--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 15:16:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsD/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -825.43 -827.81
2 -825.48 -828.92
--------------------------------------
TOTAL -825.45 -828.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901742 0.091404 0.388019 1.527727 0.873962 1375.92 1438.46 1.000
r(A<->C){all} 0.175366 0.021393 0.000021 0.474018 0.135516 268.45 273.78 1.000
r(A<->G){all} 0.159486 0.018451 0.000064 0.429465 0.121300 89.10 236.02 1.001
r(A<->T){all} 0.163765 0.019931 0.000023 0.446071 0.125153 176.91 188.00 1.003
r(C<->G){all} 0.165156 0.020004 0.000037 0.450170 0.129160 160.19 188.82 1.003
r(C<->T){all} 0.164775 0.020301 0.000113 0.446831 0.125995 142.82 232.74 1.000
r(G<->T){all} 0.171452 0.021909 0.000011 0.469094 0.129492 95.88 120.17 1.010
pi(A){all} 0.217930 0.000285 0.186038 0.251278 0.217836 1082.65 1095.13 1.000
pi(C){all} 0.291273 0.000340 0.254464 0.326423 0.290762 1345.43 1358.52 1.000
pi(G){all} 0.304685 0.000352 0.267899 0.340114 0.304274 1163.26 1285.33 1.000
pi(T){all} 0.186112 0.000248 0.157413 0.218566 0.185981 1120.30 1160.47 1.000
alpha{1,2} 0.415517 0.223336 0.000163 1.357792 0.255930 1014.46 1208.36 1.001
alpha{3} 0.452236 0.223850 0.000138 1.357836 0.296607 1179.04 1284.75 1.000
pinvar{all} 0.997418 0.000009 0.991741 1.000000 0.998423 1126.43 1296.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -779.965005
Model 2: PositiveSelection -779.965105
Model 0: one-ratio -779.965131
Model 7: beta -779.965005
Model 8: beta&w>1 -779.965005
Model 0 vs 1 2.520000000458822E-4
Model 2 vs 1 1.999999999497959E-4
Model 8 vs 7 0.0
>C1
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C2
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C3
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C4
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C5
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C6
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=201
C1 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C2 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C3 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C4 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C5 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C6 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
**************************************************
C1 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C2 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C3 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C4 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C5 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C6 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
**************************************************
C1 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C2 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C3 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C4 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C5 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C6 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
**************************************************
C1 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C2 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C3 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C4 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C5 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C6 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
**************************************************
C1 K
C2 K
C3 K
C4 K
C5 K
C6 K
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6030]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6030]--->[6030]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.481 Mb, Max= 30.744 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C2 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C3 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C4 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C5 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C6 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
**************************************************
C1 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C2 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C3 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C4 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C5 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C6 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
**************************************************
C1 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C2 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C3 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C4 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C5 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C6 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
**************************************************
C1 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C2 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C3 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C4 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C5 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C6 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
**************************************************
C1 K
C2 K
C3 K
C4 K
C5 K
C6 K
*
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C2 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C3 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C4 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C5 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C6 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
**************************************************
C1 CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C2 CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C3 CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C4 CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C5 CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C6 CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
**************************************************
C1 GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C2 GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C3 GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C4 GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C5 GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C6 GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
**************************************************
C1 CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C2 CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C3 CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C4 CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C5 CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C6 CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
**************************************************
C1 CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C2 CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C3 CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C4 CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C5 CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C6 CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
**************************************************
C1 AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C2 AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C3 AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C4 AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C5 AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C6 AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
**************************************************
C1 GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C2 GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C3 GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C4 GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C5 GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C6 GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
**************************************************
C1 CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C2 CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C3 CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C4 CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C5 CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C6 CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
**************************************************
C1 AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C2 AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C3 AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C4 AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C5 AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C6 AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
**************************************************
C1 CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C2 CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C3 CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C4 CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C5 CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C6 CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
**************************************************
C1 GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C2 GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C3 GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C4 GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C5 GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C6 GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
**************************************************
C1 TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C2 TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C3 TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C4 TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C5 TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C6 TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
**************************************************
C1 AAG
C2 AAG
C3 AAG
C4 AAG
C5 AAG
C6 AAG
***
>C1
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C2
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C3
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C4
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C5
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C6
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C1
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C2
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C3
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C4
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C5
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C6
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 603 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579792473
Setting output file names to "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2094908471
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0651545885
Seed = 2058883618
Swapseed = 1579792473
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1349.542704 -- -24.965149
Chain 2 -- -1349.542910 -- -24.965149
Chain 3 -- -1349.542910 -- -24.965149
Chain 4 -- -1349.542910 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1349.542832 -- -24.965149
Chain 2 -- -1349.542910 -- -24.965149
Chain 3 -- -1349.542910 -- -24.965149
Chain 4 -- -1349.542910 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1349.543] (-1349.543) (-1349.543) (-1349.543) * [-1349.543] (-1349.543) (-1349.543) (-1349.543)
500 -- (-838.836) [-838.559] (-841.968) (-832.093) * (-838.557) (-847.573) [-833.185] (-838.972) -- 0:00:00
1000 -- (-836.572) [-833.462] (-831.598) (-829.438) * (-845.216) (-841.631) [-834.564] (-832.211) -- 0:00:00
1500 -- (-836.277) [-833.801] (-836.331) (-832.077) * [-838.770] (-834.865) (-843.995) (-838.484) -- 0:00:00
2000 -- (-842.258) (-830.145) [-830.959] (-837.226) * (-838.597) [-835.164] (-838.713) (-834.124) -- 0:00:00
2500 -- (-830.991) (-835.027) (-836.766) [-837.508] * [-832.229] (-834.741) (-845.167) (-831.750) -- 0:00:00
3000 -- (-837.999) (-831.513) (-832.465) [-831.328] * (-835.522) (-828.328) [-835.246] (-835.156) -- 0:00:00
3500 -- (-834.469) [-832.630] (-830.119) (-831.763) * (-835.978) [-830.611] (-831.303) (-830.703) -- 0:00:00
4000 -- (-837.068) [-830.959] (-833.963) (-833.577) * (-846.890) [-833.344] (-833.602) (-834.654) -- 0:00:00
4500 -- [-830.268] (-836.532) (-833.810) (-839.639) * [-834.193] (-836.328) (-833.575) (-833.860) -- 0:00:00
5000 -- (-841.137) (-832.511) [-832.605] (-832.514) * (-842.025) [-833.151] (-831.205) (-833.338) -- 0:00:00
Average standard deviation of split frequencies: 0.088815
5500 -- [-833.608] (-834.417) (-837.571) (-841.350) * (-833.289) [-834.074] (-836.049) (-839.758) -- 0:00:00
6000 -- (-838.113) [-832.162] (-835.399) (-834.445) * [-837.300] (-833.914) (-837.720) (-838.978) -- 0:00:00
6500 -- (-835.849) (-840.394) (-833.293) [-834.635] * (-837.371) (-834.100) [-829.540] (-829.843) -- 0:00:00
7000 -- (-841.200) [-837.582] (-839.337) (-838.147) * [-832.577] (-831.518) (-840.260) (-832.736) -- 0:00:00
7500 -- (-838.512) (-835.358) [-831.833] (-842.593) * (-841.237) [-838.812] (-843.114) (-832.425) -- 0:00:00
8000 -- [-836.918] (-842.686) (-833.559) (-842.195) * [-831.072] (-832.514) (-834.055) (-841.415) -- 0:00:00
8500 -- (-833.980) [-831.077] (-829.553) (-839.693) * (-836.597) (-835.874) (-836.138) [-835.557] -- 0:00:00
9000 -- (-835.866) [-838.395] (-833.255) (-848.249) * (-847.714) [-836.482] (-846.260) (-833.144) -- 0:00:00
9500 -- (-840.710) (-833.882) [-830.662] (-839.684) * [-830.348] (-838.715) (-840.646) (-833.601) -- 0:00:00
10000 -- [-837.918] (-834.623) (-836.420) (-844.420) * (-831.035) [-835.588] (-825.876) (-834.435) -- 0:00:00
Average standard deviation of split frequencies: 0.046404
10500 -- (-833.520) (-838.276) (-833.705) [-836.783] * (-834.632) [-830.680] (-827.140) (-837.465) -- 0:00:00
11000 -- [-832.552] (-841.938) (-833.973) (-838.689) * (-832.721) (-838.858) [-827.333] (-831.657) -- 0:00:00
11500 -- [-832.469] (-842.091) (-835.481) (-824.929) * (-837.954) [-837.941] (-829.578) (-835.403) -- 0:01:25
12000 -- [-829.188] (-831.934) (-839.028) (-824.988) * [-838.227] (-830.003) (-828.964) (-839.371) -- 0:01:22
12500 -- (-836.706) (-834.111) [-836.083] (-824.230) * (-835.291) [-835.337] (-826.461) (-835.416) -- 0:01:19
13000 -- [-841.351] (-833.463) (-834.088) (-826.645) * [-836.887] (-833.423) (-829.833) (-836.957) -- 0:01:15
13500 -- (-831.444) [-832.156] (-838.710) (-826.007) * [-832.228] (-832.516) (-827.144) (-840.401) -- 0:01:13
14000 -- (-839.342) (-843.193) [-833.222] (-825.317) * (-839.751) (-835.331) [-826.575] (-835.100) -- 0:01:10
14500 -- (-836.915) (-835.255) (-831.078) [-824.336] * (-834.408) (-837.876) (-824.801) [-830.669] -- 0:01:07
15000 -- (-833.379) (-845.429) (-835.766) [-826.292] * (-834.244) (-833.854) [-826.660] (-833.053) -- 0:01:05
Average standard deviation of split frequencies: 0.047140
