338) (-1019.560) [-1016.826] (-1017.452) * [-1016.862] (-1017.453) (-1016.857) (-1017.489) -- 0:00:19
676000 -- [-1017.099] (-1016.272) (-1017.467) (-1020.536) * [-1016.305] (-1017.150) (-1016.714) (-1015.406) -- 0:00:19
676500 -- (-1017.511) (-1017.108) (-1020.193) [-1016.097] * (-1016.702) (-1021.216) [-1018.227] (-1016.885) -- 0:00:19
677000 -- (-1017.240) (-1016.412) (-1016.697) [-1016.493] * [-1017.375] (-1017.880) (-1017.984) (-1017.615) -- 0:00:19
677500 -- (-1016.174) [-1017.025] (-1016.265) (-1017.317) * [-1016.542] (-1018.961) (-1019.033) (-1016.499) -- 0:00:19
678000 -- [-1017.645] (-1018.320) (-1016.129) (-1017.662) * (-1016.598) (-1020.593) (-1021.612) [-1019.023] -- 0:00:19
678500 -- [-1017.387] (-1018.486) (-1019.000) (-1016.608) * (-1019.967) [-1019.211] (-1021.293) (-1017.044) -- 0:00:19
679000 -- (-1016.494) (-1019.902) [-1020.057] (-1015.375) * (-1024.795) (-1017.195) (-1018.952) [-1017.018] -- 0:00:19
679500 -- (-1016.258) (-1016.648) [-1019.987] (-1016.500) * (-1019.003) [-1017.390] (-1019.697) (-1017.314) -- 0:00:19
680000 -- (-1019.860) (-1019.624) (-1016.210) [-1015.951] * (-1019.723) [-1020.259] (-1017.400) (-1016.353) -- 0:00:19
Average standard deviation of split frequencies: 0.007575
680500 -- (-1016.739) [-1018.362] (-1020.789) (-1016.939) * (-1016.681) [-1016.517] (-1017.007) (-1015.760) -- 0:00:19
681000 -- (-1015.793) [-1019.035] (-1015.755) (-1018.469) * (-1016.549) (-1016.195) [-1016.136] (-1017.405) -- 0:00:19
681500 -- (-1020.400) [-1016.954] (-1017.351) (-1016.189) * [-1016.938] (-1017.017) (-1022.150) (-1016.938) -- 0:00:19
682000 -- (-1017.879) (-1016.785) [-1016.849] (-1016.174) * (-1017.525) [-1016.666] (-1019.401) (-1018.035) -- 0:00:19
682500 -- (-1017.123) (-1017.982) (-1020.134) [-1016.243] * [-1018.983] (-1019.862) (-1019.069) (-1018.551) -- 0:00:19
683000 -- (-1018.486) [-1016.664] (-1017.028) (-1015.642) * (-1015.940) (-1021.798) (-1021.261) [-1015.918] -- 0:00:19
683500 -- (-1018.512) (-1016.244) [-1015.928] (-1017.273) * [-1020.709] (-1017.744) (-1019.283) (-1015.617) -- 0:00:18
684000 -- [-1016.578] (-1018.749) (-1015.808) (-1018.083) * (-1021.947) (-1018.780) (-1018.754) [-1015.940] -- 0:00:18
684500 -- (-1019.187) [-1015.760] (-1015.961) (-1017.387) * (-1018.651) (-1020.652) [-1017.488] (-1018.393) -- 0:00:18
685000 -- (-1016.472) (-1017.933) [-1016.879] (-1019.579) * (-1019.809) [-1015.423] (-1016.210) (-1017.434) -- 0:00:18
Average standard deviation of split frequencies: 0.008074
685500 -- (-1015.781) (-1020.604) (-1016.585) [-1018.020] * [-1019.281] (-1019.227) (-1020.105) (-1016.519) -- 0:00:18
686000 -- (-1017.515) (-1020.565) (-1018.072) [-1016.778] * (-1018.790) (-1019.399) (-1016.657) [-1016.851] -- 0:00:18
686500 -- (-1017.958) (-1019.221) (-1018.928) [-1016.452] * [-1018.854] (-1018.481) (-1018.196) (-1019.578) -- 0:00:18
687000 -- [-1016.315] (-1016.873) (-1022.622) (-1015.856) * (-1018.387) [-1015.933] (-1017.509) (-1019.718) -- 0:00:18
687500 -- [-1015.710] (-1017.511) (-1023.707) (-1017.955) * [-1017.100] (-1018.012) (-1020.716) (-1019.466) -- 0:00:18
688000 -- (-1017.105) (-1016.645) [-1018.168] (-1016.829) * (-1017.068) (-1017.120) (-1016.940) [-1020.187] -- 0:00:18
688500 -- [-1018.750] (-1016.436) (-1017.874) (-1016.878) * (-1016.725) (-1019.379) [-1016.224] (-1018.917) -- 0:00:19
689000 -- (-1016.033) (-1017.075) [-1019.882] (-1017.129) * (-1018.434) (-1018.655) (-1018.803) [-1020.423] -- 0:00:18
689500 -- (-1018.437) (-1018.928) [-1017.186] (-1018.047) * (-1018.620) (-1018.361) [-1018.213] (-1017.721) -- 0:00:18
690000 -- [-1017.368] (-1019.972) (-1017.282) (-1017.779) * (-1017.279) [-1018.753] (-1016.390) (-1016.751) -- 0:00:18
Average standard deviation of split frequencies: 0.007849
690500 -- (-1016.227) (-1017.004) [-1016.192] (-1016.835) * (-1018.874) (-1017.824) [-1015.991] (-1017.595) -- 0:00:18
691000 -- (-1015.655) (-1015.750) [-1016.619] (-1015.460) * [-1017.470] (-1025.774) (-1020.820) (-1016.409) -- 0:00:18
691500 -- (-1019.602) (-1016.094) [-1017.425] (-1019.967) * (-1018.525) [-1016.794] (-1017.817) (-1016.735) -- 0:00:18
692000 -- (-1016.203) (-1016.073) (-1017.327) [-1018.211] * (-1016.208) [-1016.430] (-1020.142) (-1016.392) -- 0:00:18
692500 -- (-1017.053) (-1017.665) [-1016.273] (-1018.740) * (-1019.735) [-1015.696] (-1015.969) (-1017.375) -- 0:00:18
693000 -- (-1025.474) (-1019.200) (-1016.112) [-1016.377] * (-1017.740) [-1015.887] (-1017.384) (-1016.966) -- 0:00:18
693500 -- (-1020.926) (-1019.004) [-1018.372] (-1017.994) * (-1021.928) (-1023.113) [-1015.610] (-1015.813) -- 0:00:18
694000 -- (-1017.018) (-1021.974) (-1017.747) [-1022.324] * [-1017.100] (-1018.842) (-1017.231) (-1020.852) -- 0:00:18
694500 -- (-1017.676) (-1019.318) [-1017.174] (-1019.353) * [-1017.075] (-1019.871) (-1022.111) (-1017.263) -- 0:00:18
695000 -- (-1017.777) (-1020.340) [-1016.861] (-1017.876) * (-1019.397) (-1016.936) (-1019.255) [-1017.267] -- 0:00:18
Average standard deviation of split frequencies: 0.008043
695500 -- (-1016.914) (-1019.472) (-1018.880) [-1018.172] * [-1019.915] (-1017.321) (-1018.455) (-1016.343) -- 0:00:18
696000 -- [-1016.794] (-1016.589) (-1016.607) (-1019.040) * (-1024.948) (-1019.165) [-1017.276] (-1017.689) -- 0:00:18
696500 -- (-1021.952) (-1016.353) [-1017.805] (-1019.130) * (-1020.883) (-1016.725) [-1016.307] (-1019.246) -- 0:00:18
697000 -- (-1019.711) [-1017.377] (-1019.227) (-1017.562) * (-1021.092) [-1016.574] (-1017.261) (-1017.861) -- 0:00:18
697500 -- (-1019.736) (-1016.598) (-1015.770) [-1019.519] * (-1019.742) (-1018.002) (-1017.887) [-1017.676] -- 0:00:18
698000 -- (-1016.490) (-1016.213) [-1016.922] (-1016.934) * (-1015.781) (-1015.707) [-1018.963] (-1016.358) -- 0:00:18
698500 -- [-1015.782] (-1016.327) (-1019.034) (-1023.040) * [-1018.084] (-1016.108) (-1018.651) (-1016.663) -- 0:00:18
699000 -- (-1016.036) (-1016.626) (-1021.666) [-1019.359] * (-1017.541) (-1019.082) [-1018.626] (-1017.732) -- 0:00:18
699500 -- (-1016.276) (-1016.105) (-1020.130) [-1017.042] * [-1016.709] (-1016.635) (-1019.080) (-1018.162) -- 0:00:18
700000 -- (-1019.887) (-1017.730) (-1023.578) [-1018.982] * (-1020.650) (-1019.234) (-1021.836) [-1017.090] -- 0:00:18
Average standard deviation of split frequencies: 0.008158
700500 -- (-1021.333) (-1017.776) (-1019.762) [-1015.901] * [-1019.259] (-1016.226) (-1015.990) (-1016.529) -- 0:00:17
701000 -- (-1016.943) (-1016.958) (-1019.917) [-1017.335] * (-1016.919) (-1016.261) (-1018.422) [-1019.380] -- 0:00:17
701500 -- (-1019.041) [-1018.998] (-1016.225) (-1019.573) * (-1016.118) (-1018.981) [-1017.827] (-1016.938) -- 0:00:17
702000 -- [-1017.125] (-1019.884) (-1017.945) (-1017.901) * (-1018.343) (-1019.065) [-1015.946] (-1017.568) -- 0:00:17
702500 -- (-1017.018) (-1020.529) (-1015.647) [-1017.973] * (-1019.794) (-1018.483) [-1019.377] (-1016.555) -- 0:00:17
703000 -- [-1017.044] (-1016.266) (-1015.917) (-1023.030) * (-1018.879) (-1022.837) (-1020.530) [-1019.331] -- 0:00:17
703500 -- [-1017.138] (-1016.496) (-1015.854) (-1020.965) * (-1021.073) (-1020.595) [-1017.245] (-1016.570) -- 0:00:17
704000 -- (-1018.390) (-1017.603) (-1017.790) [-1016.698] * (-1017.656) (-1020.340) (-1018.925) [-1017.068] -- 0:00:17
704500 -- [-1019.357] (-1016.895) (-1016.921) (-1017.128) * (-1017.812) (-1016.982) (-1016.668) [-1018.008] -- 0:00:17
705000 -- (-1018.203) [-1019.158] (-1017.108) (-1016.805) * (-1018.177) [-1018.574] (-1017.248) (-1016.791) -- 0:00:17
Average standard deviation of split frequencies: 0.008305
705500 -- (-1018.178) [-1016.846] (-1019.245) (-1016.790) * (-1016.424) (-1018.983) (-1021.129) [-1016.774] -- 0:00:17
706000 -- (-1015.715) (-1021.300) (-1018.696) [-1018.673] * (-1016.146) (-1017.818) [-1016.770] (-1018.210) -- 0:00:17
706500 -- (-1016.669) (-1017.873) [-1018.339] (-1017.321) * (-1016.297) (-1015.391) (-1016.378) [-1016.288] -- 0:00:17
707000 -- (-1017.817) [-1017.550] (-1017.193) (-1021.331) * (-1019.110) [-1017.935] (-1019.779) (-1017.723) -- 0:00:17
707500 -- [-1017.879] (-1017.377) (-1015.674) (-1021.167) * (-1019.147) (-1019.296) [-1016.507] (-1017.261) -- 0:00:17
708000 -- [-1018.190] (-1020.685) (-1016.080) (-1018.045) * (-1018.510) (-1017.604) [-1016.755] (-1017.188) -- 0:00:17
708500 -- (-1018.385) (-1018.973) (-1015.791) [-1020.196] * (-1017.001) [-1019.580] (-1018.866) (-1020.354) -- 0:00:17
709000 -- (-1021.028) (-1018.041) (-1016.243) [-1015.720] * (-1020.811) (-1019.154) (-1021.916) [-1017.955] -- 0:00:17
709500 -- (-1018.057) (-1017.937) [-1016.891] (-1015.743) * (-1026.898) (-1018.462) (-1017.322) [-1018.125] -- 0:00:17
710000 -- (-1016.601) (-1016.585) [-1018.863] (-1016.382) * (-1024.736) (-1017.348) (-1019.572) [-1021.037] -- 0:00:17
Average standard deviation of split frequencies: 0.008499
710500 -- (-1016.636) (-1019.688) (-1020.466) [-1015.931] * (-1023.160) [-1017.284] (-1017.401) (-1018.628) -- 0:00:17
711000 -- (-1016.369) (-1019.818) [-1016.327] (-1016.984) * (-1021.246) (-1016.532) (-1017.825) [-1017.103] -- 0:00:17
711500 -- (-1022.332) (-1018.303) [-1018.550] (-1017.455) * (-1021.082) (-1016.281) [-1016.773] (-1018.381) -- 0:00:17
712000 -- [-1019.994] (-1016.465) (-1018.020) (-1017.952) * (-1016.606) (-1017.866) [-1016.017] (-1018.860) -- 0:00:17
712500 -- (-1017.737) [-1020.461] (-1016.692) (-1021.019) * (-1017.905) (-1016.570) (-1018.530) [-1017.508] -- 0:00:17
713000 -- (-1017.414) (-1016.580) (-1017.966) [-1019.248] * (-1017.605) (-1015.789) (-1020.449) [-1017.266] -- 0:00:17
713500 -- (-1017.088) (-1016.182) (-1016.188) [-1016.619] * [-1017.817] (-1017.433) (-1018.247) (-1018.127) -- 0:00:17
714000 -- (-1017.278) [-1016.516] (-1017.147) (-1016.651) * (-1019.478) (-1019.332) (-1018.317) [-1017.647] -- 0:00:17
714500 -- (-1021.636) (-1018.937) [-1017.474] (-1020.445) * (-1018.468) [-1017.868] (-1019.951) (-1020.319) -- 0:00:17
715000 -- (-1018.708) (-1019.528) [-1016.319] (-1016.853) * (-1017.559) (-1019.562) [-1020.177] (-1017.828) -- 0:00:17
Average standard deviation of split frequencies: 0.008998
715500 -- [-1017.265] (-1017.894) (-1017.819) (-1018.297) * (-1018.808) (-1018.499) (-1018.817) [-1018.688] -- 0:00:17
716000 -- (-1016.899) (-1017.498) [-1017.589] (-1021.117) * (-1019.012) (-1022.102) [-1018.781] (-1017.455) -- 0:00:17
716500 -- [-1017.074] (-1017.808) (-1016.954) (-1019.177) * [-1017.221] (-1016.746) (-1022.130) (-1016.025) -- 0:00:17
717000 -- [-1016.341] (-1018.787) (-1023.027) (-1019.400) * [-1016.815] (-1018.777) (-1017.152) (-1019.641) -- 0:00:16
717500 -- [-1016.604] (-1017.022) (-1019.456) (-1017.924) * (-1015.936) [-1017.694] (-1020.082) (-1017.342) -- 0:00:16
718000 -- (-1015.988) (-1017.270) (-1018.439) [-1022.746] * (-1016.753) [-1018.004] (-1016.394) (-1017.367) -- 0:00:16
718500 -- [-1015.993] (-1017.222) (-1017.097) (-1021.158) * (-1016.106) (-1016.844) [-1016.211] (-1016.788) -- 0:00:16
719000 -- (-1020.171) (-1017.939) [-1017.812] (-1018.121) * (-1019.212) (-1018.154) (-1018.588) [-1022.084] -- 0:00:16
719500 -- (-1021.673) [-1017.701] (-1016.406) (-1018.811) * (-1016.271) (-1017.932) [-1016.212] (-1019.137) -- 0:00:16
720000 -- [-1017.034] (-1018.286) (-1025.804) (-1016.817) * (-1018.298) (-1017.418) [-1018.299] (-1018.366) -- 0:00:16
Average standard deviation of split frequencies: 0.008852
720500 -- (-1018.963) (-1018.190) (-1019.829) [-1016.982] * (-1018.681) [-1019.005] (-1017.940) (-1019.449) -- 0:00:16
721000 -- (-1017.987) (-1018.096) (-1020.256) [-1017.338] * (-1019.660) (-1019.128) [-1016.640] (-1016.587) -- 0:00:17
721500 -- (-1019.010) [-1019.575] (-1020.175) (-1016.849) * (-1016.837) [-1016.169] (-1019.826) (-1017.707) -- 0:00:16
722000 -- (-1017.882) (-1019.619) [-1015.885] (-1016.291) * (-1016.893) [-1019.035] (-1017.765) (-1016.082) -- 0:00:16
722500 -- [-1016.692] (-1020.319) (-1017.431) (-1015.774) * (-1016.095) (-1016.756) (-1018.037) [-1019.612] -- 0:00:16
723000 -- (-1020.470) (-1018.749) [-1016.801] (-1017.627) * [-1016.248] (-1017.300) (-1018.850) (-1016.095) -- 0:00:16
723500 -- (-1017.757) (-1016.928) [-1018.555] (-1020.109) * (-1019.953) (-1021.157) [-1016.064] (-1016.502) -- 0:00:16
724000 -- (-1022.478) (-1019.347) [-1016.335] (-1018.895) * [-1018.770] (-1019.691) (-1016.766) (-1019.655) -- 0:00:16
724500 -- [-1019.959] (-1016.734) (-1019.336) (-1020.853) * (-1016.890) (-1016.965) [-1019.676] (-1018.793) -- 0:00:16
725000 -- (-1016.552) [-1017.934] (-1016.493) (-1021.768) * (-1015.940) (-1017.025) [-1017.226] (-1018.611) -- 0:00:16
Average standard deviation of split frequencies: 0.009220
725500 -- [-1015.530] (-1019.252) (-1016.979) (-1017.980) * [-1019.413] (-1017.217) (-1016.783) (-1017.578) -- 0:00:16
726000 -- [-1017.433] (-1017.638) (-1015.838) (-1018.045) * (-1018.812) (-1017.775) [-1016.800] (-1021.795) -- 0:00:16
726500 -- (-1019.697) (-1020.967) [-1016.821] (-1017.651) * (-1019.317) (-1017.305) [-1018.023] (-1018.916) -- 0:00:16
727000 -- (-1019.366) (-1016.787) [-1016.851] (-1018.982) * (-1016.512) (-1016.691) (-1016.224) [-1016.915] -- 0:00:16
727500 -- [-1016.844] (-1017.964) (-1015.395) (-1020.385) * (-1016.714) (-1016.380) [-1016.536] (-1015.901) -- 0:00:16
728000 -- (-1016.549) (-1018.289) [-1016.949] (-1018.725) * (-1015.511) [-1018.360] (-1018.745) (-1017.807) -- 0:00:16
728500 -- (-1023.410) (-1016.850) [-1016.146] (-1020.345) * (-1018.364) (-1016.895) [-1018.619] (-1016.650) -- 0:00:16
729000 -- (-1021.176) [-1018.041] (-1019.398) (-1016.648) * (-1022.673) [-1015.974] (-1017.724) (-1016.063) -- 0:00:16
729500 -- [-1018.610] (-1018.311) (-1017.639) (-1016.872) * (-1017.192) [-1016.609] (-1019.322) (-1016.480) -- 0:00:16
730000 -- (-1019.695) [-1016.463] (-1017.852) (-1018.392) * (-1018.053) [-1018.723] (-1016.203) (-1015.598) -- 0:00:16
Average standard deviation of split frequencies: 0.008473
730500 -- (-1017.210) [-1015.978] (-1017.257) (-1022.869) * [-1018.497] (-1018.850) (-1016.602) (-1016.298) -- 0:00:16
731000 -- (-1016.576) [-1017.830] (-1018.409) (-1016.554) * (-1020.285) [-1016.740] (-1018.155) (-1017.276) -- 0:00:16
731500 -- (-1018.095) (-1018.138) [-1019.376] (-1020.335) * (-1015.748) [-1018.654] (-1018.462) (-1016.525) -- 0:00:16
732000 -- (-1021.954) [-1015.642] (-1019.784) (-1017.588) * (-1018.629) (-1018.098) (-1019.795) [-1016.997] -- 0:00:16
732500 -- (-1018.593) [-1015.805] (-1019.261) (-1016.812) * (-1019.701) (-1018.730) (-1022.050) [-1017.486] -- 0:00:16
733000 -- (-1017.326) (-1017.179) (-1018.652) [-1018.031] * [-1016.873] (-1020.027) (-1022.272) (-1018.151) -- 0:00:16
733500 -- (-1017.201) [-1016.133] (-1018.006) (-1017.249) * (-1020.250) (-1016.422) (-1017.771) [-1018.587] -- 0:00:15
734000 -- [-1021.719] (-1016.843) (-1015.589) (-1015.993) * (-1019.309) (-1016.221) [-1018.675] (-1021.620) -- 0:00:15