15500 -- (-835.728) [-838.106] (-833.229) (-825.934) * [-830.970] (-836.447) (-831.164) (-838.232) -- 0:01:03
16000 -- (-836.087) [-834.549] (-832.266) (-825.794) * (-835.612) (-828.235) [-824.530] (-841.425) -- 0:01:01
16500 -- (-837.433) (-832.212) (-837.183) [-825.857] * (-832.653) [-839.130] (-827.929) (-837.094) -- 0:00:59
17000 -- [-835.025] (-832.722) (-835.490) (-824.536) * [-834.587] (-835.502) (-825.617) (-840.398) -- 0:00:57
17500 -- (-836.604) (-835.030) (-831.671) [-826.051] * (-842.485) [-834.466] (-826.724) (-838.403) -- 0:00:56
18000 -- [-833.886] (-836.077) (-837.851) (-831.600) * (-840.483) (-839.491) (-826.729) [-838.099] -- 0:00:54
18500 -- (-843.692) [-835.107] (-837.329) (-825.814) * (-836.943) (-836.626) [-826.080] (-840.042) -- 0:00:53
19000 -- [-833.484] (-840.833) (-836.198) (-824.272) * (-825.707) (-838.632) (-827.634) [-832.308] -- 0:00:51
19500 -- (-852.247) [-836.516] (-841.541) (-826.554) * (-829.164) (-841.050) (-826.680) [-832.219] -- 0:00:50
20000 -- [-838.460] (-840.015) (-834.612) (-824.058) * (-827.658) (-832.914) (-826.328) [-833.274] -- 0:00:49
Average standard deviation of split frequencies: 0.042936
20500 -- (-824.533) (-832.056) [-832.926] (-828.533) * (-826.179) (-829.222) [-826.485] (-857.480) -- 0:00:47
21000 -- (-824.346) [-833.484] (-836.765) (-826.202) * (-826.129) (-832.303) [-827.471] (-849.590) -- 0:00:46
21500 -- (-829.903) (-832.218) (-841.789) [-824.314] * (-827.906) (-835.093) [-827.873] (-826.957) -- 0:00:45
22000 -- [-828.191] (-837.568) (-830.001) (-825.358) * (-826.740) (-834.269) (-827.926) [-827.784] -- 0:00:44
22500 -- [-828.071] (-838.503) (-831.484) (-826.920) * (-826.634) (-834.584) (-827.026) [-828.428] -- 0:00:43
23000 -- [-825.305] (-836.543) (-831.941) (-824.783) * (-825.791) (-829.587) (-824.678) [-830.184] -- 0:00:42
23500 -- (-827.872) (-837.155) [-832.348] (-824.450) * (-826.663) [-832.365] (-826.643) (-828.599) -- 0:00:41
24000 -- [-828.973] (-837.091) (-840.851) (-828.783) * (-825.852) (-834.648) [-826.479] (-825.012) -- 0:00:40
24500 -- (-826.766) (-836.977) (-837.819) [-827.488] * (-826.935) (-836.166) (-824.745) [-826.526] -- 0:00:39
25000 -- (-826.502) (-838.290) [-840.026] (-828.547) * (-830.691) (-842.954) (-824.787) [-824.936] -- 0:00:39
Average standard deviation of split frequencies: 0.039125
25500 -- (-826.403) [-836.224] (-839.875) (-828.792) * (-825.776) (-839.317) [-823.953] (-825.665) -- 0:00:38
26000 -- (-826.637) [-836.856] (-838.345) (-828.564) * (-825.678) [-826.944] (-824.861) (-831.108) -- 0:00:37
26500 -- (-824.648) [-830.871] (-841.736) (-825.681) * (-827.140) (-826.683) (-825.240) [-824.933] -- 0:01:13
27000 -- (-824.447) (-838.820) (-837.103) [-825.806] * (-826.566) [-826.675] (-825.720) (-830.621) -- 0:01:12
27500 -- (-824.327) (-830.889) [-835.530] (-824.114) * [-827.415] (-826.911) (-826.176) (-824.776) -- 0:01:10
28000 -- (-826.324) [-834.681] (-833.405) (-827.638) * (-827.706) (-828.607) [-825.378] (-824.622) -- 0:01:09
28500 -- (-824.124) (-827.983) (-838.947) [-825.413] * (-826.411) (-828.476) [-824.368] (-829.020) -- 0:01:08
29000 -- (-824.372) (-835.475) [-836.299] (-824.782) * [-830.405] (-824.574) (-826.092) (-824.155) -- 0:01:06
29500 -- [-824.398] (-840.103) (-834.654) (-824.894) * [-826.870] (-827.232) (-825.517) (-824.033) -- 0:01:05
30000 -- (-825.328) (-839.053) (-841.748) [-827.178] * [-824.690] (-826.685) (-826.944) (-825.436) -- 0:01:04
Average standard deviation of split frequencies: 0.041261
30500 -- (-831.034) (-830.708) [-835.678] (-827.466) * (-827.240) (-825.983) (-825.806) [-825.120] -- 0:01:03
31000 -- [-827.073] (-829.300) (-843.388) (-826.121) * [-825.508] (-831.370) (-824.768) (-825.564) -- 0:01:02
31500 -- (-826.739) (-829.576) [-838.463] (-826.422) * (-825.444) (-825.197) [-824.619] (-825.195) -- 0:01:01
32000 -- [-825.173] (-833.755) (-843.627) (-824.402) * (-826.486) (-830.109) (-826.142) [-827.244] -- 0:01:00
32500 -- (-826.182) [-829.137] (-834.662) (-825.532) * [-825.877] (-826.996) (-825.505) (-825.449) -- 0:00:59
33000 -- (-823.959) (-831.197) (-832.170) [-824.113] * (-826.489) (-832.129) (-826.645) [-823.836] -- 0:00:58
33500 -- (-830.520) (-828.740) (-835.277) [-823.915] * (-828.358) (-825.879) (-827.046) [-824.794] -- 0:00:57
34000 -- (-826.690) (-834.124) [-836.474] (-825.281) * [-826.876] (-828.396) (-826.377) (-825.042) -- 0:00:56
34500 -- (-824.863) [-836.718] (-833.979) (-824.991) * (-828.147) (-826.025) [-825.457] (-826.460) -- 0:00:55
35000 -- (-826.093) (-833.029) [-829.934] (-825.211) * (-826.278) (-826.358) (-824.953) [-824.490] -- 0:00:55
Average standard deviation of split frequencies: 0.033770
35500 -- [-826.113] (-838.723) (-849.809) (-826.438) * (-825.711) (-825.643) (-826.407) [-824.267] -- 0:00:54
36000 -- (-824.485) (-839.855) (-837.656) [-825.377] * (-827.646) (-826.757) [-825.011] (-824.376) -- 0:00:53
36500 -- [-825.007] (-833.953) (-836.489) (-826.908) * (-825.067) (-827.758) [-825.013] (-824.670) -- 0:00:52
37000 -- (-829.654) (-841.479) [-833.016] (-827.865) * (-825.734) (-827.510) [-825.252] (-825.403) -- 0:00:52
37500 -- (-829.948) [-829.457] (-847.908) (-825.435) * [-827.959] (-825.734) (-823.979) (-825.296) -- 0:00:51
38000 -- (-825.980) [-834.501] (-829.619) (-824.690) * (-826.640) (-828.210) (-827.273) [-832.917] -- 0:00:50
38500 -- [-826.456] (-838.284) (-840.670) (-826.654) * (-824.475) (-832.685) [-830.090] (-826.769) -- 0:00:49
39000 -- (-828.250) [-831.488] (-833.914) (-824.877) * [-823.934] (-831.470) (-829.629) (-829.856) -- 0:00:49
39500 -- [-826.624] (-834.228) (-837.937) (-825.502) * (-823.852) [-825.616] (-828.780) (-824.607) -- 0:00:48
40000 -- (-831.694) (-842.687) (-835.041) [-825.187] * (-827.639) (-826.375) (-826.439) [-828.938] -- 0:00:48
Average standard deviation of split frequencies: 0.031725
40500 -- (-832.287) (-842.541) (-836.449) [-824.635] * (-825.193) (-825.040) (-826.439) [-829.091] -- 0:00:47
41000 -- (-827.255) [-838.730] (-840.719) (-825.189) * [-824.893] (-826.829) (-824.664) (-829.534) -- 0:00:46
41500 -- (-830.806) (-835.229) [-841.213] (-824.603) * (-826.505) [-825.319] (-824.005) (-828.431) -- 0:00:46
42000 -- (-825.512) (-834.578) (-825.837) [-826.470] * (-824.700) (-825.894) [-824.086] (-828.003) -- 0:00:45
42500 -- (-827.081) (-835.524) [-826.020] (-824.995) * (-825.007) (-824.555) [-826.573] (-828.847) -- 0:00:45
43000 -- [-827.647] (-830.326) (-826.563) (-826.945) * (-825.733) (-827.356) (-829.759) [-824.745] -- 0:01:06
43500 -- (-828.615) (-831.820) [-826.965] (-825.101) * (-824.832) (-826.383) (-828.195) [-825.325] -- 0:01:05
44000 -- (-828.653) (-832.508) [-825.576] (-826.034) * (-824.481) (-827.394) (-827.574) [-824.281] -- 0:01:05
44500 -- (-828.565) (-832.364) (-826.136) [-826.061] * (-825.419) (-827.532) (-825.272) [-824.472] -- 0:01:04
45000 -- [-827.400] (-835.192) (-831.809) (-826.969) * (-825.301) (-828.487) (-826.649) [-825.197] -- 0:01:03
Average standard deviation of split frequencies: 0.030278
45500 -- (-826.042) [-838.027] (-827.816) (-825.850) * (-825.521) (-827.741) [-827.126] (-828.361) -- 0:01:02
46000 -- (-825.594) (-837.406) [-826.461] (-827.125) * (-825.642) (-825.677) (-825.449) [-824.868] -- 0:01:02
46500 -- (-831.033) (-837.857) (-827.910) [-825.951] * (-825.199) (-825.425) (-824.134) [-825.187] -- 0:01:01
47000 -- (-828.110) (-834.611) [-826.937] (-825.201) * (-825.197) (-826.824) [-824.041] (-824.909) -- 0:01:00
47500 -- (-827.857) [-842.502] (-828.641) (-830.493) * (-827.860) [-827.596] (-826.218) (-827.513) -- 0:01:00
48000 -- (-824.528) [-835.567] (-826.109) (-827.304) * [-826.777] (-824.612) (-825.572) (-829.643) -- 0:00:59
48500 -- [-827.072] (-837.416) (-825.862) (-826.446) * [-827.122] (-825.901) (-825.947) (-824.930) -- 0:00:58
49000 -- (-826.534) (-840.396) (-827.275) [-829.862] * (-827.478) [-825.053] (-828.640) (-825.278) -- 0:00:58
49500 -- (-824.904) [-832.559] (-826.329) (-833.269) * (-826.934) (-827.035) [-826.629] (-825.634) -- 0:00:57
50000 -- (-825.632) (-848.155) (-826.211) [-826.706] * (-828.185) [-827.218] (-824.721) (-825.704) -- 0:00:57
Average standard deviation of split frequencies: 0.032564
50500 -- (-825.687) [-829.351] (-824.745) (-826.512) * [-825.400] (-830.526) (-824.783) (-826.026) -- 0:00:56
51000 -- (-827.013) (-830.206) (-824.460) [-827.434] * (-825.706) (-826.522) [-826.967] (-825.658) -- 0:00:55
51500 -- [-828.449] (-834.584) (-825.598) (-827.761) * (-825.963) (-830.507) (-826.553) [-825.450] -- 0:00:55
52000 -- (-826.143) [-836.099] (-825.059) (-826.648) * [-824.777] (-830.106) (-824.775) (-826.427) -- 0:00:54
52500 -- (-824.230) [-839.891] (-825.406) (-828.586) * (-831.466) (-826.686) [-824.621] (-826.156) -- 0:00:54
53000 -- (-826.297) (-835.820) (-826.809) [-826.849] * (-830.118) (-827.699) [-825.149] (-827.605) -- 0:00:53
53500 -- (-825.199) (-837.566) (-827.871) [-824.535] * (-824.798) (-826.900) (-825.115) [-823.880] -- 0:00:53
54000 -- (-826.994) [-828.868] (-827.494) (-824.698) * (-828.042) [-826.560] (-827.551) (-824.574) -- 0:00:52
54500 -- [-828.893] (-828.726) (-825.488) (-825.344) * (-825.256) (-825.320) (-828.982) [-824.978] -- 0:00:52
55000 -- (-825.379) (-827.772) [-824.141] (-827.347) * (-825.178) (-829.138) [-826.445] (-826.337) -- 0:00:51
Average standard deviation of split frequencies: 0.026189
55500 -- [-824.490] (-824.161) (-824.118) (-826.699) * (-824.482) [-826.826] (-826.466) (-827.988) -- 0:00:51
56000 -- (-825.224) [-824.643] (-825.066) (-827.346) * [-824.240] (-827.999) (-829.394) (-826.390) -- 0:00:50
56500 -- [-824.731] (-826.920) (-826.763) (-825.076) * (-825.275) [-825.813] (-830.403) (-825.626) -- 0:00:50
57000 -- (-824.204) [-824.742] (-824.472) (-826.071) * (-824.860) [-830.555] (-829.363) (-826.341) -- 0:00:49
57500 -- (-824.524) (-825.239) [-826.776] (-826.502) * (-826.080) (-830.639) (-829.016) [-826.152] -- 0:00:49
58000 -- (-827.726) [-824.413] (-828.725) (-826.904) * [-824.792] (-825.988) (-825.770) (-826.048) -- 0:00:48
58500 -- (-826.328) (-824.730) [-833.670] (-828.421) * (-826.584) [-825.420] (-826.173) (-824.285) -- 0:00:48
59000 -- [-824.891] (-824.903) (-826.478) (-830.626) * (-825.167) (-825.756) (-828.782) [-825.532] -- 0:00:47
59500 -- (-828.883) (-824.428) (-826.910) [-828.331] * (-826.628) [-825.262] (-831.246) (-827.818) -- 0:00:47
60000 -- [-829.374] (-825.811) (-829.064) (-825.197) * [-825.172] (-824.746) (-828.035) (-828.581) -- 0:01:02
Average standard deviation of split frequencies: 0.025140
60500 -- (-829.395) (-824.723) (-824.873) [-825.540] * [-827.153] (-828.284) (-828.081) (-826.582) -- 0:01:02
61000 -- (-825.293) (-825.634) (-825.906) [-826.449] * (-826.981) (-827.870) (-829.121) [-825.020] -- 0:01:01
61500 -- (-825.918) (-825.815) (-826.978) [-825.375] * [-826.110] (-825.302) (-827.527) (-826.259) -- 0:01:01
62000 -- (-826.390) (-824.971) [-825.719] (-825.091) * (-824.777) (-824.537) [-827.541] (-824.502) -- 0:01:00
62500 -- (-826.420) [-827.053] (-824.702) (-824.266) * (-826.501) [-824.239] (-830.894) (-824.173) -- 0:01:00
63000 -- (-827.816) (-829.510) [-825.508] (-827.490) * (-829.647) (-825.858) (-828.876) [-825.822] -- 0:00:59
63500 -- (-824.996) (-828.495) [-825.791] (-827.684) * (-826.169) [-824.684] (-828.649) (-825.152) -- 0:00:58
64000 -- (-829.529) [-825.765] (-826.897) (-827.216) * (-826.073) (-827.447) (-825.348) [-825.068] -- 0:00:58
64500 -- (-829.710) (-824.520) [-828.031] (-824.589) * [-825.176] (-824.757) (-825.932) (-825.059) -- 0:00:58
65000 -- [-830.731] (-826.989) (-830.606) (-825.211) * (-824.910) (-826.613) [-824.667] (-827.213) -- 0:00:57
Average standard deviation of split frequencies: 0.026784
65500 -- [-826.844] (-825.342) (-829.246) (-825.179) * [-826.370] (-824.447) (-824.776) (-825.820) -- 0:00:57
66000 -- (-825.073) [-825.993] (-827.364) (-827.945) * (-826.000) [-824.746] (-825.766) (-826.248) -- 0:00:56
66500 -- (-828.775) [-827.651] (-828.663) (-825.769) * (-826.985) (-824.054) (-824.909) [-825.925] -- 0:00:56
67000 -- [-826.093] (-826.140) (-829.789) (-828.395) * (-826.463) (-826.512) (-826.306) [-825.999] -- 0:00:55
67500 -- [-826.769] (-824.502) (-831.618) (-827.081) * [-827.428] (-827.754) (-828.161) (-824.953) -- 0:00:55
68000 -- (-828.466) (-827.393) (-832.034) [-825.129] * [-825.591] (-826.903) (-828.674) (-827.343) -- 0:00:54
68500 -- (-826.589) (-827.832) (-829.044) [-826.372] * (-827.750) [-827.369] (-825.002) (-827.719) -- 0:00:54
69000 -- (-827.005) (-824.880) [-827.011] (-824.863) * (-830.772) (-829.745) [-824.440] (-824.606) -- 0:00:53
69500 -- [-825.626] (-830.234) (-834.521) (-824.540) * [-826.449] (-824.992) (-824.715) (-825.983) -- 0:00:53
70000 -- [-826.322] (-831.732) (-824.872) (-826.278) * (-826.695) (-824.274) (-825.422) [-826.507] -- 0:00:53
Average standard deviation of split frequencies: 0.027385
70500 -- (-825.934) [-827.147] (-825.525) (-825.422) * (-824.745) (-829.049) [-824.204] (-824.197) -- 0:00:52
71000 -- (-825.165) (-826.140) (-824.501) [-827.574] * (-825.310) (-825.691) [-824.497] (-824.520) -- 0:00:52
71500 -- (-826.535) (-826.715) (-830.988) [-835.332] * (-832.482) (-833.960) (-825.677) [-824.500] -- 0:00:51
72000 -- (-827.264) (-826.281) [-828.521] (-827.731) * [-824.804] (-826.085) (-824.762) (-824.451) -- 0:00:51
72500 -- [-828.554] (-828.712) (-829.628) (-825.658) * (-828.005) (-826.220) [-824.642] (-826.262) -- 0:00:51
73000 -- (-829.740) (-824.256) [-827.964] (-826.918) * (-826.533) (-827.428) (-829.141) [-830.486] -- 0:00:50
73500 -- (-826.518) [-825.478] (-825.794) (-826.354) * (-825.517) (-824.709) (-825.651) [-827.077] -- 0:00:50
74000 -- [-824.873] (-830.855) (-827.005) (-830.740) * (-825.613) (-825.468) [-825.206] (-830.732) -- 0:00:50
74500 -- (-825.577) [-824.828] (-827.748) (-824.621) * (-827.814) (-825.586) [-825.446] (-825.536) -- 0:00:49
75000 -- (-824.176) (-825.406) (-829.525) [-825.207] * (-828.429) (-825.359) [-824.890] (-825.503) -- 0:00:49
Average standard deviation of split frequencies: 0.023505
75500 -- (-826.840) [-827.804] (-825.848) (-824.981) * (-827.593) (-825.030) (-824.757) [-825.841] -- 0:00:48
76000 -- (-829.406) (-829.201) [-824.961] (-826.341) * [-827.391] (-826.570) (-827.581) (-827.633) -- 0:00:48
76500 -- [-826.854] (-827.764) (-824.858) (-825.983) * (-825.791) (-827.541) (-825.165) [-827.797] -- 0:01:00
77000 -- [-828.218] (-825.454) (-825.104) (-829.119) * (-825.692) (-828.115) (-826.742) [-827.159] -- 0:00:59
77500 -- (-832.074) (-826.161) (-826.600) [-825.966] * [-825.804] (-827.860) (-825.286) (-829.456) -- 0:00:59
78000 -- (-825.664) [-825.543] (-826.294) (-827.018) * [-825.550] (-833.705) (-827.903) (-827.564) -- 0:00:59
78500 -- (-826.796) (-828.499) [-825.667] (-826.468) * [-826.616] (-829.885) (-826.173) (-825.081) -- 0:00:58
79000 -- (-827.759) [-825.419] (-827.225) (-828.075) * (-826.253) (-828.749) [-827.260] (-826.775) -- 0:00:58
79500 -- (-825.736) (-825.736) [-824.393] (-833.506) * [-824.562] (-829.276) (-826.119) (-824.803) -- 0:00:57
80000 -- (-824.884) [-827.811] (-826.277) (-837.484) * (-825.205) [-827.425] (-826.245) (-825.776) -- 0:00:57
Average standard deviation of split frequencies: 0.023068
80500 -- (-825.404) (-829.234) [-826.949] (-831.515) * [-825.266] (-828.945) (-827.920) (-831.060) -- 0:00:57
81000 -- (-825.190) (-825.525) [-827.364] (-828.552) * [-825.257] (-826.098) (-825.159) (-825.451) -- 0:00:56
81500 -- (-824.916) [-827.466] (-828.731) (-825.362) * (-828.710) (-827.545) [-825.415] (-827.407) -- 0:00:56
82000 -- (-825.742) (-825.529) (-833.308) [-826.192] * (-825.412) [-826.681] (-825.121) (-830.550) -- 0:00:55
82500 -- [-824.718] (-824.908) (-824.733) (-826.834) * (-831.624) (-826.013) [-825.657] (-825.381) -- 0:00:55
83000 -- (-828.625) [-824.726] (-824.787) (-827.612) * (-825.297) [-825.473] (-826.017) (-826.640) -- 0:00:55
83500 -- [-824.576] (-827.160) (-825.061) (-829.523) * (-824.718) (-824.616) (-824.978) [-824.991] -- 0:00:54
84000 -- (-827.229) (-825.257) [-825.135] (-829.290) * (-825.352) (-823.693) (-825.497) [-824.108] -- 0:00:54
84500 -- (-824.836) (-828.288) [-828.343] (-827.553) * (-826.315) (-827.992) (-826.849) [-825.035] -- 0:00:54
85000 -- (-825.638) [-827.342] (-825.479) (-828.923) * (-825.629) (-834.584) [-825.373] (-825.524) -- 0:00:53
Average standard deviation of split frequencies: 0.022214
85500 -- (-825.783) (-825.097) (-824.946) [-829.607] * (-826.116) (-826.523) (-824.933) [-826.177] -- 0:00:53
86000 -- [-826.080] (-825.199) (-825.153) (-824.780) * (-825.693) [-824.737] (-824.885) (-831.255) -- 0:00:53
86500 -- [-824.901] (-825.592) (-825.329) (-825.102) * (-825.630) [-827.401] (-826.907) (-828.952) -- 0:00:52
87000 -- (-827.836) (-825.660) (-826.351) [-828.577] * (-826.984) (-828.993) (-827.933) [-826.387] -- 0:00:52
87500 -- (-834.871) [-825.015] (-826.733) (-828.264) * (-827.747) (-827.422) [-826.768] (-828.512) -- 0:00:52
88000 -- (-834.366) (-826.057) (-824.395) [-825.542] * (-825.592) (-826.376) (-827.724) [-827.765] -- 0:00:51
88500 -- (-829.694) (-826.869) (-825.728) [-824.693] * (-825.519) (-825.972) (-830.499) [-827.937] -- 0:00:51
89000 -- (-826.039) (-826.618) (-826.009) [-827.348] * [-825.322] (-826.077) (-827.695) (-830.942) -- 0:00:51
89500 -- [-826.042] (-826.214) (-825.024) (-825.184) * (-825.969) (-827.053) [-825.743] (-827.694) -- 0:00:50
90000 -- (-827.324) (-826.986) [-825.178] (-826.987) * (-826.636) [-828.843] (-825.000) (-826.987) -- 0:00:50
Average standard deviation of split frequencies: 0.022097
90500 -- (-827.580) (-825.919) [-824.464] (-826.167) * (-825.860) (-831.685) [-825.213] (-825.044) -- 0:00:50
91000 -- (-825.485) (-826.820) (-825.600) [-824.898] * (-824.514) (-831.934) [-826.209] (-826.362) -- 0:00:49
91500 -- (-826.794) (-826.071) (-825.289) [-824.431] * (-826.196) (-824.207) [-825.670] (-830.271) -- 0:00:49
92000 -- [-832.084] (-827.803) (-826.956) (-824.242) * (-828.579) (-825.098) [-824.893] (-827.962) -- 0:00:49
92500 -- (-828.684) (-828.510) (-824.193) [-824.879] * [-827.782] (-825.407) (-826.220) (-828.065) -- 0:00:58
93000 -- (-827.116) [-826.917] (-824.685) (-826.447) * (-828.066) [-825.466] (-826.145) (-826.375) -- 0:00:58
93500 -- [-827.554] (-824.269) (-826.600) (-826.556) * (-825.348) [-826.429] (-830.599) (-829.583) -- 0:00:58
94000 -- (-825.910) (-826.244) (-825.726) [-829.889] * (-825.008) [-824.541] (-830.641) (-824.528) -- 0:00:57
94500 -- (-826.129) (-826.575) [-825.217] (-827.834) * [-826.162] (-829.277) (-826.297) (-826.534) -- 0:00:57
95000 -- (-829.158) (-825.122) [-823.998] (-835.695) * [-824.749] (-825.445) (-829.246) (-827.511) -- 0:00:57
Average standard deviation of split frequencies: 0.019642
95500 -- [-829.521] (-825.644) (-829.291) (-829.940) * (-824.807) (-825.201) [-824.419] (-825.799) -- 0:00:56
96000 -- (-826.017) (-826.991) (-832.057) [-826.008] * (-834.474) [-826.403] (-825.593) (-825.467) -- 0:00:56
96500 -- [-825.004] (-827.319) (-827.511) (-826.030) * [-827.042] (-825.884) (-825.711) (-829.885) -- 0:00:56
97000 -- (-827.482) [-828.227] (-826.120) (-824.367) * (-826.583) (-826.095) (-826.955) [-825.786] -- 0:00:55
97500 -- (-829.429) (-829.704) [-825.241] (-825.452) * (-825.165) (-826.995) [-827.074] (-826.329) -- 0:00:55
98000 -- (-824.948) (-825.712) [-826.956] (-825.743) * [-824.551] (-824.704) (-825.232) (-826.702) -- 0:00:55
98500 -- (-827.329) [-825.868] (-828.754) (-824.981) * (-827.789) [-825.087] (-825.649) (-825.650) -- 0:00:54
99000 -- (-828.263) (-825.654) (-827.896) [-824.716] * (-826.847) [-824.664] (-826.632) (-825.630) -- 0:00:54
99500 -- (-828.749) [-825.773] (-824.936) (-825.759) * (-829.547) [-825.261] (-823.994) (-826.052) -- 0:00:54
100000 -- (-824.692) (-825.560) [-824.833] (-824.795) * (-831.046) (-826.026) (-829.417) [-825.783] -- 0:00:54
Average standard deviation of split frequencies: 0.020384
100500 -- [-825.689] (-826.069) (-824.319) (-827.541) * (-827.067) (-824.172) [-826.503] (-827.150) -- 0:00:53
101000 -- (-826.554) (-826.872) [-828.245] (-826.466) * (-827.398) (-825.216) [-826.372] (-825.235) -- 0:00:53
101500 -- (-828.727) (-825.688) [-826.836] (-824.714) * (-828.575) (-824.991) (-825.361) [-826.626] -- 0:00:53
102000 -- (-827.740) [-825.368] (-827.581) (-826.760) * [-826.233] (-826.053) (-828.558) (-825.111) -- 0:00:52
102500 -- (-828.029) (-825.163) (-827.906) [-826.495] * (-826.659) (-825.421) [-827.657] (-824.952) -- 0:00:52
103000 -- (-827.626) [-825.426] (-828.492) (-827.091) * (-825.655) (-827.659) [-826.222] (-824.267) -- 0:00:52
103500 -- (-824.232) (-825.133) [-824.619] (-824.059) * [-825.061] (-827.016) (-824.455) (-823.911) -- 0:00:51
104000 -- (-824.213) [-825.379] (-825.805) (-826.988) * (-826.389) (-827.206) (-825.307) [-823.905] -- 0:00:51
104500 -- (-826.177) [-825.336] (-826.106) (-826.030) * (-828.403) [-828.914] (-825.721) (-825.057) -- 0:00:51
105000 -- (-824.215) (-825.211) [-828.204] (-827.910) * (-825.545) (-826.792) (-826.623) [-826.954] -- 0:00:51
Average standard deviation of split frequencies: 0.020330
105500 -- [-825.299] (-825.322) (-829.981) (-825.996) * (-825.457) (-827.432) (-826.616) [-827.024] -- 0:00:50
106000 -- [-825.646] (-826.713) (-827.022) (-826.833) * [-825.066] (-826.356) (-826.771) (-828.872) -- 0:00:50
106500 -- (-825.978) (-828.543) [-824.266] (-825.349) * [-826.595] (-826.143) (-824.571) (-831.966) -- 0:00:50
107000 -- [-826.039] (-828.515) (-825.008) (-827.419) * [-824.979] (-824.577) (-827.700) (-826.557) -- 0:00:50
107500 -- (-825.604) (-828.145) (-825.853) [-824.831] * (-826.551) [-824.531] (-826.355) (-827.799) -- 0:00:49
108000 -- (-826.608) [-826.192] (-824.999) (-824.240) * [-825.534] (-829.003) (-826.431) (-826.348) -- 0:00:49
108500 -- [-827.679] (-827.403) (-824.947) (-827.272) * [-826.619] (-827.883) (-825.771) (-826.132) -- 0:00:49
109000 -- (-825.000) (-831.125) [-827.102] (-826.713) * (-825.613) [-824.909] (-824.142) (-827.086) -- 0:00:49
109500 -- (-824.850) (-830.258) (-826.017) [-826.609] * [-824.905] (-830.981) (-830.000) (-826.283) -- 0:00:56
110000 -- (-824.398) [-827.221] (-826.297) (-827.757) * [-825.885] (-827.198) (-825.693) (-826.296) -- 0:00:56
Average standard deviation of split frequencies: 0.021085
110500 -- (-824.782) [-827.770] (-826.332) (-829.082) * (-828.196) (-824.941) [-824.279] (-826.541) -- 0:00:56
111000 -- [-825.930] (-823.898) (-827.163) (-829.814) * (-825.724) (-827.025) (-827.561) [-825.348] -- 0:00:56
111500 -- (-826.999) (-826.144) (-827.000) [-826.762] * [-825.324] (-826.576) (-827.777) (-824.504) -- 0:00:55
112000 -- (-827.003) [-824.330] (-825.613) (-826.125) * [-824.141] (-826.668) (-825.966) (-824.947) -- 0:00:55
112500 -- (-824.565) [-824.456] (-826.536) (-826.379) * (-824.163) (-825.481) (-826.913) [-827.644] -- 0:00:55
113000 -- (-824.540) [-824.465] (-827.856) (-827.852) * (-826.025) (-827.430) [-826.808] (-833.691) -- 0:00:54
113500 -- (-826.990) (-826.192) [-826.423] (-825.359) * (-827.785) (-827.676) [-829.758] (-826.465) -- 0:00:54
114000 -- [-826.313] (-826.192) (-827.237) (-825.696) * (-828.063) (-833.040) (-831.778) [-825.153] -- 0:00:54
114500 -- (-826.750) (-825.784) (-828.047) [-830.665] * [-825.731] (-826.540) (-826.807) (-828.088) -- 0:00:54
115000 -- (-826.468) (-824.533) (-825.665) [-825.996] * (-824.406) (-825.190) [-824.908] (-824.274) -- 0:00:53
Average standard deviation of split frequencies: 0.021797
115500 -- (-826.302) (-825.313) [-828.062] (-825.892) * (-826.688) [-827.028] (-830.080) (-824.747) -- 0:00:53
116000 -- [-824.201] (-827.237) (-824.972) (-827.603) * [-825.437] (-826.923) (-834.492) (-825.498) -- 0:00:53
116500 -- (-826.397) (-825.619) [-832.253] (-827.811) * (-826.401) (-825.451) (-826.717) [-825.023] -- 0:00:53
117000 -- (-824.534) (-828.870) [-825.924] (-828.281) * (-827.032) [-825.501] (-824.895) (-824.915) -- 0:00:52
117500 -- (-825.700) (-829.017) (-828.646) [-827.829] * (-827.929) (-825.336) (-824.920) [-828.913] -- 0:00:52
118000 -- [-826.890] (-827.126) (-828.436) (-825.788) * (-826.102) (-827.062) [-825.114] (-827.530) -- 0:00:52
118500 -- (-829.288) [-828.500] (-826.085) (-828.522) * (-826.059) (-826.271) (-825.035) [-826.955] -- 0:00:52
119000 -- (-830.010) (-825.597) [-823.933] (-828.885) * (-829.525) (-826.371) (-826.715) [-824.902] -- 0:00:51
119500 -- (-830.793) (-825.365) (-825.170) [-826.510] * (-826.143) (-826.956) [-827.450] (-830.017) -- 0:00:51
120000 -- (-831.567) (-828.977) [-826.106] (-826.626) * [-824.603] (-828.062) (-826.434) (-827.929) -- 0:00:51
Average standard deviation of split frequencies: 0.022659
120500 -- (-828.899) (-828.357) [-824.523] (-825.070) * [-824.222] (-825.672) (-826.416) (-826.420) -- 0:00:51
121000 -- (-824.663) (-824.682) [-827.160] (-825.953) * (-824.849) (-825.550) [-826.658] (-825.469) -- 0:00:50
121500 -- (-825.554) [-827.656] (-830.235) (-826.370) * (-826.871) (-826.293) [-827.772] (-825.378) -- 0:00:50
122000 -- (-825.072) [-826.295] (-826.473) (-824.620) * (-826.012) (-826.135) (-825.264) [-825.864] -- 0:00:50
122500 -- (-825.225) (-828.108) [-827.050] (-824.928) * (-825.348) [-825.074] (-827.287) (-824.498) -- 0:00:50
123000 -- (-828.570) [-830.061] (-828.664) (-824.304) * [-826.063] (-826.266) (-825.854) (-828.200) -- 0:00:49
123500 -- (-824.883) [-828.190] (-832.322) (-824.076) * [-825.436] (-827.478) (-825.328) (-825.357) -- 0:00:49
124000 -- [-824.737] (-828.097) (-826.735) (-826.062) * (-825.867) [-827.675] (-824.088) (-828.761) -- 0:00:49
124500 -- [-824.580] (-828.590) (-826.511) (-824.597) * (-827.929) (-826.168) [-825.406] (-826.507) -- 0:00:49
125000 -- (-825.907) [-828.140] (-826.956) (-826.835) * (-829.416) (-826.025) [-825.650] (-825.721) -- 0:00:49
Average standard deviation of split frequencies: 0.022982
125500 -- (-827.481) [-828.350] (-827.142) (-828.326) * (-825.663) (-826.728) [-825.989] (-832.114) -- 0:00:48
126000 -- (-826.745) [-827.971] (-830.448) (-825.442) * (-832.141) (-824.804) (-824.441) [-827.064] -- 0:00:55
126500 -- (-825.522) [-826.111] (-827.527) (-832.093) * [-825.492] (-826.130) (-825.224) (-824.251) -- 0:00:55
127000 -- (-825.235) [-827.704] (-826.621) (-830.852) * (-827.428) [-826.202] (-825.671) (-824.321) -- 0:00:54
127500 -- [-824.986] (-824.749) (-824.771) (-825.744) * (-825.240) [-825.667] (-825.452) (-825.161) -- 0:00:54
128000 -- (-828.436) [-824.626] (-825.065) (-825.975) * (-824.409) [-826.122] (-826.796) (-824.736) -- 0:00:54
128500 -- (-826.069) [-826.267] (-824.667) (-826.978) * (-824.749) [-827.667] (-826.243) (-824.192) -- 0:00:54
129000 -- [-825.803] (-828.826) (-824.688) (-824.901) * [-824.666] (-827.212) (-829.914) (-823.892) -- 0:00:54
129500 -- [-824.412] (-826.488) (-826.015) (-824.922) * (-823.778) (-826.702) [-829.382] (-824.047) -- 0:00:53
130000 -- (-825.523) [-824.607] (-826.365) (-827.712) * [-823.895] (-825.451) (-827.142) (-824.424) -- 0:00:53
Average standard deviation of split frequencies: 0.022187
130500 -- (-824.765) [-825.319] (-826.688) (-831.783) * (-825.081) (-824.473) [-825.501] (-824.800) -- 0:00:53
131000 -- [-824.309] (-828.372) (-826.775) (-833.321) * (-823.975) (-827.099) [-825.751] (-824.017) -- 0:00:53
131500 -- (-823.998) (-828.908) (-824.460) [-828.915] * (-826.221) [-825.670] (-829.150) (-824.565) -- 0:00:52
132000 -- (-824.715) (-832.806) (-824.830) [-825.230] * (-831.117) (-824.594) (-825.852) [-826.202] -- 0:00:52
132500 -- [-825.730] (-831.172) (-825.022) (-825.340) * (-827.658) (-825.640) (-831.192) [-824.356] -- 0:00:52
133000 -- (-828.905) (-828.288) (-824.407) [-825.100] * (-825.138) (-826.625) [-827.227] (-826.887) -- 0:00:52
133500 -- [-824.873] (-826.731) (-825.604) (-825.635) * [-825.040] (-825.134) (-826.195) (-825.150) -- 0:00:51
134000 -- [-826.454] (-825.512) (-825.001) (-824.752) * (-825.487) (-825.674) (-824.907) [-823.923] -- 0:00:51
134500 -- [-825.588] (-826.765) (-826.574) (-825.761) * (-824.424) (-826.319) [-824.822] (-826.717) -- 0:00:51
135000 -- [-828.196] (-825.166) (-827.050) (-827.216) * (-825.143) [-826.501] (-825.547) (-825.486) -- 0:00:51
Average standard deviation of split frequencies: 0.020451
135500 -- (-827.540) [-826.271] (-825.355) (-828.739) * [-825.639] (-826.815) (-824.946) (-826.391) -- 0:00:51
136000 -- (-825.493) (-831.238) (-825.289) [-827.768] * [-825.284] (-829.303) (-825.040) (-826.362) -- 0:00:50
136500 -- [-825.132] (-825.799) (-825.484) (-826.844) * (-824.817) (-829.441) [-825.091] (-826.773) -- 0:00:50
137000 -- [-825.140] (-829.192) (-826.958) (-831.345) * (-824.673) (-824.636) (-825.371) [-824.902] -- 0:00:50
137500 -- (-825.884) (-825.817) [-825.952] (-829.978) * (-824.357) (-824.888) (-826.779) [-826.752] -- 0:00:50
138000 -- (-825.040) [-825.179] (-827.047) (-825.915) * (-830.762) [-824.843] (-825.167) (-826.986) -- 0:00:49
138500 -- (-828.504) [-825.878] (-826.821) (-826.804) * (-829.365) (-827.901) (-825.199) [-825.863] -- 0:00:49
139000 -- (-825.342) [-824.951] (-826.658) (-827.502) * (-829.544) (-827.012) (-824.777) [-826.294] -- 0:00:49
139500 -- (-825.196) (-824.653) [-825.835] (-825.008) * (-827.744) (-829.235) [-824.446] (-827.337) -- 0:00:49
140000 -- (-824.256) (-825.790) (-826.134) [-827.497] * [-824.481] (-830.266) (-824.385) (-827.280) -- 0:00:49
Average standard deviation of split frequencies: 0.021038
140500 -- (-826.562) (-828.325) (-826.278) [-827.148] * (-827.571) [-826.340] (-826.338) (-826.782) -- 0:00:48
141000 -- (-826.621) (-826.467) (-825.455) [-827.840] * (-826.979) (-824.735) [-824.572] (-825.625) -- 0:00:48
141500 -- [-825.271] (-826.751) (-825.336) (-827.558) * (-827.262) [-824.763] (-824.560) (-827.068) -- 0:00:48
142000 -- [-825.348] (-826.189) (-826.024) (-826.532) * [-826.725] (-824.304) (-824.531) (-828.868) -- 0:00:48
142500 -- (-825.439) [-824.831] (-824.325) (-825.409) * (-826.065) (-824.380) [-825.895] (-826.978) -- 0:00:54
143000 -- [-825.660] (-824.745) (-830.707) (-825.262) * (-829.086) [-826.247] (-825.083) (-826.163) -- 0:00:53
143500 -- (-826.537) (-826.127) (-825.172) [-824.792] * (-830.039) [-825.868] (-826.741) (-825.193) -- 0:00:53
144000 -- (-825.982) (-824.520) [-825.891] (-825.356) * (-825.027) [-827.450] (-826.127) (-825.792) -- 0:00:53
144500 -- (-826.884) [-823.706] (-825.548) (-826.842) * [-824.848] (-827.083) (-826.610) (-829.800) -- 0:00:53
145000 -- [-825.915] (-824.928) (-829.527) (-826.241) * [-828.042] (-824.668) (-825.945) (-825.727) -- 0:00:53