734500 -- (-1017.765) (-1016.764) (-1020.114) [-1016.714] * (-1019.152) (-1018.836) [-1017.135] (-1017.280) -- 0:00:15
735000 -- [-1017.764] (-1017.170) (-1018.527) (-1016.389) * (-1021.520) (-1019.075) (-1017.730) [-1017.891] -- 0:00:15
Average standard deviation of split frequencies: 0.008198
735500 -- (-1017.311) (-1017.924) (-1017.368) [-1019.338] * [-1017.291] (-1019.353) (-1015.853) (-1020.413) -- 0:00:15
736000 -- (-1017.039) (-1017.031) (-1019.257) [-1016.885] * [-1019.622] (-1016.827) (-1015.481) (-1018.363) -- 0:00:15
736500 -- (-1016.236) (-1016.898) (-1018.572) [-1016.533] * (-1020.305) (-1018.649) [-1017.023] (-1022.083) -- 0:00:15
737000 -- (-1019.053) [-1017.146] (-1018.530) (-1020.369) * [-1018.012] (-1020.614) (-1018.988) (-1019.261) -- 0:00:16
737500 -- (-1016.855) (-1018.256) [-1016.764] (-1017.891) * [-1020.408] (-1022.314) (-1020.886) (-1018.925) -- 0:00:16
738000 -- (-1016.903) (-1016.028) [-1016.111] (-1018.268) * (-1019.091) (-1018.330) (-1018.467) [-1015.607] -- 0:00:15
738500 -- (-1016.606) (-1016.562) [-1017.686] (-1019.860) * (-1017.152) (-1022.195) (-1017.124) [-1016.359] -- 0:00:15
739000 -- (-1016.606) (-1019.374) (-1016.586) [-1019.820] * (-1017.295) (-1016.890) (-1017.917) [-1016.130] -- 0:00:15
739500 -- (-1017.373) (-1015.971) [-1016.940] (-1020.653) * [-1017.660] (-1017.547) (-1017.837) (-1016.927) -- 0:00:15
740000 -- [-1017.355] (-1016.964) (-1015.879) (-1015.949) * (-1017.579) (-1016.940) (-1016.419) [-1017.854] -- 0:00:15
Average standard deviation of split frequencies: 0.007935
740500 -- (-1018.339) [-1016.856] (-1015.907) (-1015.456) * (-1021.325) (-1022.164) (-1016.698) [-1018.646] -- 0:00:15
741000 -- (-1020.701) (-1017.199) (-1019.001) [-1015.767] * (-1019.302) (-1017.697) (-1016.028) [-1022.423] -- 0:00:15
741500 -- [-1019.054] (-1018.928) (-1021.740) (-1020.367) * (-1017.363) (-1018.424) (-1017.268) [-1021.238] -- 0:00:15
742000 -- (-1020.068) (-1016.888) (-1015.939) [-1019.043] * (-1017.937) (-1018.721) (-1017.621) [-1016.412] -- 0:00:15
742500 -- [-1017.004] (-1022.132) (-1015.591) (-1018.477) * [-1015.890] (-1019.100) (-1017.565) (-1016.397) -- 0:00:15
743000 -- (-1017.160) (-1018.487) (-1016.597) [-1015.464] * (-1017.077) (-1017.044) [-1018.770] (-1018.137) -- 0:00:15
743500 -- (-1016.165) [-1020.354] (-1015.820) (-1017.879) * [-1018.038] (-1018.103) (-1018.968) (-1018.115) -- 0:00:15
744000 -- (-1018.963) (-1016.220) [-1019.483] (-1016.759) * (-1017.214) (-1018.204) [-1018.729] (-1019.268) -- 0:00:15
744500 -- (-1018.965) (-1016.762) (-1017.053) [-1019.238] * (-1015.753) (-1019.623) (-1017.877) [-1018.360] -- 0:00:15
745000 -- (-1019.162) [-1017.126] (-1016.201) (-1016.754) * (-1015.721) (-1020.918) (-1018.952) [-1019.453] -- 0:00:15
Average standard deviation of split frequencies: 0.007920
745500 -- (-1019.197) [-1016.333] (-1015.913) (-1015.664) * (-1015.828) [-1015.884] (-1016.204) (-1018.692) -- 0:00:15
746000 -- (-1016.935) [-1015.725] (-1021.327) (-1015.929) * (-1018.871) [-1015.882] (-1016.612) (-1018.290) -- 0:00:15
746500 -- [-1016.567] (-1017.261) (-1017.446) (-1017.806) * (-1016.478) (-1017.698) [-1016.877] (-1023.604) -- 0:00:15
747000 -- (-1017.034) (-1016.983) (-1018.400) [-1015.963] * [-1015.653] (-1018.435) (-1019.842) (-1018.507) -- 0:00:15
747500 -- (-1017.408) [-1019.554] (-1017.600) (-1017.729) * (-1017.252) [-1016.203] (-1018.457) (-1024.761) -- 0:00:15
748000 -- [-1016.527] (-1018.843) (-1018.514) (-1015.578) * (-1017.128) (-1017.134) [-1021.525] (-1020.007) -- 0:00:15
748500 -- (-1017.429) (-1024.311) [-1018.672] (-1018.721) * (-1016.234) (-1017.757) [-1015.810] (-1021.502) -- 0:00:15
749000 -- [-1017.452] (-1024.418) (-1019.696) (-1017.788) * (-1016.361) [-1016.076] (-1019.079) (-1022.377) -- 0:00:15
749500 -- (-1017.184) (-1018.710) (-1017.119) [-1017.993] * (-1016.932) (-1017.625) [-1015.961] (-1019.707) -- 0:00:15
750000 -- (-1017.499) (-1016.207) (-1021.331) [-1017.228] * (-1017.629) [-1017.601] (-1017.463) (-1017.724) -- 0:00:15
Average standard deviation of split frequencies: 0.007452
750500 -- [-1017.441] (-1021.508) (-1020.285) (-1016.379) * (-1019.711) (-1017.348) [-1017.172] (-1015.663) -- 0:00:14
751000 -- (-1020.890) (-1021.183) (-1016.652) [-1015.495] * (-1021.533) (-1017.051) [-1017.674] (-1019.101) -- 0:00:14
751500 -- [-1016.574] (-1020.119) (-1015.333) (-1016.490) * (-1018.374) [-1017.098] (-1018.504) (-1020.105) -- 0:00:14
752000 -- [-1017.358] (-1018.991) (-1016.082) (-1016.473) * (-1018.518) (-1015.508) [-1017.919] (-1017.485) -- 0:00:14
752500 -- [-1017.046] (-1016.009) (-1021.201) (-1018.554) * (-1016.750) (-1015.956) (-1017.445) [-1017.135] -- 0:00:14
753000 -- (-1019.907) (-1019.031) [-1020.496] (-1017.866) * [-1015.905] (-1018.525) (-1019.965) (-1019.819) -- 0:00:14
753500 -- (-1017.634) [-1016.821] (-1019.743) (-1018.053) * (-1015.920) (-1019.123) (-1018.443) [-1017.508] -- 0:00:14
754000 -- [-1018.505] (-1015.836) (-1020.424) (-1017.180) * [-1017.470] (-1018.174) (-1016.716) (-1017.350) -- 0:00:15
754500 -- [-1016.792] (-1016.391) (-1021.611) (-1017.670) * (-1018.063) (-1017.840) [-1015.838] (-1018.037) -- 0:00:14
755000 -- (-1018.449) (-1017.447) [-1019.539] (-1019.395) * (-1015.527) [-1017.437] (-1019.261) (-1019.672) -- 0:00:14
Average standard deviation of split frequencies: 0.007524
755500 -- [-1017.503] (-1017.742) (-1021.388) (-1016.808) * (-1017.978) [-1016.472] (-1019.780) (-1017.417) -- 0:00:14
756000 -- [-1016.768] (-1015.915) (-1023.257) (-1023.205) * (-1020.061) [-1017.696] (-1018.923) (-1017.619) -- 0:00:14
756500 -- (-1016.895) (-1015.914) (-1021.861) [-1018.287] * (-1016.313) (-1017.504) [-1017.193] (-1018.302) -- 0:00:14
757000 -- (-1016.145) [-1017.056] (-1018.197) (-1020.034) * (-1015.467) (-1024.559) (-1017.501) [-1018.069] -- 0:00:14
757500 -- (-1017.132) (-1017.997) (-1017.258) [-1016.368] * (-1018.207) (-1018.842) (-1018.853) [-1017.931] -- 0:00:14
758000 -- (-1016.414) [-1019.989] (-1021.317) (-1016.988) * (-1016.686) (-1017.114) [-1016.735] (-1016.154) -- 0:00:14
758500 -- (-1016.494) (-1017.357) [-1018.008] (-1015.475) * (-1017.523) (-1021.437) [-1017.131] (-1015.871) -- 0:00:14
759000 -- (-1016.731) (-1019.650) (-1017.587) [-1016.457] * (-1019.465) (-1017.130) (-1017.679) [-1016.184] -- 0:00:14
759500 -- (-1016.536) (-1020.624) (-1017.897) [-1016.980] * [-1016.945] (-1016.237) (-1015.996) (-1018.036) -- 0:00:14
760000 -- [-1017.965] (-1021.957) (-1019.529) (-1017.510) * [-1016.377] (-1016.736) (-1015.801) (-1016.566) -- 0:00:14
Average standard deviation of split frequencies: 0.006982
760500 -- (-1017.407) (-1019.631) [-1018.204] (-1018.149) * (-1021.535) [-1016.353] (-1017.397) (-1019.385) -- 0:00:14
761000 -- (-1016.938) (-1018.556) [-1016.892] (-1018.470) * (-1019.057) [-1016.669] (-1018.136) (-1019.548) -- 0:00:14
761500 -- (-1017.787) [-1016.038] (-1016.919) (-1017.727) * [-1016.820] (-1018.901) (-1018.726) (-1019.076) -- 0:00:14
762000 -- (-1015.818) [-1015.901] (-1015.983) (-1018.278) * (-1016.301) (-1016.351) (-1017.806) [-1018.134] -- 0:00:14
762500 -- (-1017.200) [-1015.533] (-1015.983) (-1016.310) * [-1015.525] (-1022.958) (-1016.857) (-1020.069) -- 0:00:14
763000 -- [-1021.752] (-1015.477) (-1017.571) (-1020.092) * (-1016.804) (-1016.856) (-1021.161) [-1016.468] -- 0:00:14
763500 -- [-1018.767] (-1017.286) (-1017.417) (-1016.050) * (-1019.659) (-1018.849) [-1018.689] (-1016.439) -- 0:00:14
764000 -- [-1015.698] (-1017.616) (-1019.069) (-1018.932) * (-1019.557) (-1021.403) (-1016.378) [-1016.373] -- 0:00:14
764500 -- (-1016.808) [-1017.417] (-1017.092) (-1017.720) * (-1018.459) (-1018.324) (-1016.344) [-1016.362] -- 0:00:14
765000 -- (-1017.369) [-1019.102] (-1021.844) (-1017.122) * [-1017.062] (-1018.345) (-1016.549) (-1016.099) -- 0:00:14
Average standard deviation of split frequencies: 0.007846
765500 -- (-1016.702) (-1017.392) [-1016.270] (-1018.119) * (-1016.981) (-1018.674) [-1015.922] (-1019.684) -- 0:00:14
766000 -- (-1016.886) [-1018.487] (-1018.213) (-1016.250) * (-1018.895) [-1018.101] (-1017.111) (-1016.710) -- 0:00:14
766500 -- (-1016.838) (-1017.587) [-1018.257] (-1015.677) * (-1017.636) [-1016.820] (-1018.603) (-1018.800) -- 0:00:14
767000 -- (-1019.885) [-1016.460] (-1022.681) (-1016.708) * (-1019.368) (-1016.401) (-1017.878) [-1019.772] -- 0:00:13
767500 -- (-1018.863) (-1016.279) (-1022.522) [-1018.878] * (-1019.483) (-1019.644) [-1016.379] (-1016.832) -- 0:00:13
768000 -- (-1017.912) [-1017.046] (-1017.140) (-1018.786) * (-1016.998) (-1016.837) [-1015.572] (-1016.145) -- 0:00:13
768500 -- [-1017.293] (-1017.250) (-1017.173) (-1019.200) * (-1018.911) (-1017.616) [-1020.899] (-1018.107) -- 0:00:13
769000 -- [-1019.635] (-1017.916) (-1019.490) (-1018.974) * [-1015.678] (-1017.514) (-1018.679) (-1018.185) -- 0:00:13
769500 -- (-1020.326) (-1017.253) (-1016.668) [-1017.712] * (-1020.184) [-1017.597] (-1020.853) (-1019.221) -- 0:00:13
770000 -- (-1016.788) (-1021.586) (-1020.166) [-1016.685] * [-1017.964] (-1018.592) (-1020.646) (-1019.860) -- 0:00:13
Average standard deviation of split frequencies: 0.007608
770500 -- (-1017.625) [-1018.415] (-1022.652) (-1018.910) * (-1017.342) [-1017.372] (-1019.383) (-1018.890) -- 0:00:13
771000 -- [-1019.242] (-1020.121) (-1024.040) (-1018.493) * (-1018.405) (-1020.264) (-1020.072) [-1018.338] -- 0:00:13
771500 -- (-1020.446) [-1019.519] (-1018.260) (-1022.787) * (-1016.772) (-1016.324) (-1017.388) [-1016.767] -- 0:00:13
772000 -- [-1016.234] (-1017.010) (-1016.876) (-1019.389) * (-1018.653) (-1021.802) [-1020.557] (-1018.748) -- 0:00:13
772500 -- (-1020.933) [-1016.556] (-1020.085) (-1017.632) * (-1018.370) (-1018.804) (-1016.990) [-1022.579] -- 0:00:13
773000 -- (-1016.353) (-1016.420) (-1023.121) [-1018.840] * (-1020.596) (-1018.715) [-1016.002] (-1021.503) -- 0:00:13
773500 -- (-1016.057) (-1017.029) (-1021.697) [-1018.576] * (-1018.896) (-1019.062) (-1016.448) [-1016.650] -- 0:00:13
774000 -- (-1017.330) (-1017.993) [-1018.199] (-1022.491) * (-1018.667) (-1018.388) (-1017.284) [-1017.768] -- 0:00:13
774500 -- [-1016.262] (-1018.430) (-1017.640) (-1017.543) * (-1018.056) (-1018.973) (-1016.453) [-1019.119] -- 0:00:13
775000 -- (-1022.404) (-1018.831) (-1017.770) [-1016.928] * (-1019.542) (-1017.692) [-1016.606] (-1017.695) -- 0:00:13
Average standard deviation of split frequencies: 0.007707
775500 -- (-1018.316) (-1019.482) [-1016.974] (-1018.712) * (-1019.082) [-1016.147] (-1018.730) (-1016.832) -- 0:00:13
776000 -- [-1016.924] (-1016.358) (-1016.259) (-1018.742) * [-1017.797] (-1020.359) (-1016.368) (-1019.482) -- 0:00:13
776500 -- (-1018.048) [-1017.037] (-1016.892) (-1018.485) * (-1018.059) (-1018.852) (-1017.686) [-1016.600] -- 0:00:13
777000 -- [-1016.659] (-1017.544) (-1017.219) (-1021.280) * (-1019.550) [-1018.041] (-1019.386) (-1017.488) -- 0:00:13
777500 -- (-1017.105) (-1019.543) (-1022.479) [-1019.491] * (-1017.627) (-1016.079) (-1016.460) [-1018.921] -- 0:00:13
778000 -- (-1016.617) [-1016.963] (-1018.161) (-1016.932) * [-1017.919] (-1016.160) (-1020.082) (-1016.797) -- 0:00:13
778500 -- (-1017.203) (-1016.793) [-1019.056] (-1017.447) * (-1017.411) (-1018.276) [-1015.863] (-1018.423) -- 0:00:13
779000 -- [-1016.741] (-1019.747) (-1016.581) (-1018.349) * (-1018.578) [-1018.283] (-1017.176) (-1018.088) -- 0:00:13
779500 -- (-1017.301) (-1022.254) [-1015.531] (-1017.241) * (-1016.917) [-1016.954] (-1016.702) (-1018.320) -- 0:00:13
780000 -- (-1017.396) (-1017.969) [-1016.682] (-1019.409) * (-1021.467) [-1018.956] (-1017.111) (-1017.916) -- 0:00:13
Average standard deviation of split frequencies: 0.008001
780500 -- [-1016.967] (-1016.773) (-1017.626) (-1019.039) * [-1018.132] (-1016.432) (-1019.699) (-1019.059) -- 0:00:13
781000 -- (-1020.999) (-1018.276) [-1017.517] (-1019.274) * [-1016.417] (-1016.239) (-1015.999) (-1022.064) -- 0:00:13
781500 -- [-1019.618] (-1017.295) (-1021.449) (-1017.173) * (-1017.491) [-1016.987] (-1016.696) (-1021.869) -- 0:00:13
782000 -- [-1020.494] (-1018.546) (-1019.402) (-1021.458) * (-1017.107) [-1017.866] (-1016.758) (-1024.222) -- 0:00:13
782500 -- [-1018.487] (-1019.524) (-1019.430) (-1018.016) * (-1016.354) (-1018.501) (-1015.427) [-1016.084] -- 0:00:13
783000 -- [-1017.765] (-1016.890) (-1018.983) (-1018.476) * (-1016.604) [-1018.246] (-1015.425) (-1017.787) -- 0:00:13
783500 -- (-1017.097) (-1016.721) (-1015.728) [-1017.603] * (-1017.712) (-1016.062) [-1015.427] (-1018.510) -- 0:00:12
784000 -- (-1018.249) [-1019.635] (-1021.706) (-1017.410) * (-1016.457) (-1017.295) [-1019.781] (-1015.596) -- 0:00:12
784500 -- (-1018.653) [-1017.690] (-1018.041) (-1015.688) * (-1016.490) (-1017.604) (-1017.828) [-1015.746] -- 0:00:12
785000 -- (-1016.753) (-1019.237) [-1015.791] (-1015.783) * (-1016.099) (-1017.415) (-1016.254) [-1018.017] -- 0:00:12
Average standard deviation of split frequencies: 0.007557
785500 -- (-1018.750) (-1018.855) (-1019.905) [-1015.743] * (-1015.263) (-1021.963) (-1016.715) [-1016.253] -- 0:00:12
786000 -- (-1017.031) (-1018.739) (-1019.522) [-1016.343] * (-1017.325) (-1016.769) (-1015.482) [-1016.859] -- 0:00:12
786500 -- (-1016.155) [-1017.202] (-1016.997) (-1015.713) * [-1020.946] (-1016.676) (-1015.389) (-1017.751) -- 0:00:12
787000 -- (-1016.501) [-1022.651] (-1020.938) (-1017.454) * [-1016.960] (-1017.500) (-1018.586) (-1015.898) -- 0:00:12
787500 -- (-1021.601) (-1019.222) [-1017.900] (-1016.923) * (-1017.047) (-1016.776) [-1018.413] (-1018.156) -- 0:00:12
788000 -- (-1016.770) (-1016.599) [-1020.137] (-1017.275) * [-1017.976] (-1016.985) (-1018.312) (-1017.521) -- 0:00:12
788500 -- [-1016.301] (-1017.617) (-1018.715) (-1017.503) * [-1016.197] (-1021.615) (-1018.649) (-1017.375) -- 0:00:12
789000 -- (-1016.633) [-1017.313] (-1024.494) (-1020.136) * (-1018.361) [-1019.783] (-1019.224) (-1017.155) -- 0:00:12
789500 -- [-1016.586] (-1019.529) (-1019.512) (-1019.673) * (-1020.046) (-1017.109) (-1020.957) [-1015.614] -- 0:00:12
790000 -- (-1018.451) [-1017.363] (-1016.733) (-1019.807) * [-1021.706] (-1016.798) (-1017.231) (-1016.829) -- 0:00:12
Average standard deviation of split frequencies: 0.007314
790500 -- (-1018.127) (-1018.547) (-1016.514) [-1017.123] * [-1018.320] (-1016.868) (-1018.408) (-1015.642) -- 0:00:12
791000 -- (-1023.287) [-1015.963] (-1016.478) (-1018.506) * (-1019.042) [-1016.183] (-1021.510) (-1017.667) -- 0:00:12
791500 -- (-1019.253) (-1015.774) [-1020.270] (-1018.127) * [-1016.863] (-1018.113) (-1018.841) (-1019.560) -- 0:00:12
792000 -- (-1018.615) [-1019.258] (-1018.086) (-1018.372) * (-1020.041) (-1018.020) [-1016.025] (-1022.307) -- 0:00:12
792500 -- [-1016.867] (-1021.132) (-1016.227) (-1019.477) * (-1020.125) (-1019.293) [-1017.598] (-1018.707) -- 0:00:12