Average standard deviation of split frequencies: 0.017758
145500 -- [-824.854] (-825.272) (-828.862) (-826.079) * (-830.369) (-833.487) (-825.626) [-825.943] -- 0:00:52
146000 -- [-825.735] (-825.485) (-826.510) (-833.854) * (-832.745) (-830.861) (-824.601) [-826.923] -- 0:00:52
146500 -- [-826.240] (-825.185) (-824.860) (-829.841) * (-826.926) (-825.942) [-824.765] (-826.664) -- 0:00:52
147000 -- (-827.210) [-825.182] (-827.609) (-828.272) * (-826.550) (-825.004) (-827.259) [-826.681] -- 0:00:52
147500 -- (-826.493) (-824.843) (-827.286) [-830.003] * (-827.560) [-826.883] (-829.643) (-825.926) -- 0:00:52
148000 -- (-827.531) (-825.823) [-829.490] (-829.129) * [-827.170] (-823.898) (-828.224) (-834.313) -- 0:00:51
148500 -- (-826.768) [-825.551] (-829.991) (-825.845) * (-828.353) (-825.395) [-828.457] (-830.457) -- 0:00:51
149000 -- (-826.577) [-826.799] (-824.753) (-826.645) * (-824.839) (-825.531) (-826.474) [-826.225] -- 0:00:51
149500 -- (-826.547) [-826.614] (-824.948) (-826.365) * (-827.027) (-831.953) (-827.080) [-825.542] -- 0:00:51
150000 -- (-826.456) (-825.791) (-826.243) [-825.632] * [-825.692] (-828.769) (-826.545) (-823.925) -- 0:00:51
Average standard deviation of split frequencies: 0.017785
150500 -- (-826.966) (-827.401) [-825.188] (-824.993) * (-825.711) (-832.343) (-824.481) [-824.933] -- 0:00:50
151000 -- (-827.639) (-825.754) [-826.109] (-827.890) * (-827.260) (-826.725) (-825.300) [-824.852] -- 0:00:50
151500 -- (-827.483) [-824.883] (-825.421) (-828.793) * (-828.640) [-826.478] (-825.705) (-828.723) -- 0:00:50
152000 -- (-827.481) (-825.334) (-829.407) [-827.273] * (-824.916) [-825.570] (-825.415) (-827.338) -- 0:00:50
152500 -- (-826.234) [-825.091] (-825.579) (-826.314) * (-825.438) [-827.171] (-824.604) (-825.866) -- 0:00:50
153000 -- (-826.228) (-826.450) [-825.325] (-826.362) * [-824.626] (-825.824) (-825.145) (-828.854) -- 0:00:49
153500 -- (-825.346) (-829.594) [-825.773] (-827.223) * (-824.564) (-824.560) (-825.840) [-829.924] -- 0:00:49
154000 -- [-824.437] (-827.840) (-825.192) (-825.477) * [-824.796] (-824.657) (-826.414) (-826.583) -- 0:00:49
154500 -- [-827.573] (-828.560) (-825.263) (-825.025) * (-825.472) (-826.792) (-825.327) [-829.066] -- 0:00:49
155000 -- [-825.830] (-828.481) (-825.015) (-825.674) * (-826.972) [-827.611] (-824.266) (-826.325) -- 0:00:49
Average standard deviation of split frequencies: 0.017527
155500 -- (-825.667) (-827.990) [-824.082] (-828.894) * (-826.071) (-827.701) (-824.639) [-824.291] -- 0:00:48
156000 -- (-824.781) (-824.945) (-825.522) [-824.726] * (-825.914) (-826.770) [-823.767] (-825.199) -- 0:00:48
156500 -- (-826.180) [-827.990] (-825.319) (-828.239) * (-824.560) [-825.642] (-825.439) (-828.009) -- 0:00:48
157000 -- [-827.087] (-828.585) (-824.956) (-825.741) * (-825.773) (-828.991) (-829.037) [-825.184] -- 0:00:48
157500 -- [-825.176] (-829.591) (-825.019) (-827.113) * [-824.843] (-828.875) (-824.766) (-827.246) -- 0:00:48
158000 -- (-826.155) [-826.059] (-825.746) (-826.103) * (-829.793) (-826.578) [-826.830] (-827.481) -- 0:00:47
158500 -- (-825.461) (-827.886) [-827.515] (-825.473) * [-829.720] (-826.327) (-824.822) (-825.493) -- 0:00:47
159000 -- [-824.619] (-823.859) (-826.902) (-824.980) * (-829.658) [-827.217] (-823.907) (-825.583) -- 0:00:52
159500 -- (-827.037) [-824.892] (-825.639) (-826.086) * (-827.530) (-825.523) [-824.464] (-824.968) -- 0:00:52
160000 -- (-826.011) [-826.454] (-824.550) (-829.208) * (-824.415) (-826.108) (-824.612) [-827.041] -- 0:00:52
Average standard deviation of split frequencies: 0.016724
160500 -- (-830.834) (-826.174) [-824.825] (-827.826) * (-827.469) (-827.137) (-827.456) [-826.720] -- 0:00:52
161000 -- (-826.396) [-825.063] (-826.750) (-826.707) * (-823.884) (-828.298) (-829.429) [-824.856] -- 0:00:52
161500 -- (-825.931) [-828.280] (-824.693) (-824.695) * [-825.621] (-826.112) (-827.703) (-825.054) -- 0:00:51
162000 -- (-825.795) [-828.100] (-824.942) (-825.774) * [-827.012] (-828.023) (-826.043) (-825.695) -- 0:00:51
162500 -- (-826.225) (-827.971) [-825.165] (-824.765) * (-827.118) (-829.691) [-825.580] (-825.454) -- 0:00:51
163000 -- (-825.746) (-828.060) (-826.328) [-826.387] * (-830.290) (-825.570) [-828.307] (-828.224) -- 0:00:51
163500 -- (-826.166) [-828.032] (-827.073) (-827.526) * [-827.780] (-825.861) (-827.338) (-828.328) -- 0:00:51
164000 -- (-826.446) (-826.203) (-832.095) [-827.313] * (-826.561) (-827.266) [-825.243] (-828.893) -- 0:00:50
164500 -- (-825.506) (-824.836) [-824.691] (-825.846) * (-826.350) (-828.114) [-825.353] (-826.754) -- 0:00:50
165000 -- (-826.558) [-824.781] (-826.895) (-829.098) * (-825.604) (-825.780) [-827.729] (-826.507) -- 0:00:50
Average standard deviation of split frequencies: 0.015551
165500 -- (-824.363) [-828.435] (-826.142) (-828.885) * (-829.004) [-827.128] (-827.993) (-827.642) -- 0:00:50
166000 -- [-824.803] (-824.812) (-825.130) (-826.358) * [-824.956] (-827.976) (-825.871) (-830.033) -- 0:00:50
166500 -- (-827.189) (-827.740) [-826.232] (-825.482) * (-826.859) (-824.664) [-825.595] (-827.482) -- 0:00:50
167000 -- (-826.845) (-828.897) [-824.824] (-825.852) * (-825.657) (-824.756) [-827.660] (-826.500) -- 0:00:49
167500 -- [-826.015] (-824.111) (-824.550) (-827.533) * (-825.095) [-824.661] (-832.687) (-824.533) -- 0:00:49
168000 -- [-826.191] (-824.677) (-826.162) (-826.289) * (-826.371) (-826.277) (-829.870) [-823.890] -- 0:00:49
168500 -- [-828.254] (-823.874) (-826.062) (-824.641) * [-826.348] (-826.760) (-824.468) (-828.164) -- 0:00:49
169000 -- (-825.409) [-825.300] (-825.888) (-825.024) * (-826.914) (-825.433) [-826.252] (-827.330) -- 0:00:49
169500 -- (-826.366) (-824.831) (-824.109) [-825.907] * (-826.681) (-826.300) (-830.784) [-824.417] -- 0:00:48
170000 -- [-826.575] (-824.296) (-828.201) (-827.580) * (-826.805) [-827.717] (-826.646) (-830.199) -- 0:00:48
Average standard deviation of split frequencies: 0.016435
170500 -- (-827.075) [-825.829] (-824.738) (-824.937) * (-825.705) (-824.911) (-827.339) [-825.155] -- 0:00:48
171000 -- (-826.733) (-825.624) (-827.526) [-825.287] * (-827.088) (-824.847) [-826.079] (-824.680) -- 0:00:48
171500 -- (-827.314) (-827.259) (-826.276) [-824.823] * (-826.016) [-827.139] (-827.193) (-826.923) -- 0:00:48
172000 -- [-825.514] (-824.297) (-826.973) (-824.409) * [-825.712] (-825.787) (-831.482) (-828.924) -- 0:00:48
172500 -- (-825.503) (-824.599) [-825.251] (-826.397) * [-824.105] (-825.778) (-826.045) (-829.279) -- 0:00:47
173000 -- (-826.579) (-824.875) (-827.750) [-827.609] * [-825.198] (-824.766) (-824.794) (-825.770) -- 0:00:47
173500 -- (-824.381) (-827.530) (-826.089) [-827.701] * (-827.667) [-824.704] (-824.519) (-828.081) -- 0:00:47
174000 -- (-824.341) (-824.514) (-825.067) [-827.934] * (-825.251) (-824.218) (-824.877) [-827.575] -- 0:00:47
174500 -- (-827.064) (-824.521) (-823.814) [-829.667] * (-823.912) [-825.121] (-824.309) (-827.912) -- 0:00:47
175000 -- (-826.109) (-825.386) [-828.047] (-824.235) * (-827.594) (-826.857) (-827.197) [-829.098] -- 0:00:47
Average standard deviation of split frequencies: 0.016353
175500 -- (-825.858) (-826.430) [-827.208] (-826.122) * [-826.028] (-825.779) (-827.156) (-824.815) -- 0:00:51
176000 -- [-826.446] (-826.973) (-827.663) (-827.929) * (-826.083) (-824.912) (-825.486) [-825.867] -- 0:00:51
176500 -- (-824.193) (-827.519) [-825.792] (-825.206) * [-829.312] (-827.779) (-825.711) (-824.910) -- 0:00:51
177000 -- [-826.109] (-827.309) (-828.071) (-824.280) * (-826.174) [-826.483] (-827.778) (-824.717) -- 0:00:51
177500 -- (-826.605) (-824.235) (-827.553) [-826.934] * [-827.192] (-827.066) (-828.280) (-828.665) -- 0:00:50
178000 -- [-826.016] (-831.424) (-825.106) (-829.109) * [-825.600] (-825.205) (-827.452) (-828.801) -- 0:00:50
178500 -- (-825.616) (-829.738) [-825.295] (-827.576) * (-829.545) (-825.762) [-824.998] (-825.885) -- 0:00:50
179000 -- [-825.162] (-830.027) (-828.398) (-826.112) * (-824.549) (-828.056) (-827.958) [-827.333] -- 0:00:50
179500 -- [-825.052] (-828.905) (-824.966) (-825.439) * (-824.774) (-825.792) [-824.413] (-824.797) -- 0:00:50
180000 -- [-826.490] (-825.730) (-826.377) (-825.439) * (-824.324) [-826.951] (-826.516) (-829.125) -- 0:00:50
Average standard deviation of split frequencies: 0.017352
180500 -- (-824.940) (-824.558) (-825.974) [-825.106] * (-824.088) [-826.266] (-828.390) (-826.852) -- 0:00:49
181000 -- (-829.170) (-826.969) (-825.185) [-825.515] * (-827.489) (-826.220) (-827.263) [-826.603] -- 0:00:49
181500 -- (-829.851) (-825.676) [-825.892] (-826.303) * (-824.740) (-827.006) [-826.537] (-825.010) -- 0:00:49
182000 -- [-825.299] (-825.454) (-824.107) (-826.974) * (-826.247) (-826.238) [-826.822] (-828.352) -- 0:00:49
182500 -- [-823.908] (-825.577) (-825.645) (-825.779) * (-826.160) (-826.046) [-827.186] (-826.935) -- 0:00:49
183000 -- (-826.218) (-828.613) [-825.557] (-827.332) * (-826.346) (-829.332) (-827.342) [-826.289] -- 0:00:49
183500 -- [-824.519] (-830.746) (-825.286) (-827.410) * (-824.588) [-825.690] (-826.362) (-826.120) -- 0:00:48
184000 -- (-825.887) [-827.118] (-824.965) (-826.991) * (-824.090) [-825.969] (-827.159) (-829.221) -- 0:00:48
184500 -- (-824.592) (-826.253) [-826.079] (-825.469) * (-825.726) (-824.834) (-828.745) [-827.824] -- 0:00:48
185000 -- [-826.534] (-825.384) (-824.909) (-825.479) * (-825.293) (-824.525) (-827.954) [-827.087] -- 0:00:48
Average standard deviation of split frequencies: 0.019431
185500 -- (-831.486) (-826.152) [-829.841] (-826.377) * [-825.273] (-836.429) (-829.808) (-825.644) -- 0:00:48
186000 -- [-825.421] (-833.870) (-826.909) (-826.622) * (-825.100) (-825.110) (-828.948) [-825.952] -- 0:00:48
186500 -- (-826.045) (-837.967) [-824.629] (-828.563) * (-831.870) (-825.624) (-832.263) [-826.267] -- 0:00:47
187000 -- (-827.082) (-828.318) (-824.677) [-825.768] * (-829.427) [-825.715] (-827.389) (-826.560) -- 0:00:47
187500 -- (-826.115) (-828.640) [-826.940] (-827.749) * (-828.088) [-824.448] (-828.770) (-828.938) -- 0:00:47
188000 -- (-827.788) (-825.084) [-826.683] (-824.010) * [-826.430] (-825.178) (-826.825) (-826.067) -- 0:00:47
188500 -- (-827.178) (-827.783) [-825.308] (-824.666) * [-826.033] (-824.644) (-828.538) (-824.641) -- 0:00:47
189000 -- [-826.747] (-825.255) (-826.645) (-824.548) * (-827.428) (-826.326) [-825.984] (-825.902) -- 0:00:47
189500 -- (-830.397) (-825.425) (-824.507) [-824.668] * (-828.947) (-828.083) (-827.021) [-829.823] -- 0:00:47
190000 -- (-825.152) (-826.519) [-827.006] (-825.111) * (-829.186) (-827.808) [-828.781] (-826.748) -- 0:00:46
Average standard deviation of split frequencies: 0.018484
190500 -- (-825.226) (-826.522) (-825.620) [-824.439] * [-825.886] (-826.059) (-830.183) (-824.882) -- 0:00:46
191000 -- (-826.229) (-831.745) (-825.310) [-824.186] * (-824.698) (-827.185) [-828.242] (-826.144) -- 0:00:46
191500 -- (-824.097) [-829.036] (-827.624) (-825.271) * [-826.133] (-825.263) (-827.039) (-825.437) -- 0:00:46
192000 -- (-825.478) (-827.261) (-826.017) [-826.784] * [-824.263] (-825.253) (-828.518) (-826.960) -- 0:00:46
192500 -- [-826.377] (-826.641) (-826.683) (-827.273) * (-824.535) (-829.361) [-825.359] (-829.938) -- 0:00:50
193000 -- (-826.267) [-826.326] (-825.471) (-826.648) * (-826.881) (-828.763) [-824.723] (-829.787) -- 0:00:50
193500 -- [-827.494] (-825.717) (-827.560) (-828.779) * (-827.829) [-826.752] (-828.881) (-827.066) -- 0:00:50
194000 -- [-826.352] (-827.855) (-828.814) (-828.093) * (-826.027) (-829.702) (-831.924) [-826.932] -- 0:00:49
194500 -- (-825.528) [-825.122] (-827.988) (-827.027) * (-826.989) (-827.905) [-828.226] (-827.125) -- 0:00:49
195000 -- (-825.985) (-826.468) (-826.316) [-827.169] * [-824.947] (-824.175) (-824.959) (-825.756) -- 0:00:49
Average standard deviation of split frequencies: 0.018038
195500 -- (-824.157) [-825.316] (-827.271) (-826.340) * (-826.204) (-824.284) [-826.702] (-823.834) -- 0:00:49
196000 -- (-824.512) [-824.992] (-826.328) (-826.601) * (-825.096) (-827.070) [-824.539] (-824.955) -- 0:00:49
196500 -- (-827.970) (-825.989) (-825.005) [-825.555] * (-827.278) (-824.185) (-824.395) [-827.577] -- 0:00:49
197000 -- (-825.814) (-825.372) (-825.328) [-830.127] * (-827.088) [-823.941] (-824.294) (-829.066) -- 0:00:48
197500 -- (-826.377) [-828.774] (-824.947) (-824.456) * (-826.320) (-824.874) (-828.283) [-831.193] -- 0:00:48
198000 -- (-824.957) [-825.787] (-829.245) (-826.094) * (-827.001) (-825.874) (-827.416) [-824.413] -- 0:00:48
198500 -- (-827.588) (-825.405) [-824.237] (-825.203) * (-826.738) (-824.317) (-824.742) [-825.096] -- 0:00:48
199000 -- (-826.485) (-828.978) [-824.686] (-824.703) * (-826.529) [-825.064] (-828.166) (-825.288) -- 0:00:48
199500 -- (-828.878) (-834.333) (-825.923) [-827.232] * [-825.694] (-825.418) (-825.644) (-829.091) -- 0:00:48
200000 -- (-831.217) (-826.309) (-826.935) [-825.249] * (-825.513) (-826.231) (-827.953) [-825.062] -- 0:00:48
Average standard deviation of split frequencies: 0.017804
200500 -- (-831.062) (-824.563) [-830.885] (-828.120) * [-825.863] (-828.484) (-824.377) (-830.391) -- 0:00:47
201000 -- (-827.023) [-824.455] (-828.140) (-830.185) * (-827.188) [-828.222] (-824.978) (-827.531) -- 0:00:47
201500 -- [-826.342] (-824.810) (-827.716) (-832.008) * (-834.130) [-826.428] (-827.092) (-826.007) -- 0:00:47
202000 -- [-826.627] (-827.290) (-824.508) (-824.658) * (-830.614) (-828.013) [-828.260] (-825.751) -- 0:00:47
202500 -- [-826.451] (-826.858) (-825.080) (-826.965) * (-826.646) [-825.245] (-824.640) (-828.284) -- 0:00:47
203000 -- (-825.539) (-827.647) [-826.566] (-826.755) * (-828.036) (-825.726) [-828.015] (-834.609) -- 0:00:47
203500 -- (-825.864) (-831.665) [-825.271] (-824.678) * [-825.943] (-828.188) (-825.511) (-826.573) -- 0:00:46
204000 -- (-828.549) [-824.104] (-826.751) (-825.243) * (-826.022) (-825.413) (-826.448) [-824.571] -- 0:00:46
204500 -- (-825.469) [-825.749] (-827.451) (-826.151) * (-825.445) (-826.816) (-828.784) [-826.244] -- 0:00:46
205000 -- [-825.730] (-833.241) (-823.840) (-825.459) * [-827.210] (-827.338) (-825.445) (-825.728) -- 0:00:46
Average standard deviation of split frequencies: 0.018668
205500 -- (-826.153) (-828.568) (-825.229) [-824.924] * [-827.354] (-827.028) (-829.071) (-828.021) -- 0:00:46
206000 -- (-828.821) (-828.719) (-825.924) [-825.512] * (-826.045) [-827.003] (-825.951) (-825.146) -- 0:00:46
206500 -- (-824.659) [-825.830] (-829.007) (-824.928) * (-827.920) [-825.388] (-825.117) (-825.698) -- 0:00:46
207000 -- [-824.806] (-827.432) (-828.289) (-825.831) * (-824.829) [-827.094] (-827.835) (-825.701) -- 0:00:45
207500 -- (-827.119) (-825.954) [-827.461] (-827.055) * [-826.004] (-825.959) (-826.508) (-827.092) -- 0:00:45
208000 -- (-825.830) (-824.865) (-824.848) [-824.950] * (-826.700) [-831.569] (-824.104) (-827.833) -- 0:00:45
208500 -- (-827.412) (-824.836) (-825.690) [-825.167] * [-826.056] (-826.372) (-825.233) (-826.535) -- 0:00:45
209000 -- (-825.490) (-824.860) (-825.392) [-827.264] * (-827.057) [-826.424] (-824.378) (-825.551) -- 0:00:49
209500 -- (-827.626) [-830.491] (-826.372) (-829.120) * (-826.268) [-824.795] (-826.236) (-830.972) -- 0:00:49