793000 -- (-1017.097) (-1017.595) [-1017.079] (-1015.958) * (-1017.677) (-1020.019) (-1020.517) [-1017.761] -- 0:00:12
793500 -- (-1016.644) (-1017.985) [-1015.592] (-1016.621) * [-1015.933] (-1020.360) (-1019.785) (-1018.546) -- 0:00:12
794000 -- (-1018.423) [-1016.732] (-1020.266) (-1016.909) * [-1017.487] (-1021.284) (-1018.723) (-1023.395) -- 0:00:12
794500 -- (-1017.059) (-1022.663) (-1018.813) [-1016.302] * (-1017.288) (-1017.828) [-1017.181] (-1019.931) -- 0:00:12
795000 -- (-1017.410) [-1017.944] (-1018.606) (-1019.957) * [-1016.364] (-1016.703) (-1017.005) (-1020.409) -- 0:00:12
Average standard deviation of split frequencies: 0.007422
795500 -- (-1018.112) [-1016.997] (-1017.778) (-1022.765) * [-1020.167] (-1016.337) (-1015.854) (-1016.654) -- 0:00:12
796000 -- (-1018.168) [-1019.595] (-1017.846) (-1016.475) * [-1016.676] (-1017.366) (-1017.850) (-1016.104) -- 0:00:12
796500 -- (-1021.047) (-1018.287) [-1018.946] (-1016.783) * [-1017.757] (-1017.199) (-1020.999) (-1020.233) -- 0:00:12
797000 -- (-1016.495) (-1020.049) (-1015.626) [-1016.297] * [-1022.166] (-1018.769) (-1021.078) (-1020.428) -- 0:00:12
797500 -- (-1016.809) [-1018.362] (-1015.462) (-1017.103) * (-1017.793) (-1016.907) (-1022.296) [-1018.540] -- 0:00:12
798000 -- (-1021.110) (-1019.619) (-1018.216) [-1017.898] * (-1018.653) (-1016.190) (-1017.863) [-1018.770] -- 0:00:12
798500 -- (-1016.658) [-1017.677] (-1018.838) (-1020.427) * (-1017.548) (-1015.971) [-1018.475] (-1017.262) -- 0:00:12
799000 -- (-1016.419) (-1017.069) [-1021.007] (-1016.984) * [-1016.382] (-1017.653) (-1016.675) (-1019.325) -- 0:00:12
799500 -- (-1017.572) (-1018.214) (-1020.239) [-1015.991] * [-1017.638] (-1015.929) (-1020.068) (-1020.811) -- 0:00:12
800000 -- (-1019.473) [-1017.458] (-1024.936) (-1017.160) * (-1015.707) (-1018.704) (-1018.983) [-1022.804] -- 0:00:12
Average standard deviation of split frequencies: 0.007575
800500 -- (-1024.314) [-1017.262] (-1019.750) (-1017.101) * (-1018.193) (-1017.359) [-1017.157] (-1016.844) -- 0:00:11
801000 -- [-1019.316] (-1023.852) (-1019.432) (-1015.937) * (-1024.146) (-1018.070) (-1015.888) [-1016.131] -- 0:00:11
801500 -- (-1021.275) [-1018.011] (-1018.521) (-1018.251) * (-1019.914) (-1016.599) (-1018.903) [-1017.882] -- 0:00:11
802000 -- (-1019.689) [-1016.928] (-1018.722) (-1020.031) * (-1019.112) [-1016.917] (-1019.328) (-1016.668) -- 0:00:11
802500 -- (-1017.556) (-1019.426) [-1021.306] (-1017.743) * (-1021.085) [-1015.940] (-1018.322) (-1019.491) -- 0:00:11
803000 -- (-1019.771) [-1017.059] (-1020.539) (-1017.768) * [-1017.406] (-1017.752) (-1015.859) (-1021.076) -- 0:00:12
803500 -- (-1016.415) (-1017.832) (-1020.996) [-1016.578] * (-1018.166) [-1018.302] (-1017.376) (-1018.379) -- 0:00:11
804000 -- (-1017.018) (-1017.583) (-1020.417) [-1016.578] * (-1019.365) [-1017.551] (-1017.433) (-1015.774) -- 0:00:11
804500 -- (-1017.160) [-1017.840] (-1019.729) (-1017.379) * (-1019.624) [-1022.443] (-1020.982) (-1016.750) -- 0:00:11
805000 -- (-1018.126) [-1022.903] (-1020.432) (-1016.632) * (-1021.208) (-1018.032) (-1017.148) [-1017.342] -- 0:00:11
Average standard deviation of split frequencies: 0.007486
805500 -- [-1018.606] (-1017.291) (-1015.823) (-1015.428) * (-1016.331) (-1017.739) (-1015.687) [-1018.352] -- 0:00:11
806000 -- (-1018.132) [-1016.340] (-1015.563) (-1017.523) * [-1017.002] (-1018.445) (-1016.895) (-1019.218) -- 0:00:11
806500 -- (-1018.432) (-1025.763) (-1015.615) [-1016.976] * (-1018.203) (-1017.296) [-1019.032] (-1016.227) -- 0:00:11
807000 -- [-1016.672] (-1018.307) (-1016.347) (-1016.671) * (-1019.724) [-1017.588] (-1017.677) (-1016.573) -- 0:00:11
807500 -- (-1017.696) (-1017.730) [-1015.966] (-1016.521) * (-1016.857) (-1017.673) [-1017.187] (-1017.817) -- 0:00:11
808000 -- [-1016.090] (-1017.694) (-1016.511) (-1018.954) * (-1016.899) (-1022.751) (-1015.942) [-1020.922] -- 0:00:11
808500 -- (-1017.567) (-1018.235) (-1017.061) [-1015.951] * [-1015.748] (-1020.115) (-1021.422) (-1018.971) -- 0:00:11
809000 -- [-1016.858] (-1016.500) (-1015.967) (-1017.223) * (-1015.349) (-1017.952) [-1017.185] (-1017.157) -- 0:00:11
809500 -- (-1018.668) (-1017.371) [-1016.951] (-1020.077) * (-1016.875) (-1021.186) [-1018.833] (-1017.828) -- 0:00:11
810000 -- (-1020.050) (-1016.627) [-1018.804] (-1017.823) * (-1018.926) (-1018.626) [-1019.913] (-1019.379) -- 0:00:11
Average standard deviation of split frequencies: 0.007288
810500 -- (-1016.342) [-1017.006] (-1018.765) (-1017.435) * (-1016.916) (-1017.103) (-1017.200) [-1016.398] -- 0:00:11
811000 -- [-1017.601] (-1017.888) (-1015.825) (-1017.914) * [-1016.729] (-1017.350) (-1023.599) (-1017.710) -- 0:00:11
811500 -- (-1020.612) (-1025.170) (-1016.560) [-1017.125] * (-1019.206) [-1016.555] (-1019.311) (-1016.396) -- 0:00:11
812000 -- (-1018.700) (-1020.592) [-1020.938] (-1020.376) * (-1022.279) [-1018.463] (-1018.541) (-1018.135) -- 0:00:11
812500 -- (-1016.638) (-1021.881) (-1019.818) [-1019.129] * (-1017.042) (-1020.596) (-1017.507) [-1017.256] -- 0:00:11
813000 -- (-1020.405) [-1016.554] (-1020.273) (-1017.986) * [-1021.120] (-1016.529) (-1016.977) (-1016.435) -- 0:00:11
813500 -- [-1017.694] (-1016.049) (-1016.710) (-1020.523) * (-1018.364) [-1016.712] (-1016.190) (-1016.969) -- 0:00:11
814000 -- (-1016.074) (-1016.617) [-1016.989] (-1018.659) * (-1017.358) (-1017.494) [-1017.071] (-1018.445) -- 0:00:11
814500 -- [-1018.186] (-1021.162) (-1017.214) (-1017.831) * [-1016.861] (-1016.819) (-1018.226) (-1017.087) -- 0:00:11
815000 -- (-1017.284) (-1017.024) [-1016.214] (-1016.681) * [-1018.694] (-1015.965) (-1018.056) (-1023.671) -- 0:00:11
Average standard deviation of split frequencies: 0.007626
815500 -- (-1019.549) (-1016.171) (-1018.351) [-1016.392] * (-1021.375) (-1017.335) [-1017.662] (-1017.660) -- 0:00:11
816000 -- (-1019.714) (-1016.243) [-1017.018] (-1017.809) * (-1023.026) (-1016.702) [-1019.097] (-1019.306) -- 0:00:11
816500 -- [-1020.767] (-1016.080) (-1018.872) (-1016.626) * (-1019.983) (-1022.148) [-1017.637] (-1018.797) -- 0:00:11
817000 -- [-1015.522] (-1016.681) (-1017.806) (-1018.412) * (-1019.269) (-1018.231) (-1017.867) [-1017.826] -- 0:00:10
817500 -- (-1022.651) (-1017.996) [-1021.618] (-1017.208) * (-1018.840) [-1018.959] (-1018.112) (-1018.455) -- 0:00:10
818000 -- (-1023.214) (-1017.548) [-1018.279] (-1019.402) * [-1016.493] (-1016.739) (-1016.846) (-1015.584) -- 0:00:10
818500 -- (-1016.185) (-1017.323) [-1019.453] (-1018.749) * (-1018.225) (-1016.933) (-1017.154) [-1017.889] -- 0:00:10
819000 -- (-1016.357) (-1015.954) [-1016.871] (-1018.694) * (-1017.297) (-1015.843) (-1017.063) [-1020.232] -- 0:00:10
819500 -- (-1017.586) [-1016.931] (-1017.782) (-1020.786) * [-1017.173] (-1015.973) (-1017.427) (-1020.191) -- 0:00:11
820000 -- (-1015.975) (-1016.657) [-1016.443] (-1021.810) * (-1016.458) (-1017.164) (-1017.867) [-1016.435] -- 0:00:10
Average standard deviation of split frequencies: 0.007506
820500 -- (-1016.568) (-1018.108) [-1016.874] (-1017.599) * (-1016.155) [-1020.441] (-1017.590) (-1018.054) -- 0:00:10
821000 -- (-1016.582) (-1017.903) (-1016.266) [-1016.289] * [-1015.537] (-1018.445) (-1018.301) (-1016.352) -- 0:00:10
821500 -- (-1019.791) [-1018.709] (-1019.928) (-1020.869) * (-1016.366) (-1023.085) (-1016.983) [-1018.181] -- 0:00:10
822000 -- (-1022.965) [-1018.910] (-1018.409) (-1023.698) * (-1016.194) (-1016.176) [-1016.552] (-1017.292) -- 0:00:10
822500 -- (-1023.102) (-1016.930) [-1017.848] (-1016.136) * [-1017.631] (-1021.746) (-1020.550) (-1017.552) -- 0:00:10
823000 -- (-1021.309) [-1017.000] (-1018.300) (-1020.504) * (-1016.484) (-1017.766) (-1017.336) [-1017.516] -- 0:00:10
823500 -- (-1021.010) (-1020.515) [-1022.464] (-1017.750) * [-1019.302] (-1018.480) (-1017.129) (-1018.562) -- 0:00:10
824000 -- [-1017.836] (-1019.665) (-1020.588) (-1015.940) * (-1018.007) (-1016.167) (-1018.460) [-1018.931] -- 0:00:10
824500 -- (-1015.962) (-1016.090) [-1016.576] (-1019.577) * (-1018.900) [-1017.997] (-1019.421) (-1019.068) -- 0:00:10
825000 -- (-1017.882) (-1016.140) (-1016.833) [-1016.739] * (-1016.334) (-1017.633) (-1017.810) [-1019.871] -- 0:00:10
Average standard deviation of split frequencies: 0.007571
825500 -- [-1017.128] (-1019.889) (-1017.160) (-1017.955) * (-1016.253) (-1017.118) [-1017.501] (-1020.855) -- 0:00:10
826000 -- (-1016.438) (-1018.811) [-1016.354] (-1016.195) * (-1020.496) (-1020.776) [-1016.094] (-1017.281) -- 0:00:10
826500 -- (-1016.857) (-1018.753) [-1016.499] (-1019.572) * (-1018.200) (-1018.687) (-1019.937) [-1019.182] -- 0:00:10
827000 -- (-1021.351) (-1019.796) (-1016.107) [-1019.114] * (-1017.896) (-1016.554) [-1018.225] (-1021.037) -- 0:00:10
827500 -- (-1019.532) (-1020.137) [-1015.652] (-1018.106) * (-1017.249) (-1017.580) [-1019.190] (-1019.541) -- 0:00:10
828000 -- (-1017.257) (-1016.664) (-1017.871) [-1016.178] * (-1016.412) (-1020.522) [-1016.754] (-1021.463) -- 0:00:10
828500 -- (-1015.988) (-1017.100) (-1016.502) [-1017.973] * (-1016.647) [-1018.647] (-1018.856) (-1015.575) -- 0:00:10
829000 -- (-1019.125) (-1018.323) (-1017.977) [-1017.493] * (-1017.199) [-1016.417] (-1018.055) (-1016.681) -- 0:00:10
829500 -- (-1017.964) (-1017.511) [-1018.999] (-1016.916) * [-1016.601] (-1017.245) (-1017.104) (-1018.602) -- 0:00:10
830000 -- [-1015.843] (-1018.563) (-1017.993) (-1018.657) * (-1017.905) (-1020.204) (-1019.473) [-1018.231] -- 0:00:10
Average standard deviation of split frequencies: 0.007756
830500 -- [-1016.780] (-1017.793) (-1024.763) (-1018.249) * (-1017.775) (-1020.650) [-1017.416] (-1022.973) -- 0:00:10
831000 -- (-1017.512) (-1018.217) (-1023.680) [-1018.887] * (-1019.897) (-1015.949) (-1017.068) [-1021.046] -- 0:00:10
831500 -- (-1017.330) (-1018.902) [-1020.785] (-1019.721) * [-1017.454] (-1017.664) (-1017.328) (-1019.005) -- 0:00:10
832000 -- (-1019.608) (-1017.614) [-1019.704] (-1017.892) * (-1018.479) (-1017.015) [-1020.345] (-1019.059) -- 0:00:10
832500 -- (-1016.875) (-1016.967) [-1021.299] (-1017.606) * (-1020.161) [-1016.756] (-1017.576) (-1017.575) -- 0:00:10
833000 -- (-1015.780) (-1017.232) (-1020.135) [-1016.989] * (-1021.918) (-1018.018) (-1018.259) [-1016.850] -- 0:00:10
833500 -- [-1016.169] (-1017.243) (-1016.821) (-1018.334) * (-1018.415) (-1017.948) (-1019.216) [-1016.084] -- 0:00:09
834000 -- (-1015.847) (-1015.762) (-1021.656) [-1017.175] * [-1017.453] (-1016.066) (-1015.494) (-1018.684) -- 0:00:09
834500 -- [-1016.080] (-1018.015) (-1017.778) (-1017.539) * (-1017.460) (-1015.858) (-1017.534) [-1018.691] -- 0:00:09
835000 -- (-1016.790) [-1016.404] (-1017.350) (-1017.384) * [-1018.242] (-1016.803) (-1019.605) (-1016.432) -- 0:00:09
Average standard deviation of split frequencies: 0.007481
835500 -- [-1019.371] (-1016.170) (-1017.366) (-1018.390) * (-1018.491) [-1017.029] (-1015.842) (-1019.436) -- 0:00:10
836000 -- [-1018.484] (-1017.322) (-1019.201) (-1019.455) * (-1018.545) (-1016.307) [-1016.418] (-1019.177) -- 0:00:10
836500 -- (-1017.937) (-1017.864) [-1022.574] (-1018.524) * (-1016.837) [-1017.622] (-1019.626) (-1016.719) -- 0:00:09
837000 -- (-1015.960) (-1019.319) (-1018.206) [-1016.465] * (-1017.156) [-1017.832] (-1017.934) (-1021.376) -- 0:00:09
837500 -- (-1018.639) (-1018.823) [-1016.079] (-1015.689) * [-1016.984] (-1017.715) (-1016.272) (-1020.955) -- 0:00:09
838000 -- (-1019.287) [-1016.392] (-1018.410) (-1015.943) * (-1018.143) [-1016.254] (-1019.124) (-1023.481) -- 0:00:09
838500 -- [-1019.588] (-1016.680) (-1017.298) (-1016.801) * (-1016.834) (-1016.623) [-1020.646] (-1020.838) -- 0:00:09
839000 -- (-1018.053) [-1017.686] (-1017.334) (-1020.149) * (-1017.978) (-1019.019) [-1018.309] (-1020.154) -- 0:00:09
839500 -- [-1016.185] (-1020.189) (-1019.811) (-1017.181) * (-1016.609) [-1024.337] (-1019.054) (-1022.381) -- 0:00:09
840000 -- (-1018.653) (-1021.775) (-1020.809) [-1016.461] * [-1017.403] (-1018.687) (-1019.575) (-1017.691) -- 0:00:09
Average standard deviation of split frequencies: 0.007178
840500 -- (-1017.876) [-1017.092] (-1023.748) (-1017.270) * [-1017.368] (-1017.785) (-1018.612) (-1016.613) -- 0:00:09
841000 -- [-1019.685] (-1020.402) (-1015.390) (-1018.068) * [-1018.267] (-1017.133) (-1017.820) (-1018.467) -- 0:00:09
841500 -- (-1016.586) (-1015.935) (-1017.790) [-1017.052] * (-1016.651) (-1019.324) (-1020.294) [-1018.447] -- 0:00:09
842000 -- [-1016.048] (-1015.931) (-1017.952) (-1016.439) * (-1016.660) [-1017.843] (-1024.479) (-1023.989) -- 0:00:09
842500 -- [-1017.132] (-1016.686) (-1016.135) (-1018.508) * (-1020.442) [-1015.879] (-1017.395) (-1023.241) -- 0:00:09
843000 -- (-1016.586) (-1019.506) (-1015.917) [-1015.757] * (-1018.389) (-1017.715) (-1016.566) [-1017.823] -- 0:00:09
843500 -- (-1016.693) (-1020.869) (-1016.738) [-1015.774] * (-1019.825) (-1016.679) [-1016.991] (-1016.551) -- 0:00:09
844000 -- (-1020.550) [-1017.933] (-1015.797) (-1015.501) * (-1015.963) [-1016.920] (-1020.322) (-1017.353) -- 0:00:09
844500 -- (-1018.499) (-1018.346) [-1016.816] (-1018.983) * [-1015.563] (-1016.933) (-1018.912) (-1016.902) -- 0:00:09
845000 -- (-1016.829) (-1017.677) (-1017.855) [-1018.431] * (-1017.555) (-1020.278) [-1017.625] (-1017.405) -- 0:00:09
Average standard deviation of split frequencies: 0.006724
845500 -- [-1017.304] (-1020.527) (-1017.009) (-1019.508) * (-1017.930) (-1017.773) [-1016.337] (-1015.344) -- 0:00:09
846000 -- (-1020.684) (-1020.080) (-1021.083) [-1021.652] * (-1017.851) (-1018.556) (-1020.061) [-1016.121] -- 0:00:09
846500 -- [-1020.963] (-1015.852) (-1018.441) (-1018.132) * (-1016.522) (-1018.701) [-1019.457] (-1018.355) -- 0:00:09
847000 -- (-1022.812) (-1016.784) [-1017.453] (-1016.370) * [-1020.010] (-1021.612) (-1018.972) (-1016.192) -- 0:00:09
847500 -- (-1021.335) (-1016.572) [-1021.548] (-1019.938) * (-1022.427) (-1016.832) [-1016.055] (-1019.081) -- 0:00:09
848000 -- (-1017.264) (-1019.612) (-1017.574) [-1017.186] * [-1016.773] (-1016.206) (-1016.001) (-1019.864) -- 0:00:09
848500 -- (-1017.428) [-1017.186] (-1017.416) (-1017.410) * (-1017.443) (-1019.221) [-1016.026] (-1017.281) -- 0:00:09
849000 -- (-1016.791) [-1020.259] (-1017.677) (-1017.410) * (-1021.313) (-1017.742) [-1016.215] (-1017.020) -- 0:00:09
849500 -- (-1017.034) [-1016.485] (-1017.126) (-1016.087) * (-1019.662) (-1018.103) [-1015.682] (-1017.879) -- 0:00:09
850000 -- (-1018.491) [-1016.566] (-1016.269) (-1017.957) * (-1018.556) (-1018.866) (-1018.830) [-1017.733] -- 0:00:09
Average standard deviation of split frequencies: 0.007537
850500 -- (-1017.920) (-1016.035) (-1018.023) [-1019.240] * [-1016.541] (-1018.612) (-1017.819) (-1019.873) -- 0:00:09
851000 -- (-1017.966) [-1022.214] (-1020.783) (-1020.820) * (-1016.201) [-1017.341] (-1018.331) (-1019.812) -- 0:00:09
851500 -- (-1017.741) [-1019.194] (-1016.348) (-1022.946) * (-1018.214) (-1017.414) [-1016.120] (-1021.577) -- 0:00:09