210000 -- (-824.647) (-830.291) [-826.653] (-827.304) * [-829.338] (-827.429) (-824.828) (-828.592) -- 0:00:48
Average standard deviation of split frequencies: 0.017404
210500 -- (-825.182) (-825.407) [-826.468] (-828.701) * (-826.531) (-826.614) (-824.444) [-825.625] -- 0:00:48
211000 -- (-829.710) (-827.288) [-824.895] (-827.685) * (-826.765) (-831.126) (-824.235) [-828.016] -- 0:00:48
211500 -- (-827.246) (-828.830) [-825.422] (-824.489) * (-825.202) (-825.542) [-826.047] (-828.722) -- 0:00:48
212000 -- (-824.801) (-828.991) [-825.272] (-828.892) * (-825.195) (-829.203) (-827.580) [-825.345] -- 0:00:48
212500 -- (-829.695) (-825.972) (-828.942) [-827.045] * [-827.711] (-827.186) (-826.605) (-826.163) -- 0:00:48
213000 -- (-827.193) (-827.234) [-826.126] (-825.821) * [-826.282] (-825.691) (-825.715) (-826.486) -- 0:00:48
213500 -- (-824.964) (-829.509) [-825.217] (-825.880) * (-825.721) [-825.794] (-826.653) (-829.640) -- 0:00:47
214000 -- (-825.017) (-824.817) (-824.798) [-826.333] * (-825.529) [-826.268] (-826.274) (-826.470) -- 0:00:47
214500 -- [-828.352] (-825.172) (-826.454) (-826.140) * (-827.435) [-825.900] (-831.324) (-831.759) -- 0:00:47
215000 -- (-824.129) (-826.196) (-825.157) [-825.139] * [-828.345] (-826.233) (-829.246) (-825.056) -- 0:00:47
Average standard deviation of split frequencies: 0.016732
215500 -- (-828.972) [-825.209] (-825.789) (-829.986) * (-828.779) (-825.093) (-826.099) [-824.914] -- 0:00:47
216000 -- (-825.100) [-826.433] (-829.058) (-828.712) * [-824.873] (-826.271) (-829.824) (-825.849) -- 0:00:47
216500 -- (-826.048) (-831.328) (-829.292) [-827.808] * (-825.456) (-825.332) (-828.592) [-827.130] -- 0:00:47
217000 -- (-825.222) (-830.251) [-826.237] (-825.705) * (-825.348) [-824.303] (-824.250) (-826.482) -- 0:00:46
217500 -- (-825.679) (-831.099) (-825.256) [-825.410] * (-824.982) (-827.972) (-826.514) [-826.812] -- 0:00:46
218000 -- (-825.194) (-827.406) (-825.430) [-826.544] * [-826.677] (-827.364) (-825.407) (-825.382) -- 0:00:46
218500 -- (-830.933) [-827.151] (-827.177) (-824.809) * (-825.580) [-826.937] (-824.425) (-826.830) -- 0:00:46
219000 -- [-824.917] (-825.408) (-825.556) (-827.874) * (-825.415) (-825.236) (-826.409) [-826.586] -- 0:00:46
219500 -- [-826.793] (-826.665) (-833.613) (-825.869) * (-827.101) (-824.855) [-827.386] (-827.504) -- 0:00:46
220000 -- (-825.140) (-828.478) [-826.378] (-829.336) * (-829.620) [-827.217] (-824.085) (-828.130) -- 0:00:46
Average standard deviation of split frequencies: 0.015429
220500 -- [-826.239] (-831.660) (-827.248) (-827.391) * (-828.372) (-824.729) [-825.873] (-826.002) -- 0:00:45
221000 -- (-828.238) (-826.293) (-826.865) [-827.882] * (-829.181) [-824.151] (-825.905) (-825.140) -- 0:00:45
221500 -- (-825.555) [-830.827] (-824.796) (-828.242) * [-825.811] (-828.195) (-826.820) (-830.602) -- 0:00:45
222000 -- (-825.632) [-830.756] (-827.653) (-829.088) * [-824.995] (-826.156) (-829.137) (-826.792) -- 0:00:45
222500 -- (-825.325) [-826.539] (-824.874) (-825.705) * [-825.947] (-825.339) (-826.448) (-825.864) -- 0:00:45
223000 -- [-826.765] (-826.192) (-825.132) (-824.506) * [-825.355] (-827.607) (-825.723) (-830.297) -- 0:00:45
223500 -- [-825.435] (-827.659) (-827.264) (-825.135) * (-825.169) (-826.918) (-827.470) [-826.418] -- 0:00:45
224000 -- [-826.967] (-826.856) (-827.750) (-825.570) * (-824.815) (-827.815) (-826.563) [-826.520] -- 0:00:45
224500 -- (-826.464) (-829.951) (-826.168) [-825.485] * (-828.569) (-826.100) (-825.676) [-824.215] -- 0:00:44
225000 -- (-831.026) (-828.588) [-825.305] (-827.273) * (-825.057) [-825.578] (-825.570) (-825.202) -- 0:00:44
Average standard deviation of split frequencies: 0.013284
225500 -- (-826.787) (-826.932) [-825.762] (-828.363) * (-825.392) (-831.023) [-823.966] (-830.299) -- 0:00:48
226000 -- (-829.752) (-825.229) (-826.181) [-827.872] * [-824.259] (-824.423) (-824.796) (-826.134) -- 0:00:47
226500 -- (-826.730) (-825.582) (-825.095) [-827.675] * (-826.074) (-825.871) (-825.439) [-824.977] -- 0:00:47
227000 -- (-827.095) (-825.641) (-825.776) [-823.986] * (-825.641) [-826.170] (-826.843) (-827.356) -- 0:00:47
227500 -- (-830.919) (-827.869) (-827.821) [-825.071] * [-824.715] (-824.853) (-826.721) (-826.264) -- 0:00:47
228000 -- (-828.056) [-829.039] (-826.673) (-825.197) * (-826.085) [-828.352] (-825.481) (-824.713) -- 0:00:47
228500 -- [-826.866] (-829.910) (-824.457) (-825.197) * (-826.035) (-825.551) (-827.475) [-825.046] -- 0:00:47
229000 -- (-830.304) (-826.645) [-827.849] (-825.443) * (-825.661) (-826.488) (-831.386) [-825.874] -- 0:00:47
229500 -- (-826.168) (-827.032) (-828.982) [-825.753] * (-824.583) (-828.414) (-824.248) [-825.933] -- 0:00:47
230000 -- [-825.952] (-824.002) (-827.207) (-827.859) * (-827.022) [-825.708] (-825.749) (-827.013) -- 0:00:46
Average standard deviation of split frequencies: 0.012376
230500 -- (-824.715) (-826.563) (-828.602) [-828.611] * [-825.729] (-830.125) (-823.713) (-825.207) -- 0:00:46
231000 -- [-825.986] (-827.149) (-831.126) (-831.877) * (-829.958) (-825.436) [-825.858] (-826.099) -- 0:00:46
231500 -- [-826.933] (-825.387) (-830.824) (-830.428) * (-828.442) (-827.281) [-825.587] (-824.752) -- 0:00:46
232000 -- (-827.804) (-825.986) [-824.973] (-825.698) * (-827.140) [-826.158] (-826.816) (-825.544) -- 0:00:46
232500 -- (-827.389) (-828.789) (-828.297) [-827.217] * [-824.920] (-827.962) (-825.475) (-827.118) -- 0:00:46
233000 -- (-828.664) (-826.896) [-824.597] (-824.714) * (-824.643) (-828.483) (-825.403) [-824.781] -- 0:00:46
233500 -- (-827.541) (-826.479) [-824.934] (-826.248) * (-825.029) (-824.683) [-824.836] (-827.054) -- 0:00:45
234000 -- (-828.749) [-825.316] (-831.628) (-826.373) * (-824.751) (-825.752) (-824.920) [-825.543] -- 0:00:45
234500 -- (-830.305) (-826.800) (-826.632) [-828.567] * (-824.763) (-824.882) [-825.171] (-827.003) -- 0:00:45
235000 -- (-825.785) [-825.391] (-824.579) (-826.695) * [-827.681] (-825.407) (-825.035) (-827.893) -- 0:00:45
Average standard deviation of split frequencies: 0.013427
235500 -- (-831.206) (-829.502) [-824.849] (-827.685) * (-827.700) (-826.140) (-825.393) [-825.514] -- 0:00:45
236000 -- (-827.348) (-825.519) [-828.643] (-827.844) * (-826.862) (-824.986) [-824.811] (-827.191) -- 0:00:45
236500 -- [-825.577] (-826.608) (-828.109) (-831.306) * (-825.237) [-825.959] (-827.075) (-826.611) -- 0:00:45
237000 -- (-823.848) (-826.543) [-826.330] (-829.613) * (-834.747) [-826.623] (-829.532) (-827.212) -- 0:00:45
237500 -- (-824.330) (-831.482) (-831.390) [-828.706] * (-827.111) (-826.518) (-831.288) [-825.507] -- 0:00:44
238000 -- (-827.463) [-827.686] (-826.135) (-826.150) * (-827.289) [-824.539] (-830.991) (-825.377) -- 0:00:44
238500 -- (-828.118) (-826.946) (-829.250) [-826.823] * (-824.907) (-827.814) (-832.170) [-827.210] -- 0:00:44
239000 -- (-833.066) (-826.985) [-826.440] (-828.582) * (-825.398) (-827.592) [-826.493] (-824.371) -- 0:00:44
239500 -- [-827.625] (-826.122) (-824.630) (-824.847) * (-824.859) (-829.092) (-827.218) [-827.707] -- 0:00:44
240000 -- (-828.064) (-825.732) [-829.510] (-825.847) * (-828.566) (-826.121) (-824.671) [-826.632] -- 0:00:44
Average standard deviation of split frequencies: 0.012514
240500 -- (-828.624) (-826.726) [-826.261] (-825.394) * [-827.318] (-829.335) (-825.569) (-824.611) -- 0:00:44
241000 -- (-829.576) [-826.207] (-824.154) (-825.302) * (-826.836) (-827.864) (-828.045) [-828.124] -- 0:00:44
241500 -- (-825.377) (-826.892) [-825.225] (-825.133) * [-826.323] (-827.458) (-830.687) (-825.439) -- 0:00:47
242000 -- [-824.484] (-829.342) (-827.039) (-828.490) * [-824.366] (-825.001) (-824.254) (-824.601) -- 0:00:46
242500 -- [-829.612] (-829.700) (-828.226) (-828.262) * (-826.712) (-825.197) [-824.502] (-826.046) -- 0:00:46
243000 -- [-824.538] (-825.508) (-824.604) (-826.061) * (-826.863) (-824.201) [-824.502] (-826.551) -- 0:00:46
243500 -- (-826.816) [-824.920] (-824.471) (-825.455) * (-825.372) [-826.098] (-826.237) (-825.132) -- 0:00:46
244000 -- [-825.183] (-829.722) (-824.471) (-829.758) * (-825.116) (-828.650) [-826.220] (-828.282) -- 0:00:46
244500 -- [-825.855] (-825.998) (-826.440) (-830.159) * (-826.463) [-826.625] (-825.924) (-827.061) -- 0:00:46
245000 -- (-827.302) (-826.885) (-825.662) [-827.848] * (-825.076) [-824.579] (-826.358) (-825.802) -- 0:00:46
Average standard deviation of split frequencies: 0.012809
245500 -- (-824.459) (-825.973) (-826.121) [-826.522] * (-826.683) (-827.862) (-827.272) [-830.476] -- 0:00:46
246000 -- (-826.184) (-825.296) [-825.734] (-829.379) * (-826.423) [-825.315] (-825.401) (-829.324) -- 0:00:45
246500 -- (-826.073) (-825.443) [-828.523] (-827.702) * [-827.081] (-827.249) (-826.516) (-824.861) -- 0:00:45
247000 -- [-824.755] (-828.008) (-824.782) (-827.459) * (-824.235) (-827.256) [-828.728] (-826.029) -- 0:00:45
247500 -- (-825.815) [-827.925] (-825.697) (-831.363) * [-826.611] (-824.100) (-826.030) (-828.252) -- 0:00:45
248000 -- [-825.986] (-827.625) (-827.149) (-825.048) * (-828.439) [-825.407] (-826.679) (-827.809) -- 0:00:45
248500 -- (-826.280) (-826.135) (-826.791) [-830.937] * [-827.160] (-825.241) (-827.241) (-828.932) -- 0:00:45
249000 -- [-826.931] (-828.054) (-830.039) (-829.974) * (-825.897) (-825.797) (-826.486) [-828.000] -- 0:00:45
249500 -- (-826.779) [-827.307] (-830.873) (-824.265) * [-825.583] (-825.391) (-827.102) (-825.236) -- 0:00:45
250000 -- (-826.263) (-826.813) [-824.807] (-823.957) * (-825.994) [-825.806] (-827.166) (-824.086) -- 0:00:45
Average standard deviation of split frequencies: 0.011976
250500 -- (-825.816) (-825.724) [-825.289] (-824.698) * (-827.865) [-826.864] (-825.514) (-824.836) -- 0:00:44
251000 -- (-824.055) (-827.807) (-826.704) [-825.474] * (-829.178) [-826.337] (-828.203) (-826.930) -- 0:00:44
251500 -- (-823.769) (-829.869) [-823.808] (-823.798) * [-826.248] (-825.314) (-826.295) (-831.670) -- 0:00:44
252000 -- (-824.437) [-826.067] (-836.086) (-824.396) * [-825.501] (-827.172) (-825.772) (-825.022) -- 0:00:44
252500 -- (-825.132) (-824.750) [-827.904] (-826.958) * (-827.972) (-828.237) [-824.993] (-825.414) -- 0:00:44
253000 -- [-826.963] (-828.043) (-825.460) (-827.326) * (-826.772) (-827.133) [-827.278] (-824.932) -- 0:00:44
253500 -- (-825.941) [-826.593] (-825.031) (-826.433) * (-826.115) (-824.655) (-827.692) [-827.373] -- 0:00:44
254000 -- (-828.124) [-828.081] (-831.362) (-825.995) * (-827.140) [-826.372] (-829.831) (-825.344) -- 0:00:44
254500 -- [-825.268] (-827.410) (-825.309) (-826.081) * [-827.329] (-829.616) (-828.441) (-824.986) -- 0:00:43
255000 -- [-826.641] (-829.232) (-827.537) (-825.791) * (-825.884) (-827.170) [-825.778] (-827.858) -- 0:00:43
Average standard deviation of split frequencies: 0.010844
255500 -- [-829.077] (-826.424) (-827.895) (-825.578) * (-826.062) (-826.377) (-828.060) [-827.375] -- 0:00:43
256000 -- (-826.219) (-828.105) (-825.734) [-824.169] * (-827.969) (-827.293) (-824.910) [-828.934] -- 0:00:43
256500 -- [-824.871] (-828.334) (-827.874) (-825.015) * (-824.314) [-825.947] (-828.705) (-828.719) -- 0:00:43
257000 -- [-824.074] (-825.401) (-827.899) (-825.869) * [-824.194] (-828.112) (-835.468) (-824.891) -- 0:00:43
257500 -- [-825.589] (-829.444) (-826.180) (-826.476) * (-825.437) (-828.395) (-825.881) [-825.000] -- 0:00:43
258000 -- (-830.660) (-828.551) (-827.466) [-826.886] * (-827.919) (-831.102) (-825.519) [-826.079] -- 0:00:46
258500 -- (-829.173) (-826.776) [-824.426] (-828.331) * (-827.542) [-825.302] (-830.524) (-824.550) -- 0:00:45
259000 -- [-826.050] (-824.691) (-824.334) (-824.597) * (-826.605) [-828.278] (-829.839) (-825.167) -- 0:00:45
259500 -- (-827.354) (-825.609) (-824.297) [-826.456] * [-827.042] (-827.225) (-826.707) (-825.942) -- 0:00:45
260000 -- [-825.055] (-825.403) (-825.546) (-824.529) * (-823.951) [-826.423] (-824.943) (-824.784) -- 0:00:45
Average standard deviation of split frequencies: 0.009787
260500 -- (-824.983) (-829.666) [-826.566] (-825.268) * (-827.361) [-826.521] (-828.132) (-826.398) -- 0:00:45
261000 -- [-826.518] (-827.044) (-826.855) (-834.435) * [-824.398] (-829.887) (-823.976) (-827.905) -- 0:00:45
261500 -- (-829.821) (-828.647) [-824.714] (-828.153) * (-824.317) [-826.276] (-825.701) (-825.158) -- 0:00:45
262000 -- (-824.832) (-827.189) [-824.316] (-828.097) * [-824.492] (-826.164) (-825.698) (-825.070) -- 0:00:45
262500 -- (-824.373) [-825.906] (-824.286) (-826.418) * (-824.465) [-826.355] (-829.477) (-828.642) -- 0:00:44
263000 -- (-826.522) (-824.757) (-825.611) [-827.627] * [-824.292] (-827.259) (-826.555) (-824.538) -- 0:00:44
263500 -- (-825.995) (-824.947) (-825.277) [-825.911] * (-827.649) (-828.732) [-826.789] (-825.409) -- 0:00:44
264000 -- (-826.201) (-824.259) [-830.365] (-827.488) * (-827.915) (-830.554) [-824.915] (-827.367) -- 0:00:44
264500 -- (-829.290) (-825.786) (-825.847) [-825.340] * (-826.486) (-827.433) [-824.806] (-830.713) -- 0:00:44
265000 -- (-824.730) [-825.598] (-824.497) (-827.273) * (-827.442) (-828.405) [-825.343] (-824.836) -- 0:00:44
Average standard deviation of split frequencies: 0.010042
265500 -- (-828.205) (-824.555) [-824.281] (-826.049) * (-827.165) (-828.331) [-827.794] (-825.351) -- 0:00:44
266000 -- (-828.623) (-825.269) (-825.947) [-826.096] * (-828.563) (-827.454) [-825.105] (-825.045) -- 0:00:44
266500 -- (-824.246) [-826.125] (-826.480) (-825.109) * (-830.107) (-827.304) [-826.765] (-825.407) -- 0:00:44
267000 -- (-824.279) (-830.327) (-824.801) [-824.150] * (-829.014) (-825.998) [-824.266] (-825.986) -- 0:00:43
267500 -- (-827.929) (-825.882) [-825.851] (-827.019) * (-826.199) (-826.553) (-824.373) [-825.217] -- 0:00:43
268000 -- (-827.867) (-825.009) [-826.153] (-829.128) * (-826.536) [-829.899] (-824.285) (-824.982) -- 0:00:43
268500 -- (-826.106) [-825.527] (-825.862) (-825.117) * (-825.461) [-825.538] (-825.864) (-825.848) -- 0:00:43
269000 -- (-825.070) (-826.718) [-826.313] (-830.208) * (-826.454) (-825.917) [-825.817] (-828.731) -- 0:00:43
269500 -- (-825.232) [-828.743] (-826.546) (-828.899) * (-828.520) (-826.335) (-830.174) [-824.974] -- 0:00:43
270000 -- (-824.779) (-825.009) [-826.573] (-824.549) * (-827.350) (-825.829) (-827.214) [-826.626] -- 0:00:43
Average standard deviation of split frequencies: 0.009938
270500 -- [-825.088] (-825.289) (-825.866) (-825.789) * [-825.554] (-825.960) (-826.697) (-825.343) -- 0:00:43
271000 -- (-827.658) (-832.345) [-824.584] (-824.824) * (-824.590) [-825.062] (-825.903) (-827.598) -- 0:00:43
271500 -- [-825.991] (-832.982) (-830.258) (-825.617) * [-825.674] (-825.973) (-829.872) (-826.344) -- 0:00:42
272000 -- (-825.820) [-825.399] (-832.357) (-824.490) * (-826.761) [-826.137] (-825.150) (-824.973) -- 0:00:42
272500 -- (-826.354) [-826.217] (-825.718) (-829.080) * (-824.761) [-825.838] (-825.934) (-825.711) -- 0:00:42
273000 -- (-826.161) (-824.389) (-827.776) [-826.981] * (-828.756) [-826.705] (-826.686) (-825.482) -- 0:00:42
273500 -- (-826.620) [-828.107] (-825.646) (-825.816) * (-829.748) (-827.637) (-823.845) [-826.430] -- 0:00:42
274000 -- [-825.524] (-826.130) (-826.310) (-826.574) * (-826.830) (-825.176) [-824.674] (-826.414) -- 0:00:45