852000 -- (-1017.905) (-1015.943) (-1018.336) [-1018.731] * (-1017.457) [-1016.847] (-1015.646) (-1021.935) -- 0:00:09
852500 -- (-1018.658) (-1017.162) (-1017.119) [-1018.363] * (-1019.562) (-1018.491) [-1015.498] (-1019.980) -- 0:00:08
853000 -- [-1019.077] (-1018.166) (-1019.471) (-1018.794) * (-1024.278) (-1019.707) (-1016.425) [-1016.799] -- 0:00:08
853500 -- (-1017.800) (-1016.160) (-1019.851) [-1016.748] * (-1017.366) [-1017.681] (-1017.023) (-1018.398) -- 0:00:08
854000 -- (-1015.369) (-1017.706) [-1017.717] (-1018.460) * [-1016.597] (-1015.860) (-1017.432) (-1016.779) -- 0:00:08
854500 -- [-1019.719] (-1017.283) (-1016.248) (-1017.620) * (-1018.134) [-1016.289] (-1017.832) (-1015.955) -- 0:00:08
855000 -- [-1018.594] (-1020.663) (-1017.180) (-1019.736) * (-1016.859) (-1017.188) (-1019.946) [-1018.091] -- 0:00:08
Average standard deviation of split frequencies: 0.007159
855500 -- (-1019.381) (-1018.553) [-1016.134] (-1023.125) * (-1019.260) (-1017.943) (-1021.427) [-1016.509] -- 0:00:08
856000 -- (-1020.205) (-1020.110) (-1017.607) [-1020.499] * (-1018.433) (-1018.535) [-1017.368] (-1015.557) -- 0:00:08
856500 -- (-1017.246) (-1020.852) [-1016.718] (-1026.492) * (-1018.502) (-1017.184) [-1018.729] (-1017.247) -- 0:00:08
857000 -- (-1020.767) (-1020.237) [-1016.313] (-1018.718) * (-1019.908) [-1015.798] (-1018.582) (-1020.022) -- 0:00:08
857500 -- (-1017.226) [-1017.355] (-1017.595) (-1018.203) * (-1016.047) (-1019.908) (-1018.213) [-1020.852] -- 0:00:08
858000 -- (-1019.170) [-1016.351] (-1016.409) (-1022.290) * (-1015.395) (-1017.240) [-1017.732] (-1018.507) -- 0:00:08
858500 -- (-1020.328) (-1016.389) (-1015.650) [-1019.835] * [-1018.982] (-1019.901) (-1018.287) (-1017.138) -- 0:00:08
859000 -- (-1026.232) (-1018.301) [-1015.311] (-1018.325) * [-1018.300] (-1016.544) (-1018.141) (-1017.732) -- 0:00:08
859500 -- (-1017.501) [-1017.566] (-1016.752) (-1019.413) * (-1018.244) (-1018.872) (-1015.712) [-1018.249] -- 0:00:08
860000 -- [-1017.433] (-1016.541) (-1017.095) (-1016.250) * (-1015.389) [-1016.576] (-1016.169) (-1016.782) -- 0:00:08
Average standard deviation of split frequencies: 0.007486
860500 -- [-1020.184] (-1018.393) (-1020.241) (-1016.416) * (-1015.426) (-1018.444) (-1019.775) [-1019.108] -- 0:00:08
861000 -- (-1018.136) (-1017.670) [-1016.197] (-1017.796) * (-1019.692) (-1019.827) [-1019.207] (-1018.497) -- 0:00:08
861500 -- (-1018.472) (-1020.695) (-1017.339) [-1018.125] * (-1020.152) (-1016.388) (-1018.204) [-1016.329] -- 0:00:08
862000 -- (-1018.489) [-1018.401] (-1019.919) (-1021.642) * (-1020.004) (-1022.582) (-1018.549) [-1017.281] -- 0:00:08
862500 -- (-1017.502) [-1017.796] (-1015.972) (-1019.003) * (-1019.940) (-1022.129) [-1018.012] (-1016.302) -- 0:00:08
863000 -- (-1016.445) (-1019.569) [-1017.930] (-1019.945) * [-1017.583] (-1015.633) (-1019.615) (-1016.250) -- 0:00:08
863500 -- (-1016.556) (-1016.226) [-1019.552] (-1018.504) * (-1015.948) (-1018.920) (-1017.985) [-1017.447] -- 0:00:08
864000 -- (-1017.122) (-1015.923) (-1019.599) [-1016.801] * [-1019.211] (-1017.182) (-1017.117) (-1018.243) -- 0:00:08
864500 -- (-1018.657) (-1015.942) (-1016.194) [-1017.319] * (-1021.860) [-1019.039] (-1018.160) (-1021.150) -- 0:00:08
865000 -- [-1016.933] (-1016.372) (-1016.193) (-1018.738) * (-1017.498) (-1016.531) (-1016.764) [-1019.423] -- 0:00:08
Average standard deviation of split frequencies: 0.007113
865500 -- (-1016.319) [-1016.701] (-1015.946) (-1016.028) * [-1017.277] (-1020.824) (-1016.376) (-1016.715) -- 0:00:08
866000 -- (-1020.923) (-1019.144) (-1016.072) [-1015.771] * (-1017.308) (-1017.656) [-1018.993] (-1016.562) -- 0:00:08
866500 -- (-1020.113) (-1016.365) [-1018.102] (-1018.897) * [-1020.439] (-1019.642) (-1021.573) (-1015.815) -- 0:00:08
867000 -- [-1017.810] (-1018.173) (-1017.558) (-1018.375) * (-1016.818) (-1020.524) [-1017.193] (-1016.223) -- 0:00:08
867500 -- (-1018.740) (-1020.636) [-1018.042] (-1019.762) * [-1017.897] (-1019.004) (-1020.820) (-1016.442) -- 0:00:08
868000 -- (-1016.419) [-1017.136] (-1019.013) (-1018.269) * (-1019.159) (-1021.914) (-1020.100) [-1017.121] -- 0:00:08
868500 -- [-1020.067] (-1015.897) (-1019.458) (-1017.735) * (-1017.876) (-1018.233) [-1016.855] (-1020.960) -- 0:00:08
869000 -- (-1020.201) (-1017.911) [-1016.230] (-1019.341) * [-1020.274] (-1018.845) (-1018.288) (-1016.403) -- 0:00:07
869500 -- [-1020.310] (-1017.319) (-1016.750) (-1017.759) * [-1017.442] (-1016.972) (-1021.711) (-1022.038) -- 0:00:07
870000 -- (-1017.983) [-1017.997] (-1019.877) (-1016.824) * [-1018.271] (-1018.547) (-1018.857) (-1020.077) -- 0:00:07
Average standard deviation of split frequencies: 0.006750
870500 -- (-1021.887) (-1017.170) (-1018.265) [-1018.533] * [-1017.860] (-1020.231) (-1019.452) (-1018.556) -- 0:00:07
871000 -- [-1015.994] (-1017.333) (-1017.485) (-1021.963) * [-1017.046] (-1018.723) (-1017.939) (-1019.383) -- 0:00:07
871500 -- (-1016.984) (-1022.418) [-1020.354] (-1016.063) * [-1017.542] (-1017.334) (-1020.590) (-1019.553) -- 0:00:07
872000 -- (-1018.870) [-1018.974] (-1019.497) (-1016.327) * (-1020.620) (-1020.153) (-1017.833) [-1018.331] -- 0:00:07
872500 -- (-1017.591) [-1015.751] (-1016.879) (-1019.621) * (-1019.600) (-1017.237) [-1017.029] (-1018.930) -- 0:00:07
873000 -- (-1020.255) [-1017.856] (-1017.965) (-1022.096) * (-1016.723) [-1016.471] (-1019.404) (-1016.089) -- 0:00:07
873500 -- (-1020.527) (-1019.246) (-1017.942) [-1019.298] * (-1021.168) (-1017.038) [-1017.815] (-1016.842) -- 0:00:07
874000 -- [-1017.099] (-1017.538) (-1019.142) (-1017.244) * [-1016.024] (-1016.257) (-1019.382) (-1019.226) -- 0:00:07
874500 -- (-1018.190) [-1018.712] (-1018.944) (-1020.019) * (-1018.231) (-1019.200) (-1016.687) [-1020.190] -- 0:00:07
875000 -- (-1015.851) (-1019.470) [-1019.286] (-1019.459) * [-1018.243] (-1018.876) (-1017.587) (-1018.674) -- 0:00:07
Average standard deviation of split frequencies: 0.006673
875500 -- (-1017.848) (-1016.215) (-1016.412) [-1017.866] * [-1016.806] (-1018.775) (-1020.316) (-1017.276) -- 0:00:07
876000 -- [-1015.821] (-1017.655) (-1017.600) (-1017.039) * (-1017.539) [-1017.017] (-1017.535) (-1019.762) -- 0:00:07
876500 -- (-1018.436) (-1017.700) (-1020.360) [-1015.441] * [-1018.930] (-1016.818) (-1021.059) (-1017.458) -- 0:00:07
877000 -- (-1016.909) (-1016.329) (-1016.128) [-1015.657] * (-1017.250) (-1019.854) [-1017.803] (-1016.794) -- 0:00:07
877500 -- (-1017.844) (-1018.416) (-1016.963) [-1017.262] * (-1016.927) (-1016.916) (-1017.527) [-1017.991] -- 0:00:07
878000 -- (-1017.598) (-1017.162) [-1015.719] (-1016.924) * (-1016.895) (-1017.660) [-1018.694] (-1019.474) -- 0:00:07
878500 -- [-1016.157] (-1017.089) (-1015.719) (-1017.069) * (-1018.682) (-1019.532) [-1022.996] (-1017.228) -- 0:00:07
879000 -- [-1016.500] (-1017.141) (-1018.555) (-1019.822) * (-1017.255) (-1019.781) (-1019.782) [-1018.557] -- 0:00:07
879500 -- (-1017.932) (-1017.001) [-1017.554] (-1017.108) * [-1017.876] (-1017.605) (-1016.521) (-1018.218) -- 0:00:07
880000 -- [-1016.209] (-1016.897) (-1017.437) (-1016.246) * (-1017.334) [-1016.464] (-1017.177) (-1019.398) -- 0:00:07
Average standard deviation of split frequencies: 0.006423
880500 -- (-1016.808) (-1017.512) (-1016.679) [-1017.146] * (-1017.234) (-1018.398) (-1016.705) [-1017.517] -- 0:00:07
881000 -- (-1017.823) (-1016.992) (-1016.785) [-1016.908] * (-1016.492) [-1017.293] (-1018.217) (-1019.160) -- 0:00:07
881500 -- (-1017.814) (-1017.126) [-1016.570] (-1020.204) * [-1016.333] (-1021.268) (-1018.303) (-1019.242) -- 0:00:07
882000 -- (-1016.865) [-1018.498] (-1016.285) (-1018.192) * (-1016.674) [-1017.050] (-1018.914) (-1017.519) -- 0:00:07
882500 -- (-1016.585) [-1018.489] (-1018.206) (-1017.376) * (-1016.369) (-1017.035) (-1019.372) [-1016.553] -- 0:00:07
883000 -- [-1017.701] (-1017.865) (-1018.375) (-1021.800) * (-1021.413) (-1017.841) (-1020.491) [-1015.835] -- 0:00:07
883500 -- [-1017.545] (-1019.452) (-1020.476) (-1016.463) * (-1017.082) (-1023.097) [-1016.164] (-1019.558) -- 0:00:07
884000 -- [-1017.618] (-1024.478) (-1016.925) (-1017.898) * (-1016.249) (-1019.694) (-1017.266) [-1018.123] -- 0:00:07
884500 -- (-1022.391) (-1016.861) (-1016.340) [-1020.590] * (-1019.018) (-1017.424) [-1017.827] (-1017.839) -- 0:00:07
885000 -- [-1017.681] (-1017.486) (-1015.943) (-1018.814) * (-1017.956) [-1016.085] (-1018.683) (-1018.207) -- 0:00:07
Average standard deviation of split frequencies: 0.006278
885500 -- (-1016.149) (-1017.830) (-1015.943) [-1023.327] * [-1016.750] (-1016.903) (-1021.070) (-1016.511) -- 0:00:06
886000 -- [-1016.706] (-1017.132) (-1016.806) (-1018.320) * (-1021.158) (-1016.748) [-1016.495] (-1015.794) -- 0:00:06
886500 -- (-1018.574) (-1016.438) (-1019.308) [-1018.298] * (-1019.364) (-1016.805) [-1017.586] (-1016.470) -- 0:00:06
887000 -- (-1017.554) (-1015.816) (-1018.291) [-1016.691] * (-1019.066) [-1016.700] (-1022.055) (-1019.723) -- 0:00:06
887500 -- [-1018.934] (-1017.189) (-1021.573) (-1016.301) * (-1016.471) (-1017.664) (-1018.274) [-1016.656] -- 0:00:06
888000 -- (-1018.518) [-1017.504] (-1021.626) (-1026.913) * [-1017.742] (-1019.108) (-1017.799) (-1020.985) -- 0:00:06
888500 -- (-1021.244) [-1017.384] (-1016.883) (-1017.682) * (-1015.555) (-1018.572) [-1019.368] (-1018.540) -- 0:00:06
889000 -- (-1016.699) (-1017.445) [-1017.267] (-1018.520) * (-1015.903) (-1018.369) (-1019.207) [-1019.300] -- 0:00:06
889500 -- [-1017.686] (-1017.971) (-1016.684) (-1018.705) * (-1016.780) (-1017.050) [-1015.923] (-1019.500) -- 0:00:06
890000 -- (-1017.759) [-1016.862] (-1018.598) (-1020.021) * (-1016.258) [-1018.630] (-1022.065) (-1017.049) -- 0:00:06
Average standard deviation of split frequencies: 0.006316
890500 -- [-1015.726] (-1017.765) (-1022.169) (-1020.395) * [-1017.762] (-1020.331) (-1019.282) (-1016.599) -- 0:00:06
891000 -- (-1018.691) [-1017.137] (-1020.905) (-1017.041) * [-1017.993] (-1018.241) (-1016.667) (-1018.140) -- 0:00:06
891500 -- (-1024.884) (-1017.823) [-1018.339] (-1016.482) * (-1018.953) (-1016.618) (-1016.641) [-1018.920] -- 0:00:06
892000 -- (-1020.875) (-1016.502) (-1016.680) [-1017.905] * (-1016.119) [-1019.522] (-1021.312) (-1015.824) -- 0:00:06
892500 -- (-1022.147) (-1016.404) [-1016.676] (-1020.732) * (-1017.818) (-1017.691) [-1015.728] (-1018.339) -- 0:00:06
893000 -- (-1027.143) [-1018.070] (-1018.039) (-1018.207) * (-1017.681) [-1017.496] (-1018.065) (-1018.662) -- 0:00:06
893500 -- [-1017.492] (-1016.810) (-1015.956) (-1016.181) * (-1017.884) (-1017.505) [-1018.576] (-1018.336) -- 0:00:06
894000 -- (-1017.802) (-1017.865) [-1017.327] (-1016.306) * (-1020.079) (-1018.937) (-1018.925) [-1019.695] -- 0:00:06
894500 -- (-1020.041) (-1018.605) [-1020.008] (-1018.326) * (-1019.889) (-1016.664) (-1020.502) [-1016.338] -- 0:00:06
895000 -- (-1020.588) (-1018.498) [-1017.503] (-1021.195) * (-1020.089) (-1018.389) (-1018.727) [-1017.764] -- 0:00:06
Average standard deviation of split frequencies: 0.006489
895500 -- (-1017.218) [-1017.760] (-1018.019) (-1020.462) * [-1016.790] (-1016.899) (-1017.556) (-1017.684) -- 0:00:06
896000 -- [-1017.326] (-1020.427) (-1016.794) (-1016.430) * (-1016.687) (-1017.930) (-1018.303) [-1022.961] -- 0:00:06
896500 -- [-1018.080] (-1018.206) (-1016.165) (-1017.687) * (-1016.201) (-1017.201) [-1015.585] (-1019.565) -- 0:00:06
897000 -- (-1016.371) (-1019.154) (-1018.659) [-1019.200] * (-1017.354) (-1017.720) [-1016.974] (-1020.492) -- 0:00:06
897500 -- (-1018.360) (-1021.387) [-1016.458] (-1017.000) * (-1024.851) (-1020.421) [-1016.894] (-1018.487) -- 0:00:06
898000 -- (-1019.645) (-1025.649) (-1016.267) [-1016.264] * (-1022.784) (-1017.162) [-1017.101] (-1016.881) -- 0:00:06
898500 -- (-1016.687) (-1018.809) [-1016.857] (-1018.214) * (-1018.497) (-1018.116) (-1017.972) [-1015.726] -- 0:00:06
899000 -- (-1021.537) (-1017.087) (-1018.076) [-1019.974] * (-1016.722) (-1017.017) (-1018.202) [-1017.423] -- 0:00:06
899500 -- (-1019.585) [-1016.504] (-1021.963) (-1015.949) * (-1016.890) [-1016.541] (-1016.126) (-1020.267) -- 0:00:06
900000 -- (-1021.656) [-1017.798] (-1015.532) (-1016.600) * [-1016.208] (-1016.336) (-1017.758) (-1020.161) -- 0:00:06
Average standard deviation of split frequencies: 0.006525
900500 -- (-1019.450) (-1019.797) [-1017.229] (-1017.423) * (-1016.732) (-1017.887) [-1017.124] (-1017.173) -- 0:00:06
901000 -- (-1016.294) (-1017.868) (-1016.435) [-1016.939] * (-1020.098) (-1016.647) (-1015.421) [-1017.037] -- 0:00:06
901500 -- (-1019.495) [-1016.436] (-1017.427) (-1017.876) * (-1019.775) [-1017.980] (-1017.233) (-1015.882) -- 0:00:06
902000 -- (-1016.629) (-1017.380) (-1016.668) [-1019.489] * [-1018.616] (-1016.210) (-1015.910) (-1017.677) -- 0:00:05
902500 -- (-1017.589) [-1017.758] (-1017.154) (-1016.242) * (-1016.293) (-1018.998) (-1016.755) [-1017.268] -- 0:00:05
903000 -- (-1017.265) (-1016.020) (-1022.116) [-1016.971] * (-1018.333) [-1021.042] (-1016.550) (-1017.364) -- 0:00:05
903500 -- (-1018.043) [-1015.920] (-1016.707) (-1015.550) * (-1016.191) (-1016.851) (-1017.157) [-1019.951] -- 0:00:05
904000 -- (-1019.577) (-1019.310) (-1018.322) [-1018.779] * (-1018.576) [-1017.531] (-1015.636) (-1020.169) -- 0:00:05
904500 -- (-1015.700) (-1017.213) (-1020.444) [-1016.498] * [-1016.409] (-1016.398) (-1015.640) (-1020.940) -- 0:00:05
905000 -- (-1020.447) (-1019.488) [-1017.671] (-1019.678) * [-1015.942] (-1021.011) (-1015.795) (-1019.644) -- 0:00:05
Average standard deviation of split frequencies: 0.006729
905500 -- (-1016.256) [-1016.214] (-1018.414) (-1016.913) * (-1017.005) [-1016.675] (-1020.363) (-1018.094) -- 0:00:05
906000 -- (-1019.727) (-1017.678) (-1016.783) [-1016.691] * (-1020.651) [-1017.963] (-1020.057) (-1015.759) -- 0:00:05
906500 -- [-1016.211] (-1016.095) (-1017.416) (-1017.951) * (-1019.022) (-1018.507) [-1016.583] (-1016.317) -- 0:00:05
907000 -- (-1016.444) [-1017.378] (-1016.769) (-1018.589) * (-1016.997) (-1019.918) (-1016.084) [-1017.024] -- 0:00:05
907500 -- (-1018.700) (-1017.637) (-1018.916) [-1016.578] * (-1020.285) (-1018.396) (-1017.154) [-1016.159] -- 0:00:05
908000 -- (-1018.539) [-1017.247] (-1016.961) (-1015.999) * (-1017.463) (-1023.848) (-1017.558) [-1017.779] -- 0:00:05
908500 -- (-1023.447) [-1019.386] (-1016.901) (-1020.058) * (-1018.319) (-1017.173) [-1020.408] (-1025.106) -- 0:00:05
909000 -- (-1020.748) (-1018.798) [-1021.664] (-1019.381) * (-1017.058) [-1017.503] (-1018.733) (-1017.880) -- 0:00:05
909500 -- (-1018.532) [-1016.179] (-1017.692) (-1020.686) * (-1020.206) (-1018.613) [-1016.539] (-1016.501) -- 0:00:05
910000 -- [-1017.308] (-1019.567) (-1015.943) (-1022.670) * [-1018.590] (-1018.518) (-1016.522) (-1017.766) -- 0:00:05
Average standard deviation of split frequencies: 0.007109