274500 -- (-825.121) (-825.851) [-824.337] (-830.589) * (-826.926) [-824.635] (-824.845) (-824.918) -- 0:00:44
275000 -- [-824.974] (-826.479) (-824.993) (-826.319) * (-825.086) [-825.838] (-824.750) (-825.673) -- 0:00:44
Average standard deviation of split frequencies: 0.010248
275500 -- (-824.995) (-824.817) [-824.899] (-828.888) * (-824.719) (-824.983) [-828.587] (-826.125) -- 0:00:44
276000 -- (-825.600) [-824.839] (-824.852) (-826.351) * [-824.809] (-825.638) (-826.663) (-825.177) -- 0:00:44
276500 -- (-824.026) [-825.446] (-824.014) (-824.981) * (-826.549) (-828.470) [-826.437] (-824.353) -- 0:00:44
277000 -- [-825.098] (-825.446) (-826.733) (-826.409) * (-829.504) [-829.765] (-826.456) (-825.782) -- 0:00:44
277500 -- (-826.093) [-824.189] (-824.629) (-825.735) * (-826.214) (-829.360) (-825.981) [-825.469] -- 0:00:44
278000 -- (-826.816) [-825.014] (-823.977) (-825.023) * [-828.312] (-829.336) (-829.342) (-824.872) -- 0:00:44
278500 -- [-827.867] (-825.000) (-823.867) (-826.192) * (-828.348) (-824.756) (-825.371) [-824.163] -- 0:00:44
279000 -- [-824.414] (-824.782) (-824.728) (-827.019) * (-826.029) (-829.885) [-828.997] (-825.447) -- 0:00:43
279500 -- (-825.716) (-825.593) (-830.300) [-826.227] * (-829.641) (-825.470) [-826.453] (-824.440) -- 0:00:43
280000 -- (-825.992) (-826.151) [-827.413] (-825.883) * (-827.032) (-827.192) [-824.257] (-823.897) -- 0:00:43
Average standard deviation of split frequencies: 0.010078
280500 -- (-827.304) (-826.134) (-826.061) [-828.049] * (-826.377) (-825.060) (-830.374) [-826.432] -- 0:00:43
281000 -- (-827.250) (-825.834) [-825.759] (-826.175) * (-826.346) [-825.022] (-826.029) (-824.997) -- 0:00:43
281500 -- (-824.306) (-824.835) (-826.171) [-826.503] * (-827.701) [-827.575] (-826.465) (-829.110) -- 0:00:43
282000 -- (-827.500) [-824.241] (-828.181) (-827.015) * (-826.527) (-829.005) (-826.204) [-825.845] -- 0:00:43
282500 -- [-828.814] (-824.418) (-826.182) (-828.436) * (-826.525) (-827.390) [-827.707] (-826.234) -- 0:00:43
283000 -- (-825.037) [-824.457] (-824.244) (-824.932) * (-825.580) [-827.210] (-827.706) (-825.823) -- 0:00:43
283500 -- (-826.840) (-825.104) [-826.206] (-824.586) * (-824.434) (-826.375) [-826.233] (-824.283) -- 0:00:42
284000 -- (-826.187) (-826.679) (-825.756) [-828.355] * (-825.864) (-825.448) [-826.187] (-824.786) -- 0:00:42
284500 -- (-826.473) (-828.613) [-825.790] (-826.168) * [-826.767] (-826.519) (-825.401) (-825.263) -- 0:00:42
285000 -- (-827.117) (-825.150) (-826.400) [-824.090] * (-824.842) [-826.035] (-825.584) (-826.422) -- 0:00:42
Average standard deviation of split frequencies: 0.009981
285500 -- (-826.353) (-828.592) (-827.050) [-826.136] * (-825.021) (-825.303) (-826.256) [-824.771] -- 0:00:42
286000 -- (-826.341) (-828.413) [-827.413] (-826.116) * [-828.792] (-826.114) (-826.525) (-824.480) -- 0:00:42
286500 -- (-824.144) (-825.582) [-828.272] (-825.986) * (-829.941) (-826.135) [-824.376] (-827.896) -- 0:00:42
287000 -- [-824.453] (-825.526) (-828.741) (-826.338) * [-825.714] (-826.207) (-825.884) (-825.655) -- 0:00:42
287500 -- [-824.502] (-824.728) (-827.013) (-826.072) * (-826.437) [-826.783] (-826.672) (-824.829) -- 0:00:42
288000 -- (-825.004) (-828.145) (-826.852) [-825.917] * (-827.448) (-829.551) (-833.926) [-826.160] -- 0:00:42
288500 -- (-825.003) [-830.687] (-827.200) (-835.594) * [-827.950] (-829.436) (-825.697) (-824.534) -- 0:00:41
289000 -- [-824.739] (-826.182) (-827.342) (-833.144) * (-827.844) [-828.666] (-825.328) (-827.832) -- 0:00:44
289500 -- (-824.395) (-831.052) (-826.225) [-824.964] * (-825.226) [-825.650] (-825.941) (-828.460) -- 0:00:44
290000 -- [-825.627] (-829.003) (-825.131) (-827.227) * (-825.560) [-825.455] (-825.944) (-827.002) -- 0:00:44
Average standard deviation of split frequencies: 0.010362
290500 -- (-828.430) [-827.409] (-825.309) (-825.318) * (-825.211) (-825.254) (-826.668) [-827.598] -- 0:00:43
291000 -- (-826.252) (-826.598) (-827.392) [-824.632] * (-826.189) (-828.803) (-826.915) [-829.041] -- 0:00:43
291500 -- (-827.058) (-828.468) [-825.870] (-825.481) * (-828.690) [-830.047] (-831.942) (-827.452) -- 0:00:43
292000 -- (-825.579) (-825.596) [-825.802] (-830.387) * (-828.614) (-826.096) [-826.299] (-827.273) -- 0:00:43
292500 -- (-827.330) [-827.065] (-825.150) (-824.816) * (-830.999) (-825.068) [-826.465] (-826.529) -- 0:00:43
293000 -- (-834.221) [-828.194] (-828.134) (-827.974) * (-828.418) [-826.063] (-826.148) (-829.458) -- 0:00:43
293500 -- (-827.628) (-828.461) (-824.535) [-826.001] * (-829.459) [-826.340] (-825.912) (-825.503) -- 0:00:43
294000 -- (-832.674) [-825.890] (-828.309) (-829.111) * [-827.059] (-825.011) (-826.447) (-830.874) -- 0:00:43
294500 -- (-828.628) (-824.417) [-825.183] (-827.467) * (-825.470) (-826.489) (-825.431) [-825.461] -- 0:00:43
295000 -- (-826.998) (-829.993) (-828.338) [-825.671] * [-826.500] (-825.143) (-830.147) (-826.611) -- 0:00:43
Average standard deviation of split frequencies: 0.010706
295500 -- [-827.408] (-828.109) (-828.974) (-825.770) * (-824.911) [-824.401] (-828.369) (-827.206) -- 0:00:42
296000 -- (-825.561) (-828.255) (-825.245) [-825.958] * (-825.925) (-825.089) [-825.451] (-825.823) -- 0:00:42
296500 -- (-826.621) [-823.925] (-825.583) (-828.372) * [-825.021] (-827.071) (-827.054) (-827.108) -- 0:00:42
297000 -- (-827.801) (-825.044) [-825.911] (-826.338) * [-826.114] (-825.047) (-827.329) (-828.288) -- 0:00:42
297500 -- (-826.361) [-825.746] (-828.933) (-827.227) * (-825.423) (-826.946) [-825.713] (-827.464) -- 0:00:42
298000 -- (-829.981) (-824.072) [-824.652] (-825.943) * (-825.141) (-829.636) [-827.272] (-828.970) -- 0:00:42
298500 -- (-826.780) [-824.244] (-825.707) (-824.383) * (-826.498) (-827.530) (-825.665) [-825.371] -- 0:00:42
299000 -- (-828.102) (-830.054) (-826.023) [-827.746] * [-831.014] (-825.731) (-825.824) (-824.748) -- 0:00:42
299500 -- (-824.084) [-824.360] (-829.161) (-828.287) * (-828.140) [-826.491] (-826.778) (-825.184) -- 0:00:42
300000 -- (-826.684) (-827.120) (-827.702) [-827.322] * (-826.793) [-826.924] (-827.136) (-828.283) -- 0:00:42
Average standard deviation of split frequencies: 0.009499
300500 -- (-825.665) (-825.621) (-826.189) [-824.718] * (-825.720) (-824.429) (-827.433) [-833.202] -- 0:00:41
301000 -- [-824.448] (-824.138) (-828.838) (-824.856) * (-827.547) (-824.813) [-826.175] (-830.094) -- 0:00:41
301500 -- (-828.049) (-826.071) [-826.440] (-829.404) * (-829.538) (-824.565) [-824.815] (-825.968) -- 0:00:41
302000 -- (-826.413) [-824.920] (-829.723) (-825.657) * (-827.531) (-825.532) [-825.155] (-825.358) -- 0:00:41
302500 -- [-824.880] (-830.905) (-826.356) (-825.704) * [-826.401] (-827.222) (-826.225) (-825.438) -- 0:00:41
303000 -- (-826.415) (-832.197) [-827.452] (-826.902) * (-829.187) (-826.147) [-825.099] (-824.824) -- 0:00:41
303500 -- (-824.976) (-832.365) [-825.334] (-825.911) * (-826.538) (-826.837) [-825.253] (-825.898) -- 0:00:41
304000 -- (-824.736) [-826.936] (-825.638) (-829.960) * (-826.579) [-824.602] (-828.285) (-827.017) -- 0:00:41
304500 -- (-824.572) (-831.846) (-824.434) [-827.422] * (-824.618) (-825.009) (-828.432) [-825.068] -- 0:00:41
305000 -- [-824.843] (-826.444) (-826.591) (-827.039) * (-825.224) (-824.288) [-828.936] (-825.717) -- 0:00:41
Average standard deviation of split frequencies: 0.009515
305500 -- (-826.389) (-827.182) [-828.778] (-827.158) * (-825.706) [-827.007] (-825.343) (-827.954) -- 0:00:43
306000 -- [-825.576] (-827.918) (-825.910) (-826.229) * (-828.520) (-828.538) (-825.046) [-828.311] -- 0:00:43
306500 -- (-825.750) [-828.888] (-824.549) (-828.603) * [-824.550] (-828.357) (-825.223) (-829.113) -- 0:00:42
307000 -- (-828.603) [-826.945] (-827.235) (-826.594) * [-826.807] (-827.924) (-827.012) (-827.109) -- 0:00:42
307500 -- (-825.855) (-827.152) (-825.836) [-830.342] * (-825.042) (-826.864) [-824.771] (-824.320) -- 0:00:42
308000 -- (-824.945) [-831.963] (-824.467) (-827.385) * (-826.027) (-825.301) (-825.487) [-825.718] -- 0:00:42
308500 -- (-825.233) (-826.141) [-824.825] (-825.682) * [-825.887] (-826.050) (-826.135) (-828.108) -- 0:00:42
309000 -- (-825.713) (-829.826) (-827.547) [-825.322] * (-826.655) (-825.340) [-828.294] (-825.944) -- 0:00:42
309500 -- (-826.182) (-832.040) [-831.379] (-826.460) * (-825.844) (-824.984) [-826.491] (-825.197) -- 0:00:42
310000 -- (-824.499) (-825.665) [-825.106] (-825.867) * (-824.781) (-825.961) (-827.214) [-826.227] -- 0:00:42
Average standard deviation of split frequencies: 0.009908
310500 -- (-823.880) [-827.252] (-827.264) (-825.498) * (-827.230) (-826.672) (-828.632) [-825.565] -- 0:00:42
311000 -- (-826.784) (-824.642) [-825.387] (-824.379) * [-826.656] (-826.308) (-827.137) (-825.487) -- 0:00:42
311500 -- (-829.806) (-827.207) (-825.185) [-824.681] * (-825.780) [-825.722] (-826.849) (-825.626) -- 0:00:41
312000 -- (-827.612) [-826.872] (-825.163) (-824.740) * (-825.288) (-824.283) (-823.949) [-825.882] -- 0:00:41
312500 -- (-830.010) (-826.003) (-831.748) [-826.117] * (-826.237) [-825.462] (-824.464) (-830.841) -- 0:00:41
313000 -- (-825.152) [-826.090] (-825.547) (-827.453) * [-824.265] (-827.718) (-824.464) (-825.524) -- 0:00:41
313500 -- (-825.888) (-824.994) (-826.728) [-826.536] * [-826.233] (-825.649) (-825.978) (-825.964) -- 0:00:41
314000 -- [-825.952] (-826.759) (-827.111) (-824.085) * [-828.488] (-827.780) (-827.071) (-826.398) -- 0:00:41
314500 -- (-824.456) (-824.584) [-824.823] (-825.532) * (-824.392) (-830.551) [-825.057] (-824.376) -- 0:00:41
315000 -- (-825.919) (-828.009) (-826.125) [-826.232] * (-826.661) (-827.722) (-825.745) [-824.813] -- 0:00:41
Average standard deviation of split frequencies: 0.009976
315500 -- (-825.509) (-828.010) (-826.237) [-827.551] * (-829.512) (-825.874) (-825.518) [-824.420] -- 0:00:41
316000 -- (-825.029) (-825.049) (-827.829) [-825.035] * (-828.145) (-824.435) [-825.304] (-826.338) -- 0:00:41
316500 -- (-825.029) (-825.192) (-830.465) [-825.967] * [-825.300] (-826.812) (-825.154) (-828.763) -- 0:00:41
317000 -- (-824.727) (-824.073) [-827.764] (-825.967) * (-826.268) (-825.155) (-828.107) [-828.656] -- 0:00:40
317500 -- (-824.956) [-826.778] (-827.815) (-831.393) * (-827.509) (-825.302) (-826.339) [-830.814] -- 0:00:40
318000 -- (-826.617) (-829.997) (-825.314) [-826.240] * (-828.372) [-824.258] (-826.445) (-828.038) -- 0:00:40
318500 -- (-827.111) (-825.144) (-824.215) [-826.731] * (-831.505) (-831.156) (-829.279) [-826.040] -- 0:00:40
319000 -- (-827.161) (-825.276) (-824.168) [-824.340] * [-825.492] (-827.352) (-826.284) (-825.976) -- 0:00:40
319500 -- (-828.361) (-829.365) [-824.399] (-826.056) * (-827.355) (-830.144) (-827.222) [-825.291] -- 0:00:40
320000 -- (-824.798) (-830.980) [-826.344] (-830.078) * (-825.644) (-826.679) [-826.204] (-825.155) -- 0:00:40
Average standard deviation of split frequencies: 0.008085
320500 -- (-825.049) [-825.665] (-825.651) (-828.310) * (-824.331) [-829.120] (-826.406) (-824.645) -- 0:00:40
321000 -- [-824.598] (-827.378) (-828.527) (-825.749) * (-823.991) [-830.006] (-827.120) (-824.923) -- 0:00:40
321500 -- (-828.256) [-826.226] (-826.638) (-825.832) * [-826.942] (-825.755) (-824.735) (-825.784) -- 0:00:40
322000 -- (-827.499) (-830.569) [-826.541] (-825.233) * (-825.801) [-824.619] (-824.735) (-827.852) -- 0:00:42
322500 -- [-829.493] (-824.178) (-828.933) (-824.707) * [-825.465] (-824.808) (-826.356) (-826.515) -- 0:00:42
323000 -- (-826.010) (-826.637) [-826.277] (-825.350) * (-826.477) (-826.603) [-826.166] (-825.417) -- 0:00:41
323500 -- (-829.314) (-829.282) [-824.543] (-826.012) * [-826.378] (-824.104) (-827.158) (-824.626) -- 0:00:41
324000 -- (-824.188) (-825.969) [-825.067] (-828.545) * (-825.972) (-824.135) (-825.640) [-824.008] -- 0:00:41
324500 -- (-824.606) (-828.354) [-825.011] (-825.008) * (-826.707) (-824.960) [-825.799] (-832.505) -- 0:00:41
325000 -- (-825.675) (-827.813) [-824.848] (-825.863) * (-826.596) (-825.011) (-826.257) [-826.337] -- 0:00:41
Average standard deviation of split frequencies: 0.007411
325500 -- (-828.121) (-824.523) [-824.222] (-825.422) * (-826.469) [-824.997] (-826.799) (-826.232) -- 0:00:41
326000 -- (-825.439) (-825.302) (-825.481) [-828.668] * (-827.967) (-823.921) (-827.859) [-826.346] -- 0:00:41
326500 -- (-827.541) [-824.491] (-825.407) (-825.897) * (-824.749) (-825.422) (-826.065) [-827.791] -- 0:00:41
327000 -- (-826.624) (-826.365) [-825.588] (-825.449) * (-824.551) [-825.721] (-825.519) (-825.632) -- 0:00:41
327500 -- (-824.456) (-826.592) [-826.745] (-827.597) * (-825.880) (-825.778) [-824.715] (-828.208) -- 0:00:41
328000 -- (-829.327) (-825.903) (-828.428) [-826.765] * (-826.936) (-825.568) [-825.231] (-829.517) -- 0:00:40
328500 -- (-826.755) (-829.059) (-826.842) [-824.562] * [-825.220] (-825.932) (-825.050) (-828.303) -- 0:00:40
329000 -- (-826.732) (-825.750) (-825.186) [-824.595] * (-827.021) (-827.555) (-825.425) [-825.170] -- 0:00:40
329500 -- (-824.846) (-826.856) (-824.658) [-825.485] * (-825.324) (-825.726) [-825.103] (-825.166) -- 0:00:40
330000 -- (-823.978) (-824.558) (-825.791) [-826.356] * (-825.403) (-825.416) [-826.389] (-826.183) -- 0:00:40
Average standard deviation of split frequencies: 0.006950
330500 -- [-824.167] (-824.112) (-825.351) (-825.757) * (-825.166) [-826.170] (-826.451) (-828.070) -- 0:00:40
331000 -- (-827.036) (-829.980) (-826.766) [-827.087] * (-826.257) (-827.197) (-828.677) [-828.456] -- 0:00:40
331500 -- (-827.837) (-825.149) (-828.487) [-825.578] * (-827.424) [-826.388] (-826.547) (-827.655) -- 0:00:40
332000 -- (-826.239) [-827.518] (-825.758) (-828.381) * (-826.244) [-824.956] (-824.593) (-830.253) -- 0:00:40
332500 -- [-826.517] (-824.923) (-828.510) (-826.960) * (-825.459) (-827.903) [-826.100] (-826.718) -- 0:00:40
333000 -- (-825.111) (-829.123) (-828.723) [-826.192] * (-826.602) (-828.878) (-828.238) [-826.187] -- 0:00:40
333500 -- [-826.547] (-830.037) (-824.699) (-825.553) * [-825.741] (-826.266) (-830.202) (-825.820) -- 0:00:39
334000 -- (-825.920) [-824.481] (-826.259) (-825.002) * [-825.408] (-826.824) (-829.560) (-827.449) -- 0:00:39
334500 -- (-824.118) (-825.970) [-827.789] (-830.633) * (-826.039) [-824.153] (-829.702) (-825.290) -- 0:00:39
335000 -- (-834.507) (-827.500) [-827.608] (-826.480) * (-824.722) (-825.881) [-825.429] (-828.766) -- 0:00:39
Average standard deviation of split frequencies: 0.007345
335500 -- [-827.571] (-825.246) (-824.973) (-826.550) * (-825.729) (-825.809) (-826.277) [-826.987] -- 0:00:39
336000 -- [-826.764] (-824.619) (-829.402) (-827.473) * [-825.716] (-829.374) (-824.927) (-826.679) -- 0:00:39
336500 -- (-825.912) (-825.810) [-828.707] (-832.402) * (-827.914) (-828.217) [-827.895] (-827.237) -- 0:00:39
337000 -- [-825.452] (-826.298) (-825.717) (-830.090) * [-827.574] (-830.049) (-829.239) (-826.827) -- 0:00:39
337500 -- [-826.557] (-826.655) (-825.958) (-826.519) * (-827.853) (-827.684) (-829.137) [-825.606] -- 0:00:39
338000 -- (-826.914) (-829.700) [-824.166] (-826.271) * (-828.373) (-824.907) (-826.824) [-825.216] -- 0:00:39
338500 -- [-827.822] (-828.418) (-825.547) (-830.008) * [-825.356] (-824.255) (-830.310) (-826.906) -- 0:00:41
339000 -- (-825.190) (-829.765) [-827.026] (-825.845) * (-825.066) [-828.218] (-829.217) (-826.313) -- 0:00:40
339500 -- (-830.428) (-830.309) (-828.054) [-826.373] * (-827.510) (-826.623) (-827.772) [-826.774] -- 0:00:40
340000 -- (-828.436) (-824.408) [-825.616] (-826.398) * (-824.377) [-827.411] (-829.602) (-827.649) -- 0:00:40
Average standard deviation of split frequencies: 0.007082
340500 -- [-824.891] (-825.670) (-826.502) (-824.665) * (-825.940) (-825.956) [-829.234] (-830.996) -- 0:00:40
341000 -- [-826.101] (-827.769) (-824.739) (-824.700) * [-826.536] (-824.899) (-832.647) (-825.272) -- 0:00:40
341500 -- (-825.063) (-830.237) [-829.346] (-826.637) * (-829.033) (-826.392) (-830.316) [-826.102] -- 0:00:40
342000 -- (-826.248) (-837.593) (-828.367) [-829.219] * [-825.661] (-824.534) (-827.052) (-826.172) -- 0:00:40
342500 -- [-825.782] (-826.540) (-825.199) (-831.812) * (-826.493) [-825.312] (-828.245) (-826.883) -- 0:00:40
343000 -- (-825.494) [-826.336] (-825.297) (-827.544) * (-826.684) [-825.973] (-827.407) (-828.176) -- 0:00:40
343500 -- (-826.287) (-828.556) (-829.277) [-830.353] * (-827.949) (-825.509) [-827.833] (-828.045) -- 0:00:40
344000 -- (-825.740) (-829.690) [-826.276] (-829.486) * [-824.900] (-831.151) (-824.590) (-825.919) -- 0:00:40
344500 -- [-825.973] (-826.814) (-825.711) (-828.170) * (-825.048) [-827.840] (-826.461) (-825.103) -- 0:00:39
345000 -- (-825.755) (-830.581) (-827.540) [-824.806] * (-824.964) (-824.327) [-824.805] (-825.867) -- 0:00:39
Average standard deviation of split frequencies: 0.007373
345500 -- (-825.190) (-826.340) (-827.254) [-825.201] * (-825.040) (-825.747) (-826.216) [-825.197] -- 0:00:39
346000 -- [-825.492] (-828.691) (-826.093) (-826.080) * (-827.516) (-826.470) [-826.980] (-823.792) -- 0:00:39
346500 -- [-825.187] (-826.617) (-829.031) (-824.992) * (-824.618) [-825.105] (-825.977) (-830.642) -- 0:00:39
347000 -- (-825.599) (-824.204) (-826.459) [-825.054] * (-827.676) [-828.029] (-827.682) (-825.370) -- 0:00:39
347500 -- (-828.433) [-823.980] (-825.983) (-827.418) * [-824.900] (-827.411) (-827.664) (-826.694) -- 0:00:39
348000 -- (-826.267) (-824.346) (-827.936) [-826.430] * (-827.053) [-828.090] (-832.882) (-828.724) -- 0:00:39
348500 -- (-824.872) (-824.346) (-832.058) [-826.242] * (-824.612) [-827.610] (-826.709) (-827.493) -- 0:00:39
349000 -- (-825.364) (-825.151) [-826.745] (-826.764) * (-823.878) (-825.467) [-829.153] (-824.988) -- 0:00:39
349500 -- (-828.755) (-827.664) [-825.938] (-824.073) * (-826.933) (-826.513) (-826.781) [-824.399] -- 0:00:39
350000 -- (-826.109) (-835.944) [-826.637] (-824.910) * (-826.889) (-825.085) (-824.958) [-825.328] -- 0:00:39
Average standard deviation of split frequencies: 0.007908
350500 -- (-825.922) (-830.606) (-825.501) [-825.557] * (-828.885) (-828.130) (-826.725) [-826.749] -- 0:00:38
351000 -- (-825.863) (-827.484) [-825.965] (-824.670) * (-830.345) [-827.862] (-825.018) (-824.917) -- 0:00:38
351500 -- [-826.610] (-825.707) (-823.902) (-827.209) * [-830.454] (-829.861) (-826.536) (-825.630) -- 0:00:38
352000 -- (-826.417) (-826.178) [-824.375] (-829.930) * [-826.633] (-834.312) (-828.028) (-827.195) -- 0:00:38
352500 -- (-824.527) (-825.229) (-824.804) [-825.688] * (-825.101) (-831.125) [-829.358] (-827.471) -- 0:00:38
353000 -- [-825.711] (-828.638) (-825.866) (-825.442) * [-826.469] (-828.610) (-826.496) (-828.511) -- 0:00:38
353500 -- (-829.605) [-827.926] (-831.407) (-825.577) * (-824.908) [-827.771] (-824.338) (-828.074) -- 0:00:38
354000 -- (-824.431) (-824.791) [-828.041] (-829.423) * [-824.863] (-827.855) (-824.669) (-825.030) -- 0:00:38
354500 -- (-824.042) (-827.843) [-828.871] (-826.811) * (-826.269) (-825.096) (-826.033) [-824.312] -- 0:00:38
355000 -- (-824.222) (-827.420) [-829.434] (-825.800) * (-824.538) (-826.218) [-825.868] (-824.170) -- 0:00:39
Average standard deviation of split frequencies: 0.007789
355500 -- [-824.287] (-825.242) (-825.921) (-831.293) * (-824.297) [-829.044] (-825.377) (-829.707) -- 0:00:39
356000 -- [-825.445] (-824.864) (-826.139) (-826.144) * (-825.378) [-824.885] (-826.791) (-826.159) -- 0:00:39
356500 -- (-825.848) (-825.584) (-829.101) [-827.900] * [-824.769] (-824.976) (-827.604) (-826.244) -- 0:00:39
357000 -- (-824.031) (-825.770) (-828.154) [-828.062] * (-825.822) [-825.690] (-826.986) (-831.705) -- 0:00:39
357500 -- (-824.491) [-828.816] (-830.072) (-827.528) * (-826.855) (-825.134) (-824.857) [-829.993] -- 0:00:39
358000 -- (-825.297) (-827.145) (-828.180) [-825.948] * (-824.614) [-825.792] (-825.147) (-825.727) -- 0:00:39
358500 -- [-826.348] (-828.753) (-828.004) (-830.935) * [-824.252] (-826.097) (-830.110) (-828.013) -- 0:00:39
359000 -- [-824.552] (-828.034) (-828.530) (-827.518) * [-825.123] (-826.700) (-826.937) (-828.103) -- 0:00:39
359500 -- (-826.827) (-827.820) [-830.925] (-832.233) * (-826.221) (-824.276) (-824.683) [-827.314] -- 0:00:39
360000 -- (-825.097) [-827.428] (-824.945) (-826.621) * (-826.218) (-826.019) (-825.785) [-824.709] -- 0:00:39
Average standard deviation of split frequencies: 0.007842
360500 -- (-825.118) (-826.094) [-824.228] (-825.909) * (-824.548) [-829.344] (-824.970) (-825.630) -- 0:00:39
361000 -- (-825.065) (-827.055) (-825.081) [-824.690] * (-827.972) [-827.129] (-824.374) (-826.191) -- 0:00:38
361500 -- (-824.619) (-826.999) (-826.698) [-825.527] * (-827.116) (-826.882) (-825.842) [-826.818] -- 0:00:38
362000 -- (-826.492) (-825.682) (-826.441) [-824.494] * [-825.002] (-824.179) (-828.935) (-825.905) -- 0:00:38
362500 -- (-827.892) (-825.236) [-823.992] (-824.403) * (-829.649) (-825.815) [-824.380] (-825.522) -- 0:00:38
363000 -- (-826.603) (-826.975) (-826.677) [-826.050] * (-826.449) (-828.233) (-824.702) [-824.547] -- 0:00:38
363500 -- (-826.659) [-825.763] (-827.455) (-826.601) * [-826.532] (-824.157) (-826.147) (-824.294) -- 0:00:38
364000 -- [-826.554] (-825.239) (-826.258) (-824.643) * [-824.301] (-826.557) (-825.065) (-826.902) -- 0:00:38
364500 -- (-826.852) (-825.572) (-826.126) [-824.073] * (-824.969) (-826.742) [-825.381] (-826.377) -- 0:00:38
365000 -- (-827.568) (-828.786) (-827.734) [-829.126] * (-825.816) (-825.860) (-826.586) [-824.477] -- 0:00:38
Average standard deviation of split frequencies: 0.008229
365500 -- [-824.585] (-827.225) (-824.520) (-827.893) * (-826.762) (-826.781) (-829.462) [-823.953] -- 0:00:38
366000 -- (-830.429) (-825.358) (-826.215) [-826.903] * [-824.767] (-828.717) (-826.101) (-826.193) -- 0:00:38
366500 -- (-824.324) [-827.201] (-827.607) (-825.868) * [-825.097] (-827.438) (-830.846) (-825.874) -- 0:00:38
367000 -- (-827.158) [-826.801] (-829.737) (-826.331) * [-825.557] (-825.987) (-826.721) (-826.164) -- 0:00:37
367500 -- [-824.527] (-827.829) (-831.009) (-824.269) * [-823.844] (-826.147) (-826.512) (-828.152) -- 0:00:37
368000 -- (-824.015) (-826.966) [-824.373] (-824.839) * (-823.844) (-827.729) [-824.640] (-828.041) -- 0:00:37
368500 -- (-825.899) (-826.954) (-824.626) [-826.212] * [-825.826] (-834.854) (-826.603) (-828.106) -- 0:00:37
369000 -- (-827.269) (-824.173) [-824.624] (-824.606) * (-825.284) (-825.214) (-826.090) [-826.535] -- 0:00:37
369500 -- [-825.180] (-824.823) (-826.067) (-825.432) * (-827.038) (-825.062) [-827.594] (-828.096) -- 0:00:37
370000 -- (-825.013) (-825.482) [-824.569] (-827.037) * (-824.949) (-824.192) (-825.880) [-824.410] -- 0:00:37
Average standard deviation of split frequencies: 0.008055
370500 -- (-824.741) [-826.664] (-825.658) (-826.762) * (-824.960) [-824.656] (-827.963) (-826.037) -- 0:00:37
371000 -- (-826.288) (-824.484) (-826.159) [-828.763] * (-826.115) [-826.334] (-827.408) (-826.617) -- 0:00:37
371500 -- (-826.157) (-824.215) [-830.069] (-828.087) * (-825.374) (-829.625) (-827.698) [-827.544] -- 0:00:38
372000 -- (-825.573) [-826.280] (-826.012) (-825.949) * (-829.664) (-829.148) (-826.437) [-826.167] -- 0:00:38
372500 -- [-826.383] (-834.634) (-825.951) (-825.548) * [-829.546] (-829.332) (-826.320) (-826.180) -- 0:00:38
373000 -- [-826.093] (-825.885) (-831.710) (-828.058) * [-826.120] (-824.766) (-825.124) (-825.387) -- 0:00:38
373500 -- [-824.997] (-825.909) (-827.645) (-827.896) * (-831.966) (-825.725) (-825.634) [-827.293] -- 0:00:38
374000 -- (-824.347) [-829.341] (-826.367) (-825.191) * [-828.500] (-827.147) (-824.386) (-826.217) -- 0:00:38
374500 -- [-824.476] (-825.311) (-826.525) (-826.019) * (-826.105) (-825.433) [-824.778] (-824.471) -- 0:00:38
375000 -- (-824.843) (-825.276) (-826.245) [-825.550] * (-825.397) [-825.569] (-825.222) (-824.459) -- 0:00:38
Average standard deviation of split frequencies: 0.008985
375500 -- (-825.565) (-824.079) [-824.951] (-827.397) * (-827.227) (-824.866) [-827.639] (-824.337) -- 0:00:38
376000 -- (-826.500) [-824.962] (-825.504) (-824.053) * [-825.828] (-825.970) (-827.884) (-828.138) -- 0:00:38
376500 -- (-827.662) (-831.163) [-825.528] (-824.628) * (-827.459) (-825.171) (-824.708) [-827.466] -- 0:00:38
377000 -- (-825.767) (-827.489) [-825.042] (-825.311) * (-825.088) (-826.244) (-826.520) [-825.373] -- 0:00:38
377500 -- (-825.442) (-824.924) [-824.723] (-824.914) * (-828.934) [-825.557] (-824.737) (-830.579) -- 0:00:37
378000 -- (-826.026) (-826.159) [-828.524] (-825.583) * (-828.571) (-825.624) [-824.102] (-827.563) -- 0:00:37
378500 -- (-824.726) [-826.000] (-830.521) (-830.701) * (-829.140) [-825.700] (-825.709) (-828.343) -- 0:00:37
379000 -- [-825.587] (-826.099) (-825.546) (-825.888) * [-827.358] (-828.636) (-826.452) (-832.177) -- 0:00:37
379500 -- (-828.041) (-827.187) [-828.952] (-825.053) * (-826.051) [-825.324] (-825.226) (-827.695) -- 0:00:37
380000 -- (-825.613) [-824.752] (-828.372) (-824.529) * [-824.581] (-825.817) (-828.843) (-825.557) -- 0:00:37
Average standard deviation of split frequencies: 0.008462
380500 -- (-826.383) [-827.974] (-827.437) (-825.881) * [-824.798] (-826.550) (-826.672) (-825.162) -- 0:00:37
381000 -- [-826.353] (-828.273) (-825.021) (-826.340) * [-824.447] (-824.423) (-827.006) (-825.337) -- 0:00:37
381500 -- (-826.177) (-824.134) (-827.136) [-825.628] * (-826.481) (-826.489) (-825.799) [-826.904] -- 0:00:37
382000 -- (-825.245) [-825.139] (-826.085) (-825.706) * (-825.485) (-829.642) (-826.445) [-825.265] -- 0:00:37
382500 -- (-823.920) (-824.759) [-830.507] (-828.129) * (-825.900) (-825.892) (-825.642) [-825.513] -- 0:00:37
383000 -- [-825.063] (-826.450) (-827.364) (-824.555) * [-825.492] (-826.061) (-828.353) (-825.669) -- 0:00:37
383500 -- (-827.338) [-826.515] (-824.540) (-825.150) * (-824.692) [-826.563] (-825.051) (-826.789) -- 0:00:36
384000 -- (-826.995) (-826.553) [-825.919] (-825.729) * (-824.567) (-824.933) (-826.727) [-824.578] -- 0:00:36
384500 -- (-824.899) [-825.328] (-824.927) (-825.627) * (-826.048) (-823.866) (-830.200) [-824.997] -- 0:00:36
385000 -- (-824.906) (-825.128) [-824.878] (-825.461) * (-824.757) (-824.953) [-824.635] (-826.819) -- 0:00:36
Average standard deviation of split frequencies: 0.007938
385500 -- (-824.998) (-826.573) [-825.486] (-825.388) * (-827.773) (-824.128) [-829.057] (-828.182) -- 0:00:36
386000 -- (-825.189) (-826.897) (-827.390) [-827.914] * (-824.305) [-823.774] (-827.091) (-825.650) -- 0:00:36
386500 -- (-826.369) [-825.950] (-823.893) (-827.328) * (-824.661) [-828.458] (-827.778) (-826.754) -- 0:00:36
387000 -- [-827.180] (-824.598) (-827.338) (-830.923) * (-824.923) [-828.417] (-826.098) (-828.511) -- 0:00:36
387500 -- (-831.590) (-825.205) (-827.782) [-826.443] * (-825.092) [-824.515] (-825.050) (-829.488) -- 0:00:36
388000 -- [-824.982] (-825.348) (-827.037) (-824.545) * (-824.629) (-826.477) (-825.383) [-826.262] -- 0:00:37
388500 -- (-825.635) (-826.933) (-826.906) [-826.421] * [-825.842] (-826.116) (-824.720) (-826.319) -- 0:00:37
389000 -- (-825.999) (-827.679) (-823.982) [-825.220] * (-825.312) (-824.566) (-824.895) [-828.870] -- 0:00:37
389500 -- (-827.034) [-824.993] (-824.088) (-825.589) * (-827.202) (-824.089) (-828.252) [-826.668] -- 0:00:37
390000 -- (-826.891) [-827.237] (-824.796) (-825.021) * [-828.527] (-825.039) (-825.862) (-828.316) -- 0:00:37
Average standard deviation of split frequencies: 0.006905
390500 -- [-825.263] (-828.540) (-828.626) (-825.287) * (-826.336) (-829.243) [-825.266] (-827.630) -- 0:00:37
391000 -- (-829.956) (-828.456) (-826.273) [-830.660] * [-826.112] (-827.196) (-825.423) (-829.691) -- 0:00:37
391500 -- (-830.269) (-825.206) (-830.216) [-826.643] * (-827.659) (-827.668) (-826.559) [-825.088] -- 0:00:37
392000 -- (-828.709) [-825.813] (-828.685) (-827.842) * (-827.951) [-828.609] (-827.915) (-830.266) -- 0:00:37
392500 -- (-825.082) [-824.825] (-831.927) (-827.770) * [-824.384] (-828.357) (-825.170) (-827.438) -- 0:00:37
393000 -- (-825.071) [-825.214] (-826.398) (-824.786) * (-825.783) [-825.705] (-825.543) (-832.135) -- 0:00:37
393500 -- (-825.498) (-825.299) (-823.828) [-828.525] * (-826.445) (-824.366) [-825.612] (-824.626) -- 0:00:36
394000 -- [-827.367] (-826.036) (-825.850) (-827.936) * (-829.059) (-825.822) [-825.544] (-826.865) -- 0:00:36
394500 -- (-827.921) [-825.192] (-827.869) (-829.177) * (-828.154) [-825.333] (-825.601) (-826.766) -- 0:00:36
395000 -- [-826.344] (-826.122) (-829.015) (-830.725) * [-828.560] (-825.617) (-824.172) (-825.056) -- 0:00:36
Average standard deviation of split frequencies: 0.007076
395500 -- (-825.662) (-825.994) [-824.911] (-826.674) * [-827.175] (-824.748) (-824.710) (-825.348) -- 0:00:36
396000 -- [-826.190] (-825.050) (-827.928) (-827.970) * [-825.601] (-824.597) (-825.191) (-824.762) -- 0:00:36
396500 -- [-826.728] (-825.919) (-825.613) (-826.046) * (-824.418) [-827.036] (-829.139) (-825.651) -- 0:00:36
397000 -- (-830.549) (-826.220) (-828.496) [-825.658] * (-826.189) (-828.775) (-828.832) [-825.458] -- 0:00:36
397500 -- (-826.592) (-828.762) (-825.873) [-825.469] * [-825.383] (-827.676) (-826.398) (-825.586) -- 0:00:36
398000 -- (-825.595) (-827.195) [-826.342] (-827.905) * (-825.024) [-825.996] (-830.378) (-823.769) -- 0:00:36
398500 -- [-825.679] (-825.300) (-825.998) (-826.482) * (-825.238) (-825.529) [-829.274] (-826.670) -- 0:00:36
399000 -- (-824.224) (-828.876) (-829.130) [-826.739] * (-825.314) [-826.827] (-825.291) (-829.649) -- 0:00:36
399500 -- [-825.646] (-834.637) (-828.953) (-825.455) * (-826.661) (-825.775) (-824.852) [-824.640] -- 0:00:36
400000 -- (-825.555) (-825.043) [-825.075] (-824.502) * (-827.093) [-827.163] (-828.809) (-825.206) -- 0:00:36
Average standard deviation of split frequencies: 0.007405
400500 -- [-827.039] (-826.716) (-825.069) (-824.250) * (-824.844) (-825.403) (-831.271) [-824.101] -- 0:00:35
401000 -- (-826.346) (-828.762) [-824.955] (-829.546) * (-825.612) (-825.403) [-830.833] (-825.165) -- 0:00:35
401500 -- (-826.242) [-826.263] (-824.620) (-826.611) * (-825.535) (-825.214) [-827.278] (-824.461) -- 0:00:35
402000 -- (-826.396) (-828.083) (-826.476) [-826.224] * [-824.220] (-825.250) (-826.915) (-826.485) -- 0:00:35
402500 -- (-825.998) (-824.755) [-824.431] (-827.218) * [-825.217] (-827.900) (-825.402) (-825.456) -- 0:00:35