910500 -- (-1017.790) [-1018.065] (-1018.551) (-1021.592) * (-1016.540) (-1018.231) (-1017.944) [-1017.672] -- 0:00:05
911000 -- (-1016.435) (-1016.486) (-1017.507) [-1017.184] * (-1016.768) (-1017.198) [-1016.431] (-1020.095) -- 0:00:05
911500 -- (-1015.299) (-1016.374) [-1020.922] (-1018.308) * [-1016.165] (-1017.717) (-1018.246) (-1020.345) -- 0:00:05
912000 -- (-1017.275) (-1016.892) (-1016.537) [-1018.852] * (-1016.936) (-1019.311) (-1018.198) [-1017.517] -- 0:00:05
912500 -- [-1016.221] (-1017.192) (-1016.557) (-1023.255) * [-1016.051] (-1017.108) (-1015.478) (-1020.341) -- 0:00:05
913000 -- (-1018.129) (-1020.397) [-1018.944] (-1018.893) * (-1021.507) [-1016.771] (-1019.800) (-1017.972) -- 0:00:05
913500 -- (-1017.504) [-1018.245] (-1015.462) (-1016.211) * (-1018.270) (-1018.202) (-1019.873) [-1020.098] -- 0:00:05
914000 -- [-1018.368] (-1018.681) (-1016.268) (-1018.770) * (-1018.937) (-1019.221) (-1016.229) [-1019.653] -- 0:00:05
914500 -- (-1022.047) [-1018.838] (-1017.288) (-1019.315) * (-1016.818) [-1016.628] (-1016.304) (-1017.157) -- 0:00:05
915000 -- (-1019.094) (-1016.789) (-1019.228) [-1019.808] * (-1016.163) (-1016.628) [-1017.893] (-1017.423) -- 0:00:05
Average standard deviation of split frequencies: 0.006999
915500 -- (-1017.477) (-1021.305) (-1020.382) [-1016.873] * (-1015.732) [-1016.628] (-1019.143) (-1015.929) -- 0:00:05
916000 -- (-1020.516) [-1017.008] (-1017.514) (-1017.360) * [-1017.913] (-1018.537) (-1019.166) (-1015.989) -- 0:00:05
916500 -- (-1023.253) (-1018.309) (-1018.626) [-1018.189] * [-1017.580] (-1018.613) (-1017.948) (-1015.810) -- 0:00:05
917000 -- (-1018.691) (-1015.426) [-1017.766] (-1018.151) * (-1018.487) (-1017.763) (-1017.301) [-1015.909] -- 0:00:05
917500 -- (-1017.067) (-1016.239) (-1022.308) [-1017.016] * (-1015.386) [-1016.836] (-1017.148) (-1016.407) -- 0:00:05
918000 -- (-1016.716) [-1020.394] (-1017.569) (-1017.524) * (-1018.456) (-1016.454) (-1017.274) [-1016.706] -- 0:00:05
918500 -- (-1018.507) (-1020.616) [-1016.211] (-1017.964) * (-1016.949) (-1016.075) (-1017.354) [-1016.798] -- 0:00:04
919000 -- (-1018.645) (-1015.616) [-1015.815] (-1018.019) * [-1017.958] (-1016.066) (-1018.051) (-1017.186) -- 0:00:04
919500 -- (-1018.278) [-1016.565] (-1016.535) (-1019.175) * (-1016.524) (-1017.374) [-1017.352] (-1015.901) -- 0:00:04
920000 -- (-1016.059) (-1016.799) [-1018.992] (-1016.297) * [-1016.562] (-1016.834) (-1019.548) (-1015.779) -- 0:00:04
Average standard deviation of split frequencies: 0.006929
920500 -- [-1016.186] (-1017.068) (-1017.764) (-1015.487) * (-1019.016) [-1016.322] (-1017.138) (-1016.314) -- 0:00:04
921000 -- [-1015.762] (-1016.989) (-1015.806) (-1015.512) * (-1018.225) [-1017.676] (-1021.307) (-1016.542) -- 0:00:04
921500 -- (-1015.876) [-1017.346] (-1016.643) (-1017.887) * (-1020.179) [-1016.830] (-1019.366) (-1017.260) -- 0:00:04
922000 -- [-1016.453] (-1018.736) (-1020.728) (-1018.892) * [-1016.053] (-1017.327) (-1017.563) (-1017.765) -- 0:00:04
922500 -- (-1020.677) (-1016.756) (-1018.260) [-1016.326] * (-1018.568) (-1017.137) (-1015.341) [-1016.764] -- 0:00:04
923000 -- [-1018.215] (-1021.876) (-1016.196) (-1017.249) * (-1019.349) [-1016.032] (-1016.485) (-1016.661) -- 0:00:04
923500 -- [-1018.717] (-1016.346) (-1017.130) (-1016.748) * (-1018.233) (-1016.126) [-1016.288] (-1016.841) -- 0:00:04
924000 -- (-1016.026) [-1017.202] (-1017.368) (-1016.175) * (-1018.462) (-1018.206) (-1017.778) [-1017.429] -- 0:00:04
924500 -- [-1017.371] (-1021.549) (-1019.181) (-1021.357) * (-1017.387) (-1017.143) (-1018.720) [-1015.828] -- 0:00:04
925000 -- (-1021.044) (-1021.523) (-1019.727) [-1017.590] * (-1018.189) (-1017.842) [-1016.199] (-1016.489) -- 0:00:04
Average standard deviation of split frequencies: 0.006788
925500 -- (-1017.113) (-1016.824) (-1020.629) [-1017.591] * (-1016.812) (-1017.174) (-1016.969) [-1016.984] -- 0:00:04
926000 -- [-1017.217] (-1016.022) (-1017.154) (-1016.292) * (-1019.607) [-1019.373] (-1016.481) (-1020.670) -- 0:00:04
926500 -- [-1016.204] (-1018.292) (-1017.753) (-1016.034) * (-1017.138) (-1019.108) [-1018.760] (-1017.198) -- 0:00:04
927000 -- (-1015.736) (-1017.770) (-1023.388) [-1015.686] * (-1016.346) (-1017.184) [-1017.402] (-1016.415) -- 0:00:04
927500 -- (-1016.879) [-1015.758] (-1017.883) (-1015.809) * [-1016.783] (-1021.043) (-1017.582) (-1018.394) -- 0:00:04
928000 -- (-1018.375) (-1018.160) [-1019.412] (-1018.731) * (-1017.456) [-1016.601] (-1015.875) (-1016.625) -- 0:00:04
928500 -- (-1018.708) [-1017.617] (-1015.978) (-1018.378) * (-1017.657) (-1016.326) [-1017.974] (-1019.138) -- 0:00:04
929000 -- (-1016.525) (-1018.613) [-1015.837] (-1019.174) * [-1017.026] (-1016.399) (-1018.119) (-1019.923) -- 0:00:04
929500 -- (-1017.713) (-1017.881) (-1016.062) [-1019.733] * (-1017.080) [-1016.903] (-1018.655) (-1015.909) -- 0:00:04
930000 -- [-1015.741] (-1018.263) (-1018.656) (-1017.895) * (-1016.755) (-1023.110) (-1020.559) [-1018.488] -- 0:00:04
Average standard deviation of split frequencies: 0.006652
930500 -- (-1018.006) (-1016.679) [-1019.663] (-1016.837) * (-1017.286) [-1017.980] (-1018.826) (-1017.343) -- 0:00:04
931000 -- (-1019.635) [-1016.777] (-1016.784) (-1017.923) * (-1016.427) (-1016.919) [-1016.796] (-1022.626) -- 0:00:04
931500 -- [-1016.391] (-1017.497) (-1016.663) (-1017.714) * [-1016.673] (-1017.112) (-1017.476) (-1023.938) -- 0:00:04
932000 -- (-1016.825) (-1017.101) (-1017.091) [-1021.320] * (-1015.540) (-1016.916) (-1016.921) [-1017.822] -- 0:00:04
932500 -- (-1017.089) [-1016.935] (-1015.764) (-1020.767) * (-1017.192) (-1019.870) (-1016.778) [-1018.450] -- 0:00:04
933000 -- (-1019.114) (-1017.048) (-1017.218) [-1021.386] * (-1017.712) (-1017.707) (-1016.489) [-1017.236] -- 0:00:04
933500 -- (-1019.278) (-1020.141) (-1018.213) [-1015.826] * (-1017.371) [-1017.837] (-1016.854) (-1019.078) -- 0:00:04
934000 -- (-1020.103) (-1017.603) (-1016.564) [-1015.962] * [-1017.850] (-1020.008) (-1016.425) (-1016.623) -- 0:00:04
934500 -- (-1019.068) (-1017.077) [-1016.107] (-1016.275) * (-1016.671) [-1017.490] (-1015.976) (-1016.558) -- 0:00:03
935000 -- [-1016.976] (-1016.839) (-1020.102) (-1017.043) * (-1017.305) [-1016.838] (-1017.304) (-1017.305) -- 0:00:03
Average standard deviation of split frequencies: 0.006212
935500 -- (-1017.334) (-1016.785) (-1018.177) [-1021.580] * (-1017.335) [-1016.631] (-1017.965) (-1016.682) -- 0:00:03
936000 -- [-1019.686] (-1016.864) (-1017.375) (-1020.509) * (-1018.396) (-1015.786) (-1019.380) [-1019.319] -- 0:00:03
936500 -- (-1016.303) [-1017.210] (-1019.692) (-1018.282) * (-1017.481) [-1021.395] (-1019.058) (-1020.134) -- 0:00:03
937000 -- (-1017.381) (-1019.346) (-1019.753) [-1020.111] * (-1017.062) (-1020.667) [-1016.875] (-1019.900) -- 0:00:03
937500 -- (-1018.730) (-1017.545) [-1016.799] (-1020.399) * (-1016.693) [-1016.415] (-1016.880) (-1020.042) -- 0:00:03
938000 -- (-1016.871) (-1017.236) (-1017.136) [-1018.202] * (-1017.511) [-1015.720] (-1016.345) (-1016.924) -- 0:00:03
938500 -- [-1017.497] (-1017.228) (-1017.329) (-1016.153) * (-1019.820) (-1018.729) (-1019.226) [-1016.846] -- 0:00:03
939000 -- (-1018.153) (-1018.685) [-1017.139] (-1016.936) * (-1018.034) (-1019.600) [-1018.774] (-1016.715) -- 0:00:03
939500 -- (-1020.192) [-1016.487] (-1018.900) (-1018.575) * [-1016.200] (-1019.353) (-1018.072) (-1015.715) -- 0:00:03
940000 -- (-1020.336) [-1015.500] (-1018.209) (-1021.007) * (-1016.867) (-1024.037) [-1015.743] (-1020.857) -- 0:00:03
Average standard deviation of split frequencies: 0.006314
940500 -- (-1017.943) (-1016.745) [-1017.153] (-1016.416) * (-1016.259) [-1017.189] (-1017.255) (-1017.141) -- 0:00:03
941000 -- (-1016.906) (-1016.273) (-1017.573) [-1019.132] * [-1016.046] (-1016.358) (-1020.410) (-1021.769) -- 0:00:03
941500 -- (-1017.004) (-1015.412) [-1015.637] (-1019.882) * (-1016.434) (-1019.683) [-1019.468] (-1020.368) -- 0:00:03
942000 -- (-1016.839) (-1016.202) (-1017.736) [-1015.995] * (-1016.166) [-1016.542] (-1016.876) (-1016.871) -- 0:00:03
942500 -- (-1019.853) (-1021.046) [-1016.907] (-1018.159) * (-1017.761) (-1016.203) (-1017.980) [-1016.359] -- 0:00:03
943000 -- (-1017.901) [-1017.552] (-1018.806) (-1019.929) * (-1016.405) [-1017.343] (-1016.967) (-1016.948) -- 0:00:03
943500 -- (-1017.445) (-1018.124) [-1017.881] (-1020.734) * (-1018.307) [-1017.724] (-1016.254) (-1019.529) -- 0:00:03
944000 -- [-1015.985] (-1020.069) (-1020.880) (-1016.078) * [-1017.598] (-1016.541) (-1017.881) (-1017.808) -- 0:00:03
944500 -- (-1015.652) (-1018.658) [-1018.785] (-1017.262) * (-1016.400) [-1018.856] (-1021.950) (-1017.589) -- 0:00:03
945000 -- (-1015.981) [-1018.445] (-1017.465) (-1025.022) * (-1018.855) [-1017.663] (-1019.131) (-1017.671) -- 0:00:03
Average standard deviation of split frequencies: 0.006146
945500 -- [-1016.098] (-1023.041) (-1019.068) (-1022.081) * [-1016.570] (-1018.820) (-1018.719) (-1016.970) -- 0:00:03
946000 -- (-1022.732) (-1021.492) [-1016.916] (-1016.158) * (-1018.330) (-1019.741) [-1016.853] (-1020.132) -- 0:00:03
946500 -- (-1020.863) (-1019.708) [-1016.594] (-1016.887) * (-1019.239) (-1018.662) [-1018.801] (-1020.385) -- 0:00:03
947000 -- (-1018.047) (-1017.375) [-1018.688] (-1017.945) * [-1018.944] (-1018.044) (-1016.014) (-1018.351) -- 0:00:03
947500 -- (-1018.326) (-1017.916) [-1019.136] (-1016.780) * [-1016.812] (-1021.133) (-1016.739) (-1019.331) -- 0:00:03
948000 -- (-1021.805) [-1018.308] (-1016.847) (-1018.510) * (-1016.658) (-1018.384) [-1016.938] (-1022.239) -- 0:00:03
948500 -- (-1017.729) [-1016.437] (-1016.797) (-1015.955) * (-1021.123) (-1016.224) (-1016.373) [-1018.388] -- 0:00:03
949000 -- (-1017.441) [-1016.898] (-1016.317) (-1016.547) * (-1018.630) [-1015.778] (-1018.215) (-1017.305) -- 0:00:03
949500 -- (-1018.394) (-1020.226) (-1017.889) [-1015.600] * (-1020.891) [-1017.297] (-1018.128) (-1018.824) -- 0:00:03
950000 -- (-1018.208) [-1018.785] (-1017.954) (-1015.514) * [-1017.026] (-1017.162) (-1019.495) (-1017.959) -- 0:00:03
Average standard deviation of split frequencies: 0.006050
950500 -- (-1016.015) (-1018.324) [-1018.072] (-1018.592) * (-1016.005) [-1016.708] (-1017.234) (-1017.989) -- 0:00:03
951000 -- (-1018.911) [-1020.517] (-1018.096) (-1020.714) * (-1019.331) (-1020.052) [-1017.234] (-1017.161) -- 0:00:02
951500 -- (-1019.258) [-1019.401] (-1017.748) (-1017.065) * [-1017.001] (-1020.350) (-1018.909) (-1019.176) -- 0:00:02
952000 -- [-1017.506] (-1018.167) (-1017.327) (-1019.431) * (-1019.758) [-1016.562] (-1016.293) (-1017.267) -- 0:00:02
952500 -- [-1018.243] (-1022.545) (-1019.977) (-1017.463) * (-1019.648) (-1016.574) (-1016.334) [-1016.646] -- 0:00:02
953000 -- (-1016.756) [-1019.305] (-1017.782) (-1017.407) * [-1017.951] (-1018.303) (-1017.386) (-1016.658) -- 0:00:02
953500 -- [-1017.105] (-1020.762) (-1016.519) (-1017.786) * (-1018.082) (-1017.543) [-1016.428] (-1016.541) -- 0:00:02
954000 -- (-1016.898) [-1017.766] (-1019.537) (-1016.606) * (-1015.974) (-1017.714) (-1018.097) [-1019.738] -- 0:00:02
954500 -- [-1016.083] (-1017.138) (-1018.077) (-1020.828) * (-1016.940) (-1017.240) (-1016.729) [-1018.663] -- 0:00:02
955000 -- [-1016.725] (-1018.724) (-1017.946) (-1017.456) * (-1021.597) (-1015.639) [-1022.225] (-1016.081) -- 0:00:02
Average standard deviation of split frequencies: 0.005917
955500 -- (-1018.380) [-1019.531] (-1018.221) (-1017.855) * [-1018.059] (-1018.004) (-1018.283) (-1024.797) -- 0:00:02
956000 -- (-1016.344) (-1019.731) [-1020.318] (-1017.613) * [-1016.918] (-1018.832) (-1019.186) (-1017.821) -- 0:00:02
956500 -- (-1015.666) [-1016.008] (-1016.752) (-1022.794) * (-1019.018) (-1023.460) (-1020.565) [-1016.353] -- 0:00:02
957000 -- [-1016.767] (-1017.270) (-1018.046) (-1017.599) * (-1017.535) [-1022.655] (-1015.639) (-1017.892) -- 0:00:02
957500 -- (-1017.319) (-1018.343) [-1017.533] (-1016.826) * [-1016.657] (-1022.101) (-1016.257) (-1017.128) -- 0:00:02
958000 -- (-1017.769) [-1016.158] (-1025.425) (-1017.764) * (-1016.682) (-1020.397) (-1017.205) [-1016.897] -- 0:00:02
958500 -- (-1016.059) [-1016.693] (-1022.389) (-1018.091) * (-1016.152) [-1019.748] (-1018.373) (-1015.981) -- 0:00:02
959000 -- (-1018.294) (-1018.833) (-1020.400) [-1017.122] * (-1017.517) (-1015.763) [-1018.117] (-1019.843) -- 0:00:02
959500 -- (-1018.272) [-1017.604] (-1019.833) (-1018.601) * [-1019.768] (-1019.419) (-1018.776) (-1016.271) -- 0:00:02
960000 -- (-1015.952) (-1018.486) (-1019.631) [-1018.494] * (-1019.769) (-1019.800) (-1020.147) [-1015.240] -- 0:00:02
Average standard deviation of split frequencies: 0.006052
960500 -- (-1016.352) (-1016.511) (-1018.205) [-1016.339] * (-1016.975) (-1016.486) (-1018.421) [-1015.344] -- 0:00:02
961000 -- [-1019.033] (-1019.032) (-1016.310) (-1016.015) * (-1018.420) (-1017.058) (-1020.478) [-1017.570] -- 0:00:02
961500 -- (-1016.713) (-1016.325) (-1017.125) [-1015.474] * [-1017.112] (-1022.229) (-1018.230) (-1017.085) -- 0:00:02
962000 -- (-1016.093) (-1017.478) (-1017.750) [-1017.657] * (-1022.019) (-1019.582) [-1015.514] (-1017.086) -- 0:00:02
962500 -- (-1021.873) (-1015.951) [-1016.827] (-1017.536) * [-1019.842] (-1018.355) (-1015.687) (-1021.848) -- 0:00:02
963000 -- (-1020.168) [-1017.082] (-1019.069) (-1016.477) * [-1016.950] (-1019.402) (-1015.496) (-1019.743) -- 0:00:02
963500 -- (-1018.629) (-1018.754) [-1016.216] (-1017.212) * (-1018.238) [-1017.290] (-1016.876) (-1018.164) -- 0:00:02
964000 -- (-1019.575) (-1016.823) [-1018.529] (-1018.107) * (-1019.936) (-1017.280) (-1015.590) [-1019.277] -- 0:00:02
964500 -- (-1018.111) (-1019.618) [-1017.651] (-1017.091) * (-1017.053) (-1017.965) (-1016.686) [-1017.716] -- 0:00:02
965000 -- (-1018.092) (-1020.638) (-1017.588) [-1015.949] * (-1018.724) (-1018.768) [-1016.616] (-1015.975) -- 0:00:02
Average standard deviation of split frequencies: 0.005888
965500 -- (-1017.689) (-1019.556) [-1017.679] (-1016.747) * [-1018.295] (-1016.482) (-1020.907) (-1016.840) -- 0:00:02
966000 -- [-1015.777] (-1018.107) (-1020.939) (-1019.864) * (-1022.474) [-1015.972] (-1017.889) (-1018.198) -- 0:00:02
966500 -- (-1015.618) [-1015.848] (-1020.577) (-1018.860) * (-1016.181) (-1017.627) (-1017.793) [-1016.478] -- 0:00:02
967000 -- [-1015.528] (-1017.589) (-1015.986) (-1018.287) * [-1017.519] (-1019.492) (-1016.920) (-1015.836) -- 0:00:02
967500 -- (-1019.795) (-1017.311) [-1019.562] (-1019.459) * (-1017.534) (-1016.871) (-1017.515) [-1015.893] -- 0:00:01
968000 -- [-1016.011] (-1020.708) (-1017.639) (-1018.501) * (-1017.453) (-1019.359) (-1017.257) [-1016.063] -- 0:00:01
968500 -- (-1020.977) (-1019.578) [-1018.986] (-1021.998) * (-1017.795) (-1016.622) (-1019.669) [-1016.774] -- 0:00:01
969000 -- [-1018.765] (-1019.859) (-1017.902) (-1018.205) * (-1017.440) (-1015.956) [-1017.445] (-1015.894) -- 0:00:01
969500 -- (-1019.904) [-1017.501] (-1018.671) (-1015.959) * (-1016.547) [-1016.246] (-1018.043) (-1017.301) -- 0:00:01
970000 -- (-1017.662) (-1020.031) (-1018.955) [-1016.140] * (-1016.506) (-1017.537) [-1016.674] (-1016.658) -- 0:00:01
Average standard deviation of split frequencies: 0.006022
970500 -- [-1017.311] (-1020.745) (-1020.398) (-1016.474) * (-1015.944) (-1019.338) (-1015.869) [-1019.409] -- 0:00:01
971000 -- (-1019.013) (-1022.724) (-1019.449) [-1017.627] * [-1016.863] (-1019.021) (-1021.538) (-1018.398) -- 0:00:01
971500 -- (-1016.466) (-1019.405) [-1018.793] (-1018.017) * (-1017.705) (-1021.146) [-1016.744] (-1017.311) -- 0:00:01
972000 -- (-1015.854) [-1017.511] (-1016.300) (-1016.948) * (-1019.206) (-1017.184) [-1018.461] (-1015.870) -- 0:00:01
972500 -- (-1016.606) (-1018.562) (-1016.219) [-1016.948] * (-1018.615) (-1019.642) [-1019.337] (-1015.942) -- 0:00:01
973000 -- (-1016.247) [-1016.265] (-1017.970) (-1017.650) * [-1016.872] (-1017.044) (-1017.547) (-1016.351) -- 0:00:01
973500 -- (-1017.513) (-1018.028) (-1018.062) [-1017.028] * (-1020.577) (-1020.006) (-1017.381) [-1017.010] -- 0:00:01
974000 -- (-1017.137) [-1017.355] (-1019.600) (-1018.689) * (-1021.176) [-1018.677] (-1016.061) (-1016.875) -- 0:00:01
974500 -- (-1018.824) [-1017.980] (-1022.120) (-1017.449) * (-1021.357) (-1018.339) [-1016.343] (-1018.836) -- 0:00:01
975000 -- (-1016.845) (-1021.233) [-1020.238] (-1017.729) * (-1016.404) (-1018.665) (-1019.373) [-1018.135] -- 0:00:01
Average standard deviation of split frequencies: 0.006182
975500 -- (-1015.980) [-1016.535] (-1017.820) (-1018.533) * (-1016.004) (-1019.337) [-1016.076] (-1024.704) -- 0:00:01
976000 -- (-1019.084) [-1018.341] (-1019.794) (-1018.544) * (-1018.540) (-1018.240) [-1016.063] (-1019.643) -- 0:00:01
976500 -- (-1018.550) (-1018.309) (-1016.855) [-1016.403] * [-1017.415] (-1018.225) (-1017.979) (-1019.050) -- 0:00:01
977000 -- (-1022.290) [-1016.291] (-1017.900) (-1016.326) * (-1016.811) (-1018.051) (-1017.560) [-1018.074] -- 0:00:01
977500 -- (-1023.440) (-1015.641) (-1017.865) [-1021.691] * (-1019.782) [-1016.584] (-1017.733) (-1017.709) -- 0:00:01
978000 -- (-1016.953) (-1019.189) [-1018.247] (-1022.606) * [-1020.936] (-1016.743) (-1015.895) (-1022.481) -- 0:00:01
978500 -- (-1018.182) (-1021.060) [-1017.374] (-1021.332) * (-1018.555) [-1017.991] (-1017.689) (-1016.735) -- 0:00:01
979000 -- (-1017.852) (-1018.640) (-1015.442) [-1022.576] * (-1016.795) (-1016.948) (-1020.328) [-1018.884] -- 0:00:01
979500 -- (-1017.106) [-1016.110] (-1016.160) (-1017.981) * [-1018.534] (-1020.179) (-1017.827) (-1016.370) -- 0:00:01
980000 -- [-1017.292] (-1018.947) (-1016.194) (-1021.317) * (-1016.289) (-1016.626) [-1016.181] (-1017.104) -- 0:00:01
Average standard deviation of split frequencies: 0.006217
980500 -- (-1020.598) [-1018.817] (-1016.072) (-1022.139) * [-1018.229] (-1015.832) (-1017.492) (-1017.009) -- 0:00:01
981000 -- [-1019.446] (-1016.188) (-1019.758) (-1022.669) * [-1017.885] (-1018.951) (-1018.097) (-1018.322) -- 0:00:01
981500 -- [-1016.006] (-1019.482) (-1016.221) (-1021.975) * (-1022.008) (-1018.175) (-1016.964) [-1017.396] -- 0:00:01
982000 -- [-1019.041] (-1016.103) (-1018.755) (-1016.175) * [-1017.444] (-1018.143) (-1021.697) (-1017.309) -- 0:00:01
982500 -- (-1021.667) [-1019.164] (-1017.667) (-1015.363) * (-1016.982) (-1016.835) (-1019.910) [-1017.323] -- 0:00:01
983000 -- [-1018.410] (-1020.761) (-1018.855) (-1015.972) * (-1019.654) [-1016.542] (-1026.640) (-1018.555) -- 0:00:01
983500 -- (-1017.295) (-1018.288) [-1016.492] (-1017.652) * [-1018.556] (-1016.185) (-1020.256) (-1018.461) -- 0:00:01
984000 -- (-1015.459) [-1017.950] (-1016.937) (-1018.403) * [-1019.567] (-1017.582) (-1017.755) (-1018.631) -- 0:00:00
984500 -- (-1016.001) [-1016.778] (-1021.766) (-1018.952) * (-1015.467) (-1019.170) [-1016.293] (-1018.585) -- 0:00:00
985000 -- (-1021.069) [-1021.286] (-1020.327) (-1020.939) * (-1015.471) (-1017.301) [-1018.300] (-1016.781) -- 0:00:00
Average standard deviation of split frequencies: 0.006152
985500 -- [-1017.714] (-1019.321) (-1023.427) (-1018.016) * [-1018.967] (-1017.262) (-1023.559) (-1015.438) -- 0:00:00
986000 -- (-1018.548) (-1018.965) (-1028.622) [-1016.588] * [-1017.919] (-1015.994) (-1017.759) (-1019.894) -- 0:00:00
986500 -- (-1016.684) (-1016.850) (-1019.025) [-1017.174] * (-1022.654) (-1016.034) (-1018.086) [-1021.073] -- 0:00:00
987000 -- (-1018.214) (-1016.911) (-1019.980) [-1016.170] * (-1026.521) [-1019.020] (-1016.728) (-1019.445) -- 0:00:00
987500 -- (-1018.664) (-1015.459) (-1022.129) [-1017.360] * (-1019.401) (-1018.550) (-1018.865) [-1015.894] -- 0:00:00
988000 -- (-1020.851) [-1016.002] (-1016.673) (-1017.526) * (-1022.392) (-1016.498) (-1017.856) [-1017.676] -- 0:00:00
988500 -- (-1022.316) [-1017.533] (-1018.090) (-1017.987) * (-1015.651) [-1018.171] (-1016.629) (-1021.064) -- 0:00:00
989000 -- (-1016.877) (-1017.650) [-1016.187] (-1017.389) * (-1016.814) [-1016.712] (-1016.535) (-1016.936) -- 0:00:00
989500 -- (-1016.612) (-1018.569) [-1016.082] (-1017.795) * (-1017.120) (-1017.856) [-1017.979] (-1020.012) -- 0:00:00
990000 -- (-1016.333) (-1019.324) (-1017.157) [-1018.658] * (-1017.542) (-1019.610) [-1016.572] (-1018.298) -- 0:00:00
Average standard deviation of split frequencies: 0.006123
990500 -- (-1018.060) [-1019.326] (-1017.114) (-1016.723) * [-1015.920] (-1018.541) (-1019.029) (-1017.402) -- 0:00:00
991000 -- (-1018.893) (-1026.164) [-1018.635] (-1018.550) * [-1015.991] (-1018.561) (-1018.645) (-1017.346) -- 0:00:00
991500 -- (-1019.579) [-1016.502] (-1019.794) (-1018.986) * (-1020.556) (-1016.830) (-1018.884) [-1016.293] -- 0:00:00
992000 -- [-1017.463] (-1018.389) (-1018.851) (-1020.349) * (-1022.636) (-1021.425) (-1018.827) [-1018.206] -- 0:00:00
992500 -- (-1015.641) (-1015.467) (-1017.195) [-1017.787] * (-1017.505) (-1021.042) [-1019.436] (-1018.445) -- 0:00:00
993000 -- (-1017.373) (-1016.683) [-1019.224] (-1017.686) * (-1019.001) (-1017.973) (-1018.583) [-1020.316] -- 0:00:00
993500 -- (-1020.675) (-1018.432) [-1018.154] (-1024.281) * (-1018.923) (-1016.246) [-1018.036] (-1020.128) -- 0:00:00
994000 -- (-1016.407) (-1017.285) (-1018.683) [-1019.588] * [-1016.768] (-1016.516) (-1018.797) (-1016.385) -- 0:00:00
994500 -- (-1018.388) [-1017.304] (-1024.850) (-1016.490) * (-1017.371) [-1015.897] (-1019.165) (-1018.553) -- 0:00:00
995000 -- (-1016.569) (-1015.762) [-1018.742] (-1016.443) * [-1016.794] (-1019.422) (-1021.409) (-1019.185) -- 0:00:00
Average standard deviation of split frequencies: 0.006437
995500 -- (-1019.720) [-1019.356] (-1017.701) (-1018.017) * (-1016.243) (-1022.549) (-1021.740) [-1016.950] -- 0:00:00
996000 -- (-1017.232) [-1018.827] (-1019.632) (-1022.437) * (-1018.242) [-1016.795] (-1019.752) (-1016.532) -- 0:00:00
996500 -- [-1015.473] (-1017.468) (-1016.014) (-1020.095) * (-1020.229) (-1019.960) [-1015.767] (-1016.393) -- 0:00:00
997000 -- (-1017.085) (-1020.462) (-1017.192) [-1015.907] * (-1016.721) (-1017.572) (-1016.359) [-1016.388] -- 0:00:00
997500 -- (-1019.507) (-1019.817) [-1016.058] (-1017.543) * [-1018.767] (-1015.970) (-1017.160) (-1018.858) -- 0:00:00
998000 -- [-1016.899] (-1019.258) (-1016.310) (-1020.669) * (-1018.774) (-1015.831) [-1017.603] (-1017.881) -- 0:00:00
998500 -- (-1017.195) [-1018.673] (-1016.448) (-1020.063) * (-1020.738) (-1016.057) [-1017.592] (-1017.603) -- 0:00:00
999000 -- (-1018.237) (-1026.838) (-1017.273) [-1020.581] * (-1016.419) (-1016.696) (-1015.911) [-1016.529] -- 0:00:00
999500 -- (-1018.516) (-1016.626) (-1017.570) [-1017.144] * (-1015.963) (-1019.336) (-1016.107) [-1017.247] -- 0:00:00
1000000 -- [-1018.070] (-1017.858) (-1019.422) (-1017.943) * (-1019.048) (-1022.839) [-1016.101] (-1016.098) -- 0:00:00
Average standard deviation of split frequencies: 0.006187
Analysis completed in 1 mins 1 seconds
Analysis used 59.85 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1015.26
Likelihood of best state for "cold" chain of run 2 was -1015.26
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 60 %) Dirichlet(Revmat{all})
99.9 % ( 98 %) Slider(Revmat{all})
28.3 % ( 37 %) Dirichlet(Pi{all})
28.8 % ( 32 %) Slider(Pi{all})
78.4 % ( 51 %) Multiplier(Alpha{1,2})
77.8 % ( 43 %) Multiplier(Alpha{3})
20.0 % ( 20 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.0 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 36 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.6 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 78 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
27.8 % ( 28 %) Dirichlet(Pi{all})
29.2 % ( 26 %) Slider(Pi{all})
78.5 % ( 58 %) Multiplier(Alpha{1,2})
78.0 % ( 60 %) Multiplier(Alpha{3})
20.3 % ( 18 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 94 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166772 0.83 0.67
3 | 166828 166062 0.84
4 | 167461 166522 166355
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166441 0.82 0.67
3 | 166432 167562 0.84
4 | 166687 166340 166538
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1016.96
| 1 |
| 1 2 1 1 2 2 |
| 1 2|
| 2 1 2 1 |
| 1 2 2 2 2 2 |
|1 11 2 2 1 2 2 1 |
| 2 1 1 1 1 1 1 2 2 21 |
| 2 22 2 21 1 2 2 1 11 2 2 |
|2 2 1 221 1 * 2 2 2 1 1 1 2 1 1 1|
| 1 2 1 1 2 2 2 21 * 1 2 1* |
| 1 2 11 2 1 1 1 |
| 2 1 2 1 2 22 2 2 |
| 1 1 2 1 1 1 1 |
| 2 1 |
| 2 1 2 2 21 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1018.33
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1016.97 -1019.37
2 -1016.96 -1019.99
--------------------------------------
TOTAL -1016.96 -1019.73
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886840 0.085113 0.370713 1.457604 0.854733 1501.00 1501.00 1.000
r(A<->C){all} 0.172357 0.021780 0.000070 0.471496 0.134249 193.68 236.10 1.000
r(A<->G){all} 0.165140 0.020033 0.000010 0.455532 0.128002 170.01 206.04 1.001
r(A<->T){all} 0.162999 0.017838 0.000025 0.431778 0.130954 192.94 236.86 1.007
r(C<->G){all} 0.165286 0.021317 0.000035 0.449568 0.124811 196.93 197.79 1.000
r(C<->T){all} 0.160626 0.018912 0.000008 0.433784 0.124259 181.79 243.19 1.000
r(G<->T){all} 0.173592 0.020976 0.000094 0.473759 0.137078 221.02 226.20 1.003
pi(A){all} 0.200478 0.000210 0.173020 0.228853 0.199739 1214.98 1326.04 1.000
pi(C){all} 0.294834 0.000272 0.264726 0.328537 0.294757 1289.83 1309.32 1.000
pi(G){all} 0.328147 0.000276 0.297320 0.361494 0.328017 1194.41 1208.65 1.000
pi(T){all} 0.176541 0.000189 0.149826 0.202976 0.176215 1393.73 1447.37 1.000
alpha{1,2} 0.428726 0.255305 0.000304 1.458503 0.248434 1200.10 1272.87 1.000
alpha{3} 0.457938 0.231091 0.000173 1.422572 0.308353 778.77 901.26 1.000
pinvar{all} 0.998028 0.000005 0.993662 0.999999 0.998729 988.40 1144.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .***.*
8 -- ..*..*
9 -- ..****
10 -- .*..*.
11 -- ..**..
12 -- ....**
13 -- .**...
14 -- .*.***
15 -- .*...*
16 -- ...*.*
17 -- .*.*..
18 -- .****.
19 -- ...**.
20 -- ..*.*.
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 447 0.148901 0.001413 0.147901 0.149900 2
8 445 0.148235 0.006124 0.143904 0.152565 2
9 445 0.148235 0.000471 0.147901 0.148568 2
10 439 0.146236 0.012719 0.137242 0.155230 2
11 435 0.144903 0.005182 0.141239 0.148568 2
12 427 0.142239 0.000471 0.141905 0.142572 2
13 427 0.142239 0.003298 0.139907 0.144570 2
14 427 0.142239 0.016488 0.130580 0.153897 2
15 425 0.141572 0.024026 0.124584 0.158561 2
16 423 0.140906 0.001413 0.139907 0.141905 2
17 419 0.139574 0.001413 0.138574 0.140573 2
18 419 0.139574 0.012719 0.130580 0.148568 2
19 415 0.138241 0.004240 0.135243 0.141239 2
20 413 0.137575 0.001413 0.136576 0.138574 2
21 407 0.135576 0.001413 0.134577 0.136576 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.099672 0.009846 0.000015 0.298634 0.069339 1.000 2
length{all}[2] 0.097562 0.009067 0.000004 0.289223 0.067955 1.000 2
length{all}[3] 0.098737 0.010262 0.000006 0.303346 0.066701 1.000 2
length{all}[4] 0.097890 0.009356 0.000010 0.299695 0.067380 1.001 2
length{all}[5] 0.099418 0.009964 0.000035 0.302234 0.067440 1.000 2
length{all}[6] 0.098924 0.010075 0.000029 0.302853 0.068966 1.000 2
length{all}[7] 0.090876 0.007679 0.000067 0.281087 0.061858 1.014 2
length{all}[8] 0.097524 0.009195 0.000283 0.296490 0.069474 0.998 2
length{all}[9] 0.103789 0.010114 0.000327 0.296631 0.079818 0.998 2
length{all}[10] 0.098487 0.010295 0.000025 0.307594 0.065825 0.999 2
length{all}[11] 0.102016 0.009411 0.000120 0.308168 0.073062 0.998 2
length{all}[12] 0.097907 0.009137 0.000259 0.295107 0.065016 0.998 2
length{all}[13] 0.105989 0.011203 0.000198 0.330486 0.071420 0.998 2
length{all}[14] 0.106323 0.011774 0.000178 0.334872 0.071109 0.999 2
length{all}[15] 0.098558 0.009227 0.000088 0.279471 0.069007 0.998 2
length{all}[16] 0.096337 0.009844 0.000083 0.300276 0.067262 1.004 2
length{all}[17] 0.095508 0.009061 0.000125 0.294408 0.065868 1.005 2
length{all}[18] 0.097938 0.010551 0.000038 0.294845 0.063274 0.998 2
length{all}[19] 0.100919 0.011864 0.000153 0.324562 0.065083 1.000 2
length{all}[20] 0.092116 0.007774 0.000201 0.262828 0.063745 0.998 2
length{all}[21] 0.104001 0.012141 0.000040 0.303573 0.072137 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006187
Maximum standard deviation of split frequencies = 0.024026
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.014
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 750
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 51 patterns at 250 / 250 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 51 patterns at 250 / 250 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
49776 bytes for conP
4488 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.012676 0.014569 0.073980 0.047766 0.038688 0.080416 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1050.071860
Iterating by ming2
Initial: fx= 1050.071860
x= 0.01268 0.01457 0.07398 0.04777 0.03869 0.08042 0.30000 1.30000
1 h-m-p 0.0000 0.0001 599.9569 ++ 1031.535240 m 0.0001 13 | 1/8
2 h-m-p 0.0006 0.0068 47.0019 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 548.2932 ++ 1029.223700 m 0.0000 44 | 2/8
4 h-m-p 0.0001 0.0083 38.8537 ---------.. | 2/8
5 h-m-p 0.0000 0.0001 489.7672 ++ 1005.576888 m 0.0001 73 | 3/8
6 h-m-p 0.0014 0.0111 29.5047 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 425.4384 ++ 998.859774 m 0.0000 104 | 4/8
8 h-m-p 0.0007 0.0180 19.0589 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 347.3201 ++ 985.849545 m 0.0001 135 | 5/8
10 h-m-p 0.0024 0.0332 11.1437 ------------.. | 5/8
11 h-m-p 0.0000 0.0000 246.6097 ++ 984.240130 m 0.0000 167 | 6/8
12 h-m-p 0.1446 8.0000 0.0000 Y 984.240130 0 0.0362 178 | 6/8
13 h-m-p 0.2623 8.0000 0.0000 --------------Y 984.240130 0 0.0000 205
Out..
lnL = -984.240130
206 lfun, 206 eigenQcodon, 1236 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077123 0.022945 0.022383 0.105324 0.050563 0.075878 0.299957 0.878266 0.171786
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 16.300347
np = 9
lnL0 = -1068.064837
Iterating by ming2
Initial: fx= 1068.064837
x= 0.07712 0.02295 0.02238 0.10532 0.05056 0.07588 0.29996 0.87827 0.17179
1 h-m-p 0.0000 0.0001 559.0837 ++ 1037.354348 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0000 665.0103 ++ 1036.685585 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0002 400.9094 +++ 1012.033297 m 0.0002 39 | 3/9
4 h-m-p 0.0000 0.0002 551.9487 ++ 991.208514 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0000 1147.1988 ++ 990.477756 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 3829.3147 ++ 990.162108 m 0.0000 75 | 6/9
7 h-m-p 0.0001 0.0330 12.8268 ----------.. | 6/9
8 h-m-p 0.0000 0.0001 241.7550 ++ 984.240163 m 0.0001 107 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 ++ 984.240163 m 8.0000 119 | 6/9
10 h-m-p 0.4053 8.0000 0.0001 +++ 984.240163 m 8.0000 134 | 6/9
11 h-m-p 0.0060 0.0300 0.0316 --------C 984.240163 0 0.0000 157 | 6/9
12 h-m-p 0.0160 8.0000 0.0004 -------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 984.240163 m 8.0000 201 | 6/9
14 h-m-p 0.0110 5.4836 0.1581 +++++ 984.240129 m 5.4836 219 | 7/9
15 h-m-p 1.6000 8.0000 0.0264 ++ 984.240128 m 8.0000 234 | 7/9
16 h-m-p 0.1389 0.6947 0.2308 ++ 984.240128 m 0.6947 248 | 8/9
17 h-m-p 1.6000 8.0000 0.0001 -N 984.240128 0 0.1000 263 | 8/9
18 h-m-p 0.6667 8.0000 0.0000 Y 984.240128 0 0.6667 276 | 8/9
19 h-m-p 1.6000 8.0000 0.0000 N 984.240128 0 1.6000 289 | 8/9
20 h-m-p 0.0002 0.0789 2.6704 -Y 984.240128 0 0.0000 303 | 8/9
21 h-m-p 1.6000 8.0000 0.0000 N 984.240128 0 1.6000 315 | 8/9
22 h-m-p 0.0160 8.0000 0.0000 N 984.240128 0 0.0160 328
Out..
lnL = -984.240128
329 lfun, 987 eigenQcodon, 3948 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.049882 0.028830 0.066609 0.064111 0.084650 0.025004 0.000100 0.970973 0.571141 0.296676 1.446587
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.513752
np = 11
lnL0 = -1059.856481
Iterating by ming2
Initial: fx= 1059.856481
x= 0.04988 0.02883 0.06661 0.06411 0.08465 0.02500 0.00011 0.97097 0.57114 0.29668 1.44659
1 h-m-p 0.0000 0.0000 558.5546 ++ 1058.441667 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0008 224.6116 ++++ 1023.671264 m 0.0008 32 | 2/11
3 h-m-p 0.0000 0.0000 540.1769 ++ 1019.753298 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0005 240.0947 ++ 1005.242972 m 0.0005 60 | 4/11
5 h-m-p 0.0004 0.0022 44.7695 ++ 1003.486731 m 0.0022 74 | 5/11
6 h-m-p 0.0000 0.0001 440.7916 ++ 994.058408 m 0.0001 88 | 6/11
7 h-m-p 0.0003 0.0017 47.7445 ++ 993.755577 m 0.0017 102 | 7/11
8 h-m-p 0.0135 6.7545 30.5160 -------------.. | 7/11
9 h-m-p 0.0000 0.0002 238.0069 +++ 984.240132 m 0.0002 142 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 984.240132 m 8.0000 156 | 8/11
11 h-m-p 0.0215 8.0000 0.0018 +++++ 984.240132 m 8.0000 176 | 8/11
12 h-m-p 0.0160 8.0000 1.8779 ++++Y 984.240124 0 4.0960 197 | 8/11
13 h-m-p 1.6000 8.0000 0.1467 C 984.240124 0 0.4925 211 | 8/11
14 h-m-p 1.6000 8.0000 0.0005 ++ 984.240124 m 8.0000 228 | 8/11
15 h-m-p 1.3616 8.0000 0.0030 ++ 984.240124 m 8.0000 245 | 8/11
16 h-m-p 0.0687 8.0000 0.3514 -----Y 984.240124 0 0.0000 267 | 8/11
17 h-m-p 0.1170 8.0000 0.0001 ++++ 984.240124 m 8.0000 286 | 8/11
18 h-m-p 0.0160 8.0000 0.3892 +++++ 984.240121 m 8.0000 306 | 8/11
19 h-m-p 1.4142 8.0000 2.2019 ++ 984.240120 m 8.0000 323 | 8/11
20 h-m-p 1.6000 8.0000 0.7484 ++ 984.240120 m 8.0000 337 | 8/11
21 h-m-p 0.5848 8.0000 10.2379 ++ 984.240119 m 8.0000 354 | 8/11
22 h-m-p 1.6000 8.0000 0.0000 C 984.240119 0 1.6000 368 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 +++++ 984.240119 m 8.0000 388 | 7/11
24 h-m-p 0.3906 8.0000 0.0002 +++ 984.240119 m 8.0000 407 | 7/11
25 h-m-p 0.0160 8.0000 0.3634 +++++ 984.240111 m 8.0000 428 | 7/11
26 h-m-p 1.6000 8.0000 0.6583 ++ 984.240108 m 8.0000 446 | 7/11
27 h-m-p 1.6000 8.0000 1.6658 ++ 984.240106 m 8.0000 464 | 7/11
28 h-m-p 1.6000 8.0000 0.5240 ++ 984.240106 m 8.0000 478 | 7/11
29 h-m-p 0.7274 4.4587 5.7625 ---------Y 984.240106 0 0.0000 505 | 7/11
30 h-m-p 1.6000 8.0000 0.0000 C 984.240106 0 0.4000 519 | 7/11
31 h-m-p 1.6000 8.0000 0.0000 --------------N 984.240106 0 0.0000 551
Out..
lnL = -984.240106
552 lfun, 2208 eigenQcodon, 9936 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -984.234568 S = -984.234260 -0.000118
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:04
did 20 / 51 patterns 0:04
did 30 / 51 patterns 0:04
did 40 / 51 patterns 0:04
did 50 / 51 patterns 0:04
did 51 / 51 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015335 0.069290 0.014286 0.046729 0.038892 0.074510 25.693380 0.849717 1.308898
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 1.135352
np = 9
lnL0 = -1046.924877
Iterating by ming2
Initial: fx= 1046.924877
x= 0.01533 0.06929 0.01429 0.04673 0.03889 0.07451 25.69338 0.84972 1.30890
1 h-m-p 0.0000 0.0001 577.4657 ++ 1026.823823 m 0.0001 14 | 1/9
2 h-m-p 0.0013 0.0347 24.7259 -----------.. | 1/9
3 h-m-p 0.0000 0.0000 535.7260 ++ 1025.579359 m 0.0000 47 | 2/9
4 h-m-p 0.0001 0.0472 18.2647 ----------.. | 2/9
5 h-m-p 0.0000 0.0001 477.6840 ++ 1002.825013 m 0.0001 79 | 3/9
6 h-m-p 0.0035 0.0766 11.4615 ------------.. | 3/9
7 h-m-p 0.0000 0.0000 422.9907 ++ 996.998442 m 0.0000 113 | 4/9
8 h-m-p 0.0025 0.2488 4.4213 ------------.. | 4/9
9 h-m-p 0.0000 0.0001 346.4308 ++ 985.590366 m 0.0001 147 | 5/9
10 h-m-p 0.0095 0.6405 2.4194 -------------.. | 5/9
11 h-m-p 0.0000 0.0000 249.1909 ++ 984.240206 m 0.0000 182 | 6/9
12 h-m-p 0.1085 8.0000 0.0000 ++++ 984.240206 m 8.0000 196 | 6/9
13 h-m-p 0.0160 8.0000 0.0022 +++++ 984.240206 m 8.0000 214 | 6/9
14 h-m-p 0.0244 8.0000 0.7116 +++++ 984.240204 m 8.0000 232 | 6/9
15 h-m-p 1.6000 8.0000 0.3214 ++ 984.240203 m 8.0000 247 | 6/9
16 h-m-p 0.7412 8.0000 3.4692 ++ 984.240203 m 8.0000 262 | 6/9
17 h-m-p 1.4170 7.0850 5.2918 -----------C 984.240203 0 0.0000 285 | 6/9
18 h-m-p 1.3209 8.0000 0.0000 C 984.240203 0 1.3209 297 | 6/9
19 h-m-p 0.1609 8.0000 0.0000 Y 984.240203 0 0.0402 312
Out..
lnL = -984.240203
313 lfun, 3443 eigenQcodon, 18780 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.037386 0.023680 0.083345 0.085989 0.089671 0.032794 24.653318 0.900000 0.818375 1.557965 1.300016
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 1.113478
np = 11
lnL0 = -1067.310765
Iterating by ming2
Initial: fx= 1067.310765
x= 0.03739 0.02368 0.08335 0.08599 0.08967 0.03279 24.65332 0.90000 0.81838 1.55796 1.30002
1 h-m-p 0.0000 0.0001 548.5611 ++ 1035.417438 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0005 169.7127 ++ 1023.322239 m 0.0005 30 | 2/11
3 h-m-p 0.0000 0.0000 589.3748 ++ 1018.486675 m 0.0000 44 | 3/11
4 h-m-p 0.0001 0.0029 162.6716 +++ 987.123593 m 0.0029 59 | 4/11
5 h-m-p 0.0000 0.0000 2905.2318 ++ 985.421678 m 0.0000 73 | 5/11
6 h-m-p 0.0001 0.0005 851.3930 ++ 984.240144 m 0.0005 87 | 6/11
7 h-m-p 1.6000 8.0000 0.0017 ++ 984.240144 m 8.0000 101 | 6/11
8 h-m-p 0.0307 0.5236 0.4396 +++ 984.240137 m 0.5236 121 | 7/11
9 h-m-p 0.0591 0.2955 1.2837 ++ 984.240134 m 0.2955 140 | 7/11
10 h-m-p 0.0000 0.0000 1.3348
h-m-p: 1.04134085e-18 5.20670423e-18 1.33482887e+00 984.240134
.. | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 984.240134 m 8.0000 168 | 7/11
12 h-m-p 0.0221 8.0000 0.0039 ------C 984.240134 0 0.0000 192 | 7/11
13 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
14 h-m-p 0.0160 8.0000 0.0000 +++++ 984.240134 m 8.0000 242 | 7/11
15 h-m-p 0.0160 8.0000 0.2546 +++++ 984.240121 m 8.0000 263 | 7/11
16 h-m-p 1.6000 8.0000 0.9616 ++ 984.240110 m 8.0000 281 | 7/11
17 h-m-p 1.6000 8.0000 1.2989 ++ 984.240108 m 8.0000 299 | 7/11
18 h-m-p 1.6000 8.0000 6.2875 ++ 984.240105 m 8.0000 313 | 7/11
19 h-m-p 1.6000 8.0000 8.7319 ----------------.. | 7/11
20 h-m-p 0.0160 8.0000 0.0000 ---Y 984.240105 0 0.0001 358 | 7/11
21 h-m-p 0.0677 8.0000 0.0000 ----Y 984.240105 0 0.0001 380
Out..
lnL = -984.240105
381 lfun, 4572 eigenQcodon, 25146 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -984.234498 S = -984.234240 -0.000113
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 51 patterns 0:15
did 20 / 51 patterns 0:16
did 30 / 51 patterns 0:16
did 40 / 51 patterns 0:16
did 50 / 51 patterns 0:16
did 51 / 51 patterns 0:16
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=250
NC_011896_1_WP_010907969_1_896_MLBR_RS04215 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
NC_002677_1_NP_301645_1_517_ML0857 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM
**************************************************
NC_011896_1_WP_010907969_1_896_MLBR_RS04215 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
NC_002677_1_NP_301645_1_517_ML0857 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730 IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV
**************************************************
NC_011896_1_WP_010907969_1_896_MLBR_RS04215 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
NC_002677_1_NP_301645_1_517_ML0857 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730 YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA
**************************************************
NC_011896_1_WP_010907969_1_896_MLBR_RS04215 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
NC_002677_1_NP_301645_1_517_ML0857 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730 EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR
**************************************************
NC_011896_1_WP_010907969_1_896_MLBR_RS04215 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
NC_002677_1_NP_301645_1_517_ML0857 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730 LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
**************************************************
>NC_011896_1_WP_010907969_1_896_MLBR_RS04215 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG >NC_002677_1_NP_301645_1_517_ML0857 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG >NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG >NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG >NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG >NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730 ATGGCTAAACCCCGAAATGCCGCTGCGCACAAGGCCGCGAGAGCGGAGGC GAAAGCTGCCCGTAAGGCCGCGTCTCGACAACGCCGCCTTCAGTTGTGGC AGGCGTTCACGATTCAACGCACGGAAGACAAGCGACTGATACCGTACATG ATTGCCGCCTTCTCCTTGATGGTGAGCGCCTCGGTGACGGCAGGAGTTCT AGTCGGCGGATTGACCATGATCACCTTGATCCTGCTCGGCGTGGTGCTCG GCGCGTTGGTGGCGTTCATCATCTTCGGTCGACGGACCCAGCAATCGGTC TACCACAAAGCCGAAGGCCAAACCGGCGGAGCGGCATGGGCCCTGGACAA TCTGCGTGGCAAGTGGCGGGTGAGCCCGGGTGTGGCCGCTAATGGCCACT TTGACGCGGTGCATCGGGTGATCGGCCGTCCTGGCGTAATCTTCGTCGCC GAGGGATCGGCTGCCCGAGTCAAACCGCTGTTAGCGCAGGAGAAGAAGCG CACCGCACGCTTGGTCGGCGACGTACCGATCTACGACATCATAGTCGGCA ACGGCGACGGTGAGGTTGCGCTGGTCAAGTTGGAGCGCCACCTCGCCCGC TTGCCTGCCAATATCAGCGTAAAACAAGTCGACATACTGGAATCGCGGCT GGCAGCACTGGGATCGCGAGCTGGTGCGAGTCTTATACCGAAGGGACCGC TGCCCAACGCCGGCAAGATGCGCGGCGTGCAACGCACGGTGCGCCGCAAG
>NC_011896_1_WP_010907969_1_896_MLBR_RS04215 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK >NC_002677_1_NP_301645_1_517_ML0857 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK >NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK >NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK >NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK >NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730 MAKPRNAAAHKAARAEAKAARKAASRQRRLQLWQAFTIQRTEDKRLIPYM IAAFSLMVSASVTAGVLVGGLTMITLILLGVVLGALVAFIIFGRRTQQSV YHKAEGQTGGAAWALDNLRGKWRVSPGVAANGHFDAVHRVIGRPGVIFVA EGSAARVKPLLAQEKKRTARLVGDVPIYDIIVGNGDGEVALVKLERHLAR LPANISVKQVDILESRLAALGSRAGASLIPKGPLPNAGKMRGVQRTVRRK
#NEXUS
[ID: 0878497501]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907969_1_896_MLBR_RS04215
NC_002677_1_NP_301645_1_517_ML0857
NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255
NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885
NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645
NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907969_1_896_MLBR_RS04215,
2 NC_002677_1_NP_301645_1_517_ML0857,
3 NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255,
4 NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885,
5 NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645,
6 NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0693387,2:0.06795499,3:0.06670088,4:0.06737991,5:0.06743994,6:0.06896636);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0693387,2:0.06795499,3:0.06670088,4:0.06737991,5:0.06743994,6:0.06896636);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1016.97 -1019.37
2 -1016.96 -1019.99
--------------------------------------
TOTAL -1016.96 -1019.73
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/5res/ML0857/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886840 0.085113 0.370713 1.457604 0.854733 1501.00 1501.00 1.000
r(A<->C){all} 0.172357 0.021780 0.000070 0.471496 0.134249 193.68 236.10 1.000
r(A<->G){all} 0.165140 0.020033 0.000010 0.455532 0.128002 170.01 206.04 1.001
r(A<->T){all} 0.162999 0.017838 0.000025 0.431778 0.130954 192.94 236.86 1.007
r(C<->G){all} 0.165286 0.021317 0.000035 0.449568 0.124811 196.93 197.79 1.000
r(C<->T){all} 0.160626 0.018912 0.000008 0.433784 0.124259 181.79 243.19 1.000
r(G<->T){all} 0.173592 0.020976 0.000094 0.473759 0.137078 221.02 226.20 1.003
pi(A){all} 0.200478 0.000210 0.173020 0.228853 0.199739 1214.98 1326.04 1.000
pi(C){all} 0.294834 0.000272 0.264726 0.328537 0.294757 1289.83 1309.32 1.000
pi(G){all} 0.328147 0.000276 0.297320 0.361494 0.328017 1194.41 1208.65 1.000
pi(T){all} 0.176541 0.000189 0.149826 0.202976 0.176215 1393.73 1447.37 1.000
alpha{1,2} 0.428726 0.255305 0.000304 1.458503 0.248434 1200.10 1272.87 1.000
alpha{3} 0.457938 0.231091 0.000173 1.422572 0.308353 778.77 901.26 1.000
pinvar{all} 0.998028 0.000005 0.993662 0.999999 0.998729 988.40 1144.15 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/5res/ML0857/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 250
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 1 1 1 1 1 1 | TAC 3 3 3 3 3 3 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 5 5 5 5 5 5 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 3 3 3 3 3 3 | CCC 2 2 2 2 2 2 | CAC 4 4 4 4 4 4 | CGC 11 11 11 11 11 11
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 6 6 6 6 6 6 | CGA 6 6 6 6 6 6
CTG 10 10 10 10 10 10 | CCG 6 6 6 6 6 6 | CAG 4 4 4 4 4 4 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 9 9 9 9 9 9 | ACC 5 5 5 5 5 5 | AAC 2 2 2 2 2 2 | AGC 3 3 3 3 3 3
ATA 4 4 4 4 4 4 | ACA 0 0 0 0 0 0 | Lys AAA 5 5 5 5 5 5 | Arg AGA 1 1 1 1 1 1
Met ATG 5 5 5 5 5 5 | ACG 4 4 4 4 4 4 | AAG 10 10 10 10 10 10 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 6 6 6 6 6 6 | Asp GAT 0 0 0 0 0 0 | Gly GGT 4 4 4 4 4 4
GTC 8 8 8 8 8 8 | GCC 15 15 15 15 15 15 | GAC 7 7 7 7 7 7 | GGC 14 14 14 14 14 14
GTA 3 3 3 3 3 3 | GCA 5 5 5 5 5 5 | Glu GAA 3 3 3 3 3 3 | GGA 6 6 6 6 6 6
GTG 11 11 11 11 11 11 | GCG 13 13 13 13 13 13 | GAG 5 5 5 5 5 5 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907969_1_896_MLBR_RS04215
position 1: T:0.11200 C:0.26000 A:0.22000 G:0.40800
position 2: T:0.30000 C:0.26000 A:0.21600 G:0.22400
position 3: T:0.11600 C:0.36800 A:0.16400 G:0.35200
Average T:0.17600 C:0.29600 A:0.20000 G:0.32800
#2: NC_002677_1_NP_301645_1_517_ML0857
position 1: T:0.11200 C:0.26000 A:0.22000 G:0.40800
position 2: T:0.30000 C:0.26000 A:0.21600 G:0.22400
position 3: T:0.11600 C:0.36800 A:0.16400 G:0.35200
Average T:0.17600 C:0.29600 A:0.20000 G:0.32800
#3: NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255
position 1: T:0.11200 C:0.26000 A:0.22000 G:0.40800
position 2: T:0.30000 C:0.26000 A:0.21600 G:0.22400
position 3: T:0.11600 C:0.36800 A:0.16400 G:0.35200
Average T:0.17600 C:0.29600 A:0.20000 G:0.32800
#4: NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885
position 1: T:0.11200 C:0.26000 A:0.22000 G:0.40800
position 2: T:0.30000 C:0.26000 A:0.21600 G:0.22400
position 3: T:0.11600 C:0.36800 A:0.16400 G:0.35200
Average T:0.17600 C:0.29600 A:0.20000 G:0.32800
#5: NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645
position 1: T:0.11200 C:0.26000 A:0.22000 G:0.40800
position 2: T:0.30000 C:0.26000 A:0.21600 G:0.22400
position 3: T:0.11600 C:0.36800 A:0.16400 G:0.35200
Average T:0.17600 C:0.29600 A:0.20000 G:0.32800
#6: NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730
position 1: T:0.11200 C:0.26000 A:0.22000 G:0.40800
position 2: T:0.30000 C:0.26000 A:0.21600 G:0.22400
position 3: T:0.11600 C:0.36800 A:0.16400 G:0.35200
Average T:0.17600 C:0.29600 A:0.20000 G:0.32800
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 30 | TCC 6 | TAC 18 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 30 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 18
CTC 18 | CCC 12 | CAC 24 | CGC 66
CTA 6 | CCA 0 | Gln Q CAA 36 | CGA 36
CTG 60 | CCG 36 | CAG 24 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 24 | Ser S AGT 6
ATC 54 | ACC 30 | AAC 12 | AGC 18
ATA 24 | ACA 0 | Lys K AAA 30 | Arg R AGA 6
Met M ATG 30 | ACG 24 | AAG 60 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 36 | Asp D GAT 0 | Gly G GGT 24
GTC 48 | GCC 90 | GAC 42 | GGC 84
GTA 18 | GCA 30 | Glu E GAA 18 | GGA 36
GTG 66 | GCG 78 | GAG 30 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11200 C:0.26000 A:0.22000 G:0.40800
position 2: T:0.30000 C:0.26000 A:0.21600 G:0.22400
position 3: T:0.11600 C:0.36800 A:0.16400 G:0.35200
Average T:0.17600 C:0.29600 A:0.20000 G:0.32800
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -984.240130 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299957 1.300016
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907969_1_896_MLBR_RS04215: 0.000004, NC_002677_1_NP_301645_1_517_ML0857: 0.000004, NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255: 0.000004, NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885: 0.000004, NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645: 0.000004, NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29996
omega (dN/dS) = 1.30002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 564.1 185.9 1.3000 0.0000 0.0000 0.0 0.0
7..2 0.000 564.1 185.9 1.3000 0.0000 0.0000 0.0 0.0
7..3 0.000 564.1 185.9 1.3000 0.0000 0.0000 0.0 0.0
7..4 0.000 564.1 185.9 1.3000 0.0000 0.0000 0.0 0.0
7..5 0.000 564.1 185.9 1.3000 0.0000 0.0000 0.0 0.0
7..6 0.000 564.1 185.9 1.3000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -984.240128 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.789217
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907969_1_896_MLBR_RS04215: 0.000004, NC_002677_1_NP_301645_1_517_ML0857: 0.000004, NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255: 0.000004, NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885: 0.000004, NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645: 0.000004, NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.78922 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 567.3 182.7 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 567.3 182.7 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 567.3 182.7 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 567.3 182.7 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 567.3 182.7 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 567.3 182.7 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -984.240106 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 25.693380 0.000000 0.000000 0.000001 46.524871
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907969_1_896_MLBR_RS04215: 0.000004, NC_002677_1_NP_301645_1_517_ML0857: 0.000004, NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255: 0.000004, NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885: 0.000004, NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645: 0.000004, NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 25.69338
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 46.52487
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 543.4 206.6 46.5249 0.0000 0.0000 0.0 0.0
7..2 0.000 543.4 206.6 46.5249 0.0000 0.0000 0.0 0.0
7..3 0.000 543.4 206.6 46.5249 0.0000 0.0000 0.0 0.0
7..4 0.000 543.4 206.6 46.5249 0.0000 0.0000 0.0 0.0
7..5 0.000 543.4 206.6 46.5249 0.0000 0.0000 0.0 0.0
7..6 0.000 543.4 206.6 46.5249 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907969_1_896_MLBR_RS04215)
Pr(w>1) post mean +- SE for w
1 M 1.000** 46.525
2 A 1.000** 46.525
3 K 1.000** 46.525
4 P 1.000** 46.525
5 R 1.000** 46.525
6 N 1.000** 46.525
7 A 1.000** 46.525
8 A 1.000** 46.525
9 A 1.000** 46.525
10 H 1.000** 46.525
11 K 1.000** 46.525
12 A 1.000** 46.525
13 A 1.000** 46.525
14 R 1.000** 46.525
15 A 1.000** 46.525
16 E 1.000** 46.525
17 A 1.000** 46.525
18 K 1.000** 46.525
19 A 1.000** 46.525
20 A 1.000** 46.525
21 R 1.000** 46.525
22 K 1.000** 46.525
23 A 1.000** 46.525
24 A 1.000** 46.525
25 S 1.000** 46.525
26 R 1.000** 46.525
27 Q 1.000** 46.525
28 R 1.000** 46.525
29 R 1.000** 46.525
30 L 1.000** 46.525
31 Q 1.000** 46.525
32 L 1.000** 46.525
33 W 1.000** 46.525
34 Q 1.000** 46.525
35 A 1.000** 46.525
36 F 1.000** 46.525
37 T 1.000** 46.525
38 I 1.000** 46.525
39 Q 1.000** 46.525
40 R 1.000** 46.525
41 T 1.000** 46.525
42 E 1.000** 46.525
43 D 1.000** 46.525
44 K 1.000** 46.525
45 R 1.000** 46.525
46 L 1.000** 46.525
47 I 1.000** 46.525
48 P 1.000** 46.525
49 Y 1.000** 46.525
50 M 1.000** 46.525
51 I 1.000** 46.525
52 A 1.000** 46.525
53 A 1.000** 46.525
54 F 1.000** 46.525
55 S 1.000** 46.525
56 L 1.000** 46.525
57 M 1.000** 46.525
58 V 1.000** 46.525
59 S 1.000** 46.525
60 A 1.000** 46.525
61 S 1.000** 46.525
62 V 1.000** 46.525
63 T 1.000** 46.525
64 A 1.000** 46.525
65 G 1.000** 46.525
66 V 1.000** 46.525
67 L 1.000** 46.525
68 V 1.000** 46.525
69 G 1.000** 46.525
70 G 1.000** 46.525
71 L 1.000** 46.525
72 T 1.000** 46.525
73 M 1.000** 46.525
74 I 1.000** 46.525
75 T 1.000** 46.525
76 L 1.000** 46.525
77 I 1.000** 46.525
78 L 1.000** 46.525
79 L 1.000** 46.525
80 G 1.000** 46.525
81 V 1.000** 46.525
82 V 1.000** 46.525
83 L 1.000** 46.525
84 G 1.000** 46.525
85 A 1.000** 46.525
86 L 1.000** 46.525
87 V 1.000** 46.525
88 A 1.000** 46.525
89 F 1.000** 46.525
90 I 1.000** 46.525
91 I 1.000** 46.525
92 F 1.000** 46.525
93 G 1.000** 46.525
94 R 1.000** 46.525
95 R 1.000** 46.525
96 T 1.000** 46.525
97 Q 1.000** 46.525
98 Q 1.000** 46.525
99 S 1.000** 46.525
100 V 1.000** 46.525
101 Y 1.000** 46.525
102 H 1.000** 46.525
103 K 1.000** 46.525
104 A 1.000** 46.525
105 E 1.000** 46.525
106 G 1.000** 46.525
107 Q 1.000** 46.525
108 T 1.000** 46.525
109 G 1.000** 46.525
110 G 1.000** 46.525
111 A 1.000** 46.525
112 A 1.000** 46.525
113 W 1.000** 46.525
114 A 1.000** 46.525
115 L 1.000** 46.525
116 D 1.000** 46.525
117 N 1.000** 46.525
118 L 1.000** 46.525
119 R 1.000** 46.525
120 G 1.000** 46.525
121 K 1.000** 46.525
122 W 1.000** 46.525
123 R 1.000** 46.525
124 V 1.000** 46.525
125 S 1.000** 46.525
126 P 1.000** 46.525
127 G 1.000** 46.525
128 V 1.000** 46.525
129 A 1.000** 46.525
130 A 1.000** 46.525
131 N 1.000** 46.525
132 G 1.000** 46.525
133 H 1.000** 46.525
134 F 1.000** 46.525
135 D 1.000** 46.525
136 A 1.000** 46.525
137 V 1.000** 46.525
138 H 1.000** 46.525
139 R 1.000** 46.525
140 V 1.000** 46.525
141 I 1.000** 46.525
142 G 1.000** 46.525
143 R 1.000** 46.525
144 P 1.000** 46.525
145 G 1.000** 46.525
146 V 1.000** 46.525
147 I 1.000** 46.525
148 F 1.000** 46.525
149 V 1.000** 46.525
150 A 1.000** 46.525
151 E 1.000** 46.525
152 G 1.000** 46.525
153 S 1.000** 46.525
154 A 1.000** 46.525
155 A 1.000** 46.525
156 R 1.000** 46.525
157 V 1.000** 46.525
158 K 1.000** 46.525
159 P 1.000** 46.525
160 L 1.000** 46.525
161 L 1.000** 46.525
162 A 1.000** 46.525
163 Q 1.000** 46.525
164 E 1.000** 46.525
165 K 1.000** 46.525
166 K 1.000** 46.525
167 R 1.000** 46.525
168 T 1.000** 46.525
169 A 1.000** 46.525
170 R 1.000** 46.525
171 L 1.000** 46.525
172 V 1.000** 46.525
173 G 1.000** 46.525
174 D 1.000** 46.525
175 V 1.000** 46.525
176 P 1.000** 46.525
177 I 1.000** 46.525
178 Y 1.000** 46.525
179 D 1.000** 46.525
180 I 1.000** 46.525
181 I 1.000** 46.525
182 V 1.000** 46.525
183 G 1.000** 46.525
184 N 1.000** 46.525
185 G 1.000** 46.525
186 D 1.000** 46.525
187 G 1.000** 46.525
188 E 1.000** 46.525
189 V 1.000** 46.525
190 A 1.000** 46.525
191 L 1.000** 46.525
192 V 1.000** 46.525
193 K 1.000** 46.525
194 L 1.000** 46.525
195 E 1.000** 46.525
196 R 1.000** 46.525
197 H 1.000** 46.525
198 L 1.000** 46.525
199 A 1.000** 46.525
200 R 1.000** 46.525
201 L 1.000** 46.525
202 P 1.000** 46.525
203 A 1.000** 46.525
204 N 1.000** 46.525
205 I 1.000** 46.525
206 S 1.000** 46.525
207 V 1.000** 46.525
208 K 1.000** 46.525
209 Q 1.000** 46.525
210 V 1.000** 46.525
211 D 1.000** 46.525
212 I 1.000** 46.525
213 L 1.000** 46.525
214 E 1.000** 46.525
215 S 1.000** 46.525
216 R 1.000** 46.525
217 L 1.000** 46.525
218 A 1.000** 46.525
219 A 1.000** 46.525
220 L 1.000** 46.525
221 G 1.000** 46.525
222 S 1.000** 46.525
223 R 1.000** 46.525
224 A 1.000** 46.525
225 G 1.000** 46.525
226 A 1.000** 46.525
227 S 1.000** 46.525
228 L 1.000** 46.525
229 I 1.000** 46.525
230 P 1.000** 46.525
231 K 1.000** 46.525
232 G 1.000** 46.525
233 P 1.000** 46.525
234 L 1.000** 46.525
235 P 1.000** 46.525
236 N 1.000** 46.525
237 A 1.000** 46.525
238 G 1.000** 46.525
239 K 1.000** 46.525
240 M 1.000** 46.525
241 R 1.000** 46.525
242 G 1.000** 46.525
243 V 1.000** 46.525
244 Q 1.000** 46.525
245 R 1.000** 46.525
246 T 1.000** 46.525
247 V 1.000** 46.525
248 R 1.000** 46.525
249 R 1.000** 46.525
250 K 1.000** 46.525
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907969_1_896_MLBR_RS04215)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -984.240203 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 24.653318 21.738920 30.652958
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907969_1_896_MLBR_RS04215: 0.000004, NC_002677_1_NP_301645_1_517_ML0857: 0.000004, NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255: 0.000004, NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885: 0.000004, NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645: 0.000004, NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 24.65332
Parameters in M7 (beta):
p = 21.73892 q = 30.65296
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.30578 0.34453 0.36833 0.38768 0.40527 0.42245 0.44033 0.46035 0.48552 0.52781
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 543.5 206.5 0.4148 0.0000 0.0000 0.0 0.0
7..2 0.000 543.5 206.5 0.4148 0.0000 0.0000 0.0 0.0
7..3 0.000 543.5 206.5 0.4148 0.0000 0.0000 0.0 0.0
7..4 0.000 543.5 206.5 0.4148 0.0000 0.0000 0.0 0.0
7..5 0.000 543.5 206.5 0.4148 0.0000 0.0000 0.0 0.0
7..6 0.000 543.5 206.5 0.4148 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -984.240105 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 24.434741 0.000010 0.005000 1.818034 72.700435
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907969_1_896_MLBR_RS04215: 0.000004, NC_002677_1_NP_301645_1_517_ML0857: 0.000004, NZ_LVXE01000007_1_WP_010907969_1_2572_A3216_RS04255: 0.000004, NZ_LYPH01000011_1_WP_010907969_1_394_A8144_RS01885: 0.000004, NZ_CP029543_1_WP_010907969_1_914_DIJ64_RS04645: 0.000004, NZ_AP014567_1_WP_010907969_1_931_JK2ML_RS04730: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 24.43474
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.81803
(p1 = 0.99999) w = 72.70043
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 72.70043
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 543.5 206.5 72.6997 0.0000 0.0000 0.0 0.0
7..2 0.000 543.5 206.5 72.6997 0.0000 0.0000 0.0 0.0
7..3 0.000 543.5 206.5 72.6997 0.0000 0.0000 0.0 0.0
7..4 0.000 543.5 206.5 72.6997 0.0000 0.0000 0.0 0.0
7..5 0.000 543.5 206.5 72.6997 0.0000 0.0000 0.0 0.0
7..6 0.000 543.5 206.5 72.6997 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907969_1_896_MLBR_RS04215)
Pr(w>1) post mean +- SE for w
1 M 1.000** 72.700
2 A 1.000** 72.700
3 K 1.000** 72.700
4 P 1.000** 72.700
5 R 1.000** 72.700
6 N 1.000** 72.700
7 A 1.000** 72.700
8 A 1.000** 72.700
9 A 1.000** 72.700
10 H 1.000** 72.700
11 K 1.000** 72.700
12 A 1.000** 72.700
13 A 1.000** 72.700
14 R 1.000** 72.700
15 A 1.000** 72.700
16 E 1.000** 72.700
17 A 1.000** 72.700
18 K 1.000** 72.700
19 A 1.000** 72.700
20 A 1.000** 72.700
21 R 1.000** 72.700
22 K 1.000** 72.700
23 A 1.000** 72.700
24 A 1.000** 72.700
25 S 1.000** 72.700
26 R 1.000** 72.700
27 Q 1.000** 72.700
28 R 1.000** 72.700
29 R 1.000** 72.700
30 L 1.000** 72.700
31 Q 1.000** 72.700
32 L 1.000** 72.700
33 W 1.000** 72.700
34 Q 1.000** 72.700
35 A 1.000** 72.700
36 F 1.000** 72.700
37 T 1.000** 72.700
38 I 1.000** 72.700
39 Q 1.000** 72.700
40 R 1.000** 72.700
41 T 1.000** 72.700
42 E 1.000** 72.700
43 D 1.000** 72.700
44 K 1.000** 72.700
45 R 1.000** 72.700
46 L 1.000** 72.700
47 I 1.000** 72.700
48 P 1.000** 72.700
49 Y 1.000** 72.700
50 M 1.000** 72.700
51 I 1.000** 72.700
52 A 1.000** 72.700
53 A 1.000** 72.700
54 F 1.000** 72.700
55 S 1.000** 72.700
56 L 1.000** 72.700
57 M 1.000** 72.700
58 V 1.000** 72.700
59 S 1.000** 72.700
60 A 1.000** 72.700
61 S 1.000** 72.700
62 V 1.000** 72.700
63 T 1.000** 72.700
64 A 1.000** 72.700
65 G 1.000** 72.700
66 V 1.000** 72.700
67 L 1.000** 72.700
68 V 1.000** 72.700
69 G 1.000** 72.700
70 G 1.000** 72.700
71 L 1.000** 72.700
72 T 1.000** 72.700
73 M 1.000** 72.700
74 I 1.000** 72.700
75 T 1.000** 72.700
76 L 1.000** 72.700
77 I 1.000** 72.700
78 L 1.000** 72.700
79 L 1.000** 72.700
80 G 1.000** 72.700
81 V 1.000** 72.700
82 V 1.000** 72.700
83 L 1.000** 72.700
84 G 1.000** 72.700
85 A 1.000** 72.700
86 L 1.000** 72.700
87 V 1.000** 72.700
88 A 1.000** 72.700
89 F 1.000** 72.700
90 I 1.000** 72.700
91 I 1.000** 72.700
92 F 1.000** 72.700
93 G 1.000** 72.700
94 R 1.000** 72.700
95 R 1.000** 72.700
96 T 1.000** 72.700
97 Q 1.000** 72.700
98 Q 1.000** 72.700
99 S 1.000** 72.700
100 V 1.000** 72.700
101 Y 1.000** 72.700
102 H 1.000** 72.700
103 K 1.000** 72.700
104 A 1.000** 72.700
105 E 1.000** 72.700
106 G 1.000** 72.700
107 Q 1.000** 72.700
108 T 1.000** 72.700
109 G 1.000** 72.700
110 G 1.000** 72.700
111 A 1.000** 72.700
112 A 1.000** 72.700
113 W 1.000** 72.700
114 A 1.000** 72.700
115 L 1.000** 72.700
116 D 1.000** 72.700
117 N 1.000** 72.700
118 L 1.000** 72.700
119 R 1.000** 72.700
120 G 1.000** 72.700
121 K 1.000** 72.700
122 W 1.000** 72.700
123 R 1.000** 72.700
124 V 1.000** 72.700
125 S 1.000** 72.700
126 P 1.000** 72.700
127 G 1.000** 72.700
128 V 1.000** 72.700
129 A 1.000** 72.700
130 A 1.000** 72.700
131 N 1.000** 72.700
132 G 1.000** 72.700
133 H 1.000** 72.700
134 F 1.000** 72.700
135 D 1.000** 72.700
136 A 1.000** 72.700
137 V 1.000** 72.700
138 H 1.000** 72.700
139 R 1.000** 72.700
140 V 1.000** 72.700
141 I 1.000** 72.700
142 G 1.000** 72.700
143 R 1.000** 72.700
144 P 1.000** 72.700
145 G 1.000** 72.700
146 V 1.000** 72.700
147 I 1.000** 72.700
148 F 1.000** 72.700
149 V 1.000** 72.700
150 A 1.000** 72.700
151 E 1.000** 72.700
152 G 1.000** 72.700
153 S 1.000** 72.700
154 A 1.000** 72.700
155 A 1.000** 72.700
156 R 1.000** 72.700
157 V 1.000** 72.700
158 K 1.000** 72.700
159 P 1.000** 72.700
160 L 1.000** 72.700
161 L 1.000** 72.700
162 A 1.000** 72.700
163 Q 1.000** 72.700
164 E 1.000** 72.700
165 K 1.000** 72.700
166 K 1.000** 72.700
167 R 1.000** 72.700
168 T 1.000** 72.700
169 A 1.000** 72.700
170 R 1.000** 72.700
171 L 1.000** 72.700
172 V 1.000** 72.700
173 G 1.000** 72.700
174 D 1.000** 72.700
175 V 1.000** 72.700
176 P 1.000** 72.700
177 I 1.000** 72.700
178 Y 1.000** 72.700
179 D 1.000** 72.700
180 I 1.000** 72.700
181 I 1.000** 72.700
182 V 1.000** 72.700
183 G 1.000** 72.700
184 N 1.000** 72.700
185 G 1.000** 72.700
186 D 1.000** 72.700
187 G 1.000** 72.700
188 E 1.000** 72.700
189 V 1.000** 72.700
190 A 1.000** 72.700
191 L 1.000** 72.700
192 V 1.000** 72.700
193 K 1.000** 72.700
194 L 1.000** 72.700
195 E 1.000** 72.700
196 R 1.000** 72.700
197 H 1.000** 72.700
198 L 1.000** 72.700
199 A 1.000** 72.700
200 R 1.000** 72.700
201 L 1.000** 72.700
202 P 1.000** 72.700
203 A 1.000** 72.700
204 N 1.000** 72.700
205 I 1.000** 72.700
206 S 1.000** 72.700
207 V 1.000** 72.700
208 K 1.000** 72.700
209 Q 1.000** 72.700
210 V 1.000** 72.700
211 D 1.000** 72.700
212 I 1.000** 72.700
213 L 1.000** 72.700
214 E 1.000** 72.700
215 S 1.000** 72.700
216 R 1.000** 72.700
217 L 1.000** 72.700
218 A 1.000** 72.700
219 A 1.000** 72.700
220 L 1.000** 72.700
221 G 1.000** 72.700
222 S 1.000** 72.700
223 R 1.000** 72.700
224 A 1.000** 72.700
225 G 1.000** 72.700
226 A 1.000** 72.700
227 S 1.000** 72.700
228 L 1.000** 72.700
229 I 1.000** 72.700
230 P 1.000** 72.700
231 K 1.000** 72.700
232 G 1.000** 72.700
233 P 1.000** 72.700
234 L 1.000** 72.700
235 P 1.000** 72.700
236 N 1.000** 72.700
237 A 1.000** 72.700
238 G 1.000** 72.700
239 K 1.000** 72.700
240 M 1.000** 72.700
241 R 1.000** 72.700
242 G 1.000** 72.700
243 V 1.000** 72.700
244 Q 1.000** 72.700
245 R 1.000** 72.700
246 T 1.000** 72.700
247 V 1.000** 72.700
248 R 1.000** 72.700
249 R 1.000** 72.700
250 K 1.000** 72.700
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907969_1_896_MLBR_RS04215)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -984.240128 Model 2: PositiveSelection -984.240106 Model 0: one-ratio -984.24013 Model 7: beta -984.240203 Model 8: beta&w>1 -984.240105 Model 0 vs 1 3.999999989900971E-6 Model 2 vs 1 4.4000000116284355E-5 Model 8 vs 7 1.9599999995989492E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