403000 -- (-825.841) [-824.307] (-824.665) (-824.471) * (-826.094) [-825.359] (-824.645) (-824.748) -- 0:00:35
403500 -- [-825.205] (-824.739) (-828.128) (-828.141) * (-826.349) (-824.750) [-827.595] (-824.504) -- 0:00:35
404000 -- (-824.821) (-824.932) (-826.779) [-826.375] * (-827.922) [-825.130] (-826.903) (-829.947) -- 0:00:35
404500 -- [-823.906] (-827.620) (-825.983) (-828.919) * (-825.541) (-826.227) [-827.943] (-827.196) -- 0:00:35
405000 -- (-823.998) (-825.760) [-825.019] (-825.744) * (-824.369) (-825.465) (-826.181) [-825.942] -- 0:00:36
Average standard deviation of split frequencies: 0.007171
405500 -- [-825.308] (-825.162) (-825.312) (-825.851) * (-824.526) (-826.078) [-824.474] (-826.413) -- 0:00:36
406000 -- [-826.495] (-826.159) (-827.595) (-824.643) * [-825.319] (-825.116) (-824.392) (-825.864) -- 0:00:36
406500 -- [-825.910] (-825.913) (-826.194) (-825.732) * (-824.432) (-828.135) [-827.893] (-827.263) -- 0:00:36
407000 -- (-825.444) (-825.622) [-826.679] (-826.897) * [-825.992] (-827.265) (-824.534) (-826.083) -- 0:00:36
407500 -- (-827.282) (-828.421) [-825.615] (-832.574) * [-825.823] (-824.980) (-826.555) (-828.381) -- 0:00:36
408000 -- (-827.357) [-827.896] (-827.315) (-829.122) * (-826.189) [-824.853] (-825.881) (-827.176) -- 0:00:36
408500 -- (-827.311) (-825.766) [-826.291] (-828.661) * (-824.484) [-826.802] (-824.799) (-828.714) -- 0:00:36
409000 -- (-828.106) [-826.286] (-827.903) (-827.008) * (-825.113) (-825.472) (-825.408) [-827.260] -- 0:00:36
409500 -- [-827.194] (-828.934) (-824.394) (-826.325) * (-824.565) [-825.619] (-826.309) (-825.552) -- 0:00:36
410000 -- [-824.806] (-826.625) (-824.441) (-827.309) * [-825.999] (-825.600) (-826.311) (-826.114) -- 0:00:35
Average standard deviation of split frequencies: 0.007225
410500 -- [-825.363] (-828.244) (-824.993) (-826.042) * (-830.079) (-826.293) (-826.313) [-824.501] -- 0:00:35
411000 -- (-827.231) (-825.215) (-825.253) [-826.181] * (-826.896) [-826.128] (-826.812) (-824.597) -- 0:00:35
411500 -- (-827.572) (-825.267) (-825.901) [-825.173] * (-828.649) [-829.200] (-826.903) (-827.548) -- 0:00:35
412000 -- (-825.311) [-826.193] (-825.805) (-827.178) * (-825.273) (-832.327) [-825.396] (-828.546) -- 0:00:35
412500 -- (-827.133) (-826.644) (-826.144) [-827.163] * (-827.575) (-827.005) (-827.742) [-825.976] -- 0:00:35
413000 -- (-825.681) (-829.053) [-825.144] (-827.395) * (-825.954) (-828.610) [-827.083] (-828.170) -- 0:00:35
413500 -- (-825.981) (-824.967) [-825.109] (-826.244) * [-828.421] (-830.688) (-832.527) (-825.542) -- 0:00:35
414000 -- (-827.992) [-824.942] (-824.261) (-826.878) * [-825.226] (-825.882) (-833.280) (-831.315) -- 0:00:35
414500 -- (-829.806) [-825.732] (-824.748) (-824.420) * (-826.864) (-827.964) [-827.453] (-826.961) -- 0:00:35
415000 -- (-826.793) (-825.800) (-827.537) [-825.064] * (-828.306) (-825.516) [-828.552] (-828.575) -- 0:00:35
Average standard deviation of split frequencies: 0.006732
415500 -- [-824.668] (-824.076) (-828.482) (-825.222) * (-826.533) (-825.409) [-827.221] (-828.275) -- 0:00:35
416000 -- (-829.361) (-824.756) (-829.750) [-825.264] * (-823.934) (-824.784) [-824.688] (-825.973) -- 0:00:35
416500 -- (-826.875) (-826.998) (-829.227) [-825.139] * [-825.697] (-824.877) (-827.224) (-825.443) -- 0:00:35
417000 -- (-825.436) [-826.217] (-825.949) (-825.786) * (-826.635) (-825.762) (-826.940) [-826.088] -- 0:00:34
417500 -- [-827.269] (-826.955) (-826.365) (-825.113) * (-829.144) [-834.582] (-824.902) (-826.976) -- 0:00:34
418000 -- [-825.966] (-826.731) (-826.952) (-825.397) * (-826.608) [-829.685] (-826.922) (-826.290) -- 0:00:34
418500 -- (-826.969) (-824.452) [-825.451] (-824.788) * (-825.529) (-830.036) (-826.235) [-824.814] -- 0:00:34
419000 -- [-825.201] (-824.158) (-825.527) (-828.560) * (-824.514) [-830.864] (-824.240) (-824.816) -- 0:00:34
419500 -- [-824.873] (-831.979) (-828.394) (-828.080) * [-826.128] (-826.172) (-825.586) (-824.717) -- 0:00:34
420000 -- (-826.244) (-826.078) [-825.130] (-826.273) * [-825.970] (-827.369) (-825.159) (-824.681) -- 0:00:34
Average standard deviation of split frequencies: 0.007251
420500 -- (-828.026) [-826.948] (-824.571) (-825.249) * (-824.520) [-824.220] (-825.911) (-824.160) -- 0:00:34
421000 -- (-830.919) (-825.738) (-824.606) [-828.160] * (-827.229) (-826.867) (-829.613) [-826.589] -- 0:00:34
421500 -- (-824.920) (-826.469) [-824.611] (-827.897) * (-825.761) [-826.708] (-825.183) (-832.119) -- 0:00:34
422000 -- (-829.655) [-827.662] (-824.622) (-824.654) * (-824.371) (-826.900) (-826.251) [-826.118] -- 0:00:35
422500 -- (-829.712) [-827.310] (-826.928) (-826.547) * [-824.719] (-825.309) (-825.787) (-829.388) -- 0:00:35
423000 -- (-827.657) [-826.359] (-827.717) (-830.779) * (-824.628) (-825.895) (-825.903) [-829.205] -- 0:00:35
423500 -- (-827.095) (-833.520) (-824.785) [-827.633] * (-827.074) (-829.862) [-831.356] (-826.023) -- 0:00:35
424000 -- (-827.101) [-824.916] (-824.007) (-826.747) * (-826.330) [-825.510] (-827.581) (-825.611) -- 0:00:35
424500 -- [-824.659] (-828.118) (-824.197) (-828.501) * (-826.831) [-825.545] (-825.386) (-826.452) -- 0:00:35
425000 -- (-825.113) (-826.315) [-824.450] (-827.806) * (-825.630) (-826.339) [-826.165] (-826.243) -- 0:00:35
Average standard deviation of split frequencies: 0.007746
425500 -- (-825.620) (-825.192) [-824.305] (-825.470) * [-825.185] (-827.824) (-826.555) (-828.261) -- 0:00:35
426000 -- [-826.098] (-823.930) (-826.255) (-824.817) * (-825.135) (-827.322) [-825.563] (-828.349) -- 0:00:35
426500 -- [-825.856] (-824.454) (-826.015) (-825.381) * (-825.284) [-830.057] (-823.991) (-825.545) -- 0:00:34
427000 -- (-826.338) (-824.739) [-825.445] (-824.805) * [-827.166] (-828.435) (-825.042) (-827.124) -- 0:00:34
427500 -- (-826.338) [-826.467] (-827.482) (-825.492) * (-827.441) [-826.561] (-824.471) (-829.549) -- 0:00:34
428000 -- (-823.999) (-824.886) (-826.802) [-825.393] * (-826.803) (-825.503) (-827.672) [-824.952] -- 0:00:34
428500 -- (-825.921) [-824.201] (-826.732) (-828.329) * (-825.550) [-826.253] (-826.115) (-825.110) -- 0:00:34
429000 -- (-824.533) (-824.947) [-825.416] (-827.348) * (-825.721) [-826.980] (-826.307) (-824.237) -- 0:00:34
429500 -- (-824.099) [-825.487] (-824.608) (-827.191) * (-825.462) [-827.169] (-824.795) (-824.197) -- 0:00:34
430000 -- (-824.901) [-824.824] (-824.608) (-825.755) * (-827.254) (-828.550) (-824.142) [-824.246] -- 0:00:34
Average standard deviation of split frequencies: 0.008048
430500 -- (-826.160) (-824.988) (-825.636) [-826.317] * (-825.778) (-827.223) [-826.086] (-825.503) -- 0:00:34
431000 -- [-827.272] (-825.888) (-824.919) (-825.036) * (-826.958) [-826.237] (-826.198) (-825.755) -- 0:00:34
431500 -- (-826.637) (-825.032) (-824.796) [-825.683] * (-827.679) (-826.779) (-826.879) [-825.542] -- 0:00:34
432000 -- (-825.824) (-824.764) (-827.157) [-825.216] * [-826.818] (-825.301) (-826.772) (-825.900) -- 0:00:34
432500 -- (-828.124) (-824.963) (-824.600) [-827.129] * (-828.162) (-825.709) (-827.895) [-824.735] -- 0:00:34
433000 -- [-825.078] (-825.224) (-826.422) (-826.960) * (-827.302) [-825.872] (-826.166) (-825.296) -- 0:00:34
433500 -- [-824.677] (-825.225) (-827.522) (-826.254) * [-826.550] (-826.275) (-826.937) (-825.388) -- 0:00:33
434000 -- (-824.215) [-827.064] (-824.252) (-824.806) * (-825.657) [-825.330] (-825.646) (-825.625) -- 0:00:33
434500 -- (-824.148) [-825.211] (-829.322) (-824.752) * (-825.580) (-825.747) (-824.929) [-829.282] -- 0:00:33
435000 -- (-824.947) (-825.506) [-827.442] (-825.778) * (-827.024) (-825.596) (-825.134) [-833.274] -- 0:00:33
Average standard deviation of split frequencies: 0.006614
435500 -- (-827.843) [-826.393] (-827.288) (-824.555) * (-825.239) [-824.961] (-825.331) (-827.171) -- 0:00:33
436000 -- (-827.212) [-826.082] (-830.865) (-824.259) * [-825.412] (-824.614) (-827.521) (-826.884) -- 0:00:33
436500 -- (-829.125) [-826.095] (-827.143) (-824.442) * (-824.851) [-823.783] (-825.666) (-824.286) -- 0:00:33
437000 -- (-826.148) (-831.646) (-829.502) [-828.885] * (-825.183) [-825.262] (-825.219) (-826.558) -- 0:00:33
437500 -- (-825.968) (-826.596) (-826.348) [-825.802] * (-827.884) (-829.143) [-825.086] (-825.109) -- 0:00:33
438000 -- (-829.171) (-824.404) (-826.753) [-826.623] * [-827.100] (-828.300) (-824.719) (-824.786) -- 0:00:33
438500 -- (-824.780) (-825.169) (-830.014) [-825.739] * (-828.705) (-824.092) [-825.654] (-825.237) -- 0:00:34
439000 -- [-825.014] (-824.978) (-829.371) (-827.332) * [-824.576] (-824.723) (-827.368) (-825.792) -- 0:00:34
439500 -- (-830.056) (-826.806) (-827.278) [-831.027] * [-826.081] (-825.071) (-825.167) (-825.290) -- 0:00:34
440000 -- [-828.333] (-829.291) (-824.850) (-824.719) * (-829.274) (-825.851) [-826.862] (-826.374) -- 0:00:34
Average standard deviation of split frequencies: 0.007237
440500 -- [-827.839] (-827.710) (-825.094) (-825.392) * (-826.312) (-824.647) (-825.627) [-828.432] -- 0:00:34
441000 -- (-827.844) (-825.585) [-824.816] (-826.372) * (-827.372) (-824.554) (-825.036) [-825.743] -- 0:00:34
441500 -- (-827.612) [-825.285] (-826.319) (-824.508) * (-824.900) (-827.496) [-825.491] (-828.071) -- 0:00:34
442000 -- (-825.553) [-826.332] (-827.751) (-826.425) * [-826.291] (-828.502) (-826.705) (-828.331) -- 0:00:34
442500 -- [-827.605] (-824.775) (-825.036) (-825.583) * (-826.814) [-828.121] (-829.791) (-828.704) -- 0:00:34
443000 -- [-826.777] (-824.628) (-824.818) (-826.361) * (-824.743) (-827.648) (-828.354) [-826.086] -- 0:00:33
443500 -- (-826.060) [-826.426] (-827.890) (-826.239) * (-824.574) (-826.606) (-825.161) [-830.135] -- 0:00:33
444000 -- (-827.172) (-826.426) (-824.298) [-831.051] * (-825.169) [-826.002] (-824.551) (-827.815) -- 0:00:33
444500 -- (-825.794) [-825.037] (-827.872) (-825.405) * [-824.564] (-828.404) (-825.207) (-827.737) -- 0:00:33
445000 -- (-826.594) (-828.393) (-825.052) [-825.013] * (-824.685) (-827.633) [-826.809] (-827.044) -- 0:00:33
Average standard deviation of split frequencies: 0.007692
445500 -- (-826.913) (-828.450) (-823.753) [-824.161] * (-825.989) (-827.302) [-826.186] (-826.744) -- 0:00:33
446000 -- (-825.495) (-833.049) (-825.796) [-825.505] * (-826.789) (-827.210) [-824.679] (-825.834) -- 0:00:33
446500 -- (-825.371) (-826.629) (-825.833) [-826.493] * (-827.241) [-824.383] (-828.114) (-826.072) -- 0:00:33
447000 -- (-825.703) [-826.183] (-825.035) (-826.021) * [-827.666] (-824.778) (-825.255) (-825.430) -- 0:00:33
447500 -- (-824.964) [-828.874] (-829.332) (-826.961) * (-825.693) [-825.577] (-825.269) (-828.543) -- 0:00:33
448000 -- (-825.413) [-823.929] (-824.836) (-827.183) * (-828.547) [-825.925] (-825.174) (-824.786) -- 0:00:33
448500 -- (-824.650) [-825.100] (-827.331) (-827.422) * (-824.401) (-826.479) (-825.370) [-826.220] -- 0:00:33
449000 -- (-827.531) (-825.504) [-826.026] (-826.102) * (-826.457) (-830.621) (-830.751) [-825.844] -- 0:00:33
449500 -- (-826.148) (-828.279) (-825.222) [-825.089] * (-826.216) [-828.187] (-830.236) (-825.886) -- 0:00:33
450000 -- [-824.290] (-827.436) (-824.890) (-824.789) * (-826.086) [-826.930] (-829.990) (-825.585) -- 0:00:33
Average standard deviation of split frequencies: 0.007876
450500 -- (-826.889) (-825.139) (-828.842) [-827.469] * (-831.065) (-827.273) [-828.447] (-826.493) -- 0:00:32
451000 -- [-826.614] (-825.703) (-828.938) (-826.578) * (-827.956) (-826.769) (-825.668) [-830.467] -- 0:00:32
451500 -- [-825.721] (-826.800) (-826.548) (-826.153) * (-827.238) [-825.535] (-830.789) (-829.677) -- 0:00:32
452000 -- (-826.405) [-827.075] (-824.718) (-825.686) * [-827.220] (-827.917) (-832.006) (-827.371) -- 0:00:32
452500 -- (-824.960) (-828.172) [-825.496] (-824.505) * [-827.491] (-825.298) (-828.019) (-827.663) -- 0:00:32
453000 -- (-825.724) (-825.630) [-825.346] (-824.947) * (-827.912) (-826.045) (-825.429) [-827.972] -- 0:00:32
453500 -- (-827.549) (-827.057) (-828.896) [-826.092] * [-825.392] (-824.768) (-826.163) (-825.536) -- 0:00:32
454000 -- (-824.719) (-829.032) (-825.805) [-825.194] * [-827.790] (-824.135) (-824.739) (-826.036) -- 0:00:32
454500 -- (-826.014) (-824.705) (-826.510) [-826.548] * [-825.068] (-825.041) (-828.421) (-826.935) -- 0:00:32
455000 -- (-824.455) (-825.123) (-829.567) [-824.856] * (-825.564) [-826.538] (-825.155) (-826.163) -- 0:00:32
Average standard deviation of split frequencies: 0.008500
455500 -- (-828.568) (-827.243) (-827.353) [-824.961] * (-825.410) [-825.207] (-829.324) (-826.182) -- 0:00:33
456000 -- (-827.965) (-824.802) (-824.876) [-824.628] * (-824.900) (-825.441) (-827.088) [-827.212] -- 0:00:33
456500 -- (-827.646) (-824.653) (-829.004) [-824.650] * (-827.092) (-826.753) (-824.560) [-824.139] -- 0:00:33
457000 -- (-825.806) (-827.945) (-825.191) [-824.413] * (-826.015) [-825.483] (-827.612) (-824.422) -- 0:00:33
457500 -- (-825.763) (-826.064) (-826.692) [-828.290] * (-828.452) [-826.058] (-826.757) (-825.791) -- 0:00:33
458000 -- (-825.912) (-824.991) [-824.763] (-825.263) * (-824.862) (-828.868) (-825.543) [-827.497] -- 0:00:33
458500 -- (-832.139) [-826.341] (-825.483) (-828.410) * (-827.426) (-828.527) (-828.693) [-827.232] -- 0:00:33
459000 -- (-829.448) [-827.388] (-825.564) (-827.196) * (-826.953) (-824.591) (-827.295) [-828.804] -- 0:00:33
459500 -- (-826.971) (-825.079) [-825.920] (-826.790) * (-828.363) [-824.701] (-828.651) (-832.582) -- 0:00:32
460000 -- (-826.348) (-829.928) [-827.349] (-825.554) * (-825.388) [-826.793] (-826.722) (-824.950) -- 0:00:32
Average standard deviation of split frequencies: 0.008307
460500 -- (-828.583) [-828.301] (-828.804) (-828.215) * (-825.133) [-825.556] (-826.834) (-827.402) -- 0:00:32
461000 -- (-826.144) (-826.723) [-825.912] (-830.927) * (-826.998) [-825.931] (-825.566) (-832.583) -- 0:00:32
461500 -- (-825.724) (-827.074) [-825.376] (-827.267) * (-825.124) (-826.600) (-825.314) [-826.162] -- 0:00:32
462000 -- (-826.275) (-825.863) [-828.189] (-826.218) * (-827.296) (-827.792) [-825.947] (-825.947) -- 0:00:32
462500 -- (-827.371) (-825.987) (-825.985) [-825.757] * [-826.082] (-828.207) (-825.244) (-829.363) -- 0:00:32
463000 -- (-829.946) [-825.294] (-825.388) (-827.288) * (-830.607) (-826.516) [-826.033] (-826.666) -- 0:00:32
463500 -- [-827.132] (-827.085) (-824.172) (-826.687) * (-825.179) (-826.022) [-826.191] (-826.382) -- 0:00:32
464000 -- (-825.189) (-825.747) (-825.161) [-824.639] * (-825.519) (-825.286) [-826.631] (-824.846) -- 0:00:32
464500 -- (-825.549) [-825.308] (-824.078) (-826.547) * (-826.130) (-824.657) (-828.620) [-825.556] -- 0:00:32
465000 -- (-826.799) [-828.828] (-824.674) (-830.494) * (-826.856) (-826.195) [-828.155] (-824.119) -- 0:00:32
Average standard deviation of split frequencies: 0.008271
465500 -- (-825.550) (-828.233) [-825.053] (-825.453) * (-825.360) [-829.938] (-827.608) (-824.113) -- 0:00:32
466000 -- (-824.303) (-825.239) [-824.089] (-824.939) * (-827.767) (-827.494) (-828.607) [-826.758] -- 0:00:32
466500 -- (-826.239) (-826.239) [-827.781] (-825.852) * (-825.884) [-825.460] (-827.205) (-828.729) -- 0:00:32
467000 -- (-825.741) [-826.496] (-826.482) (-825.393) * (-824.437) [-828.153] (-831.277) (-826.662) -- 0:00:31
467500 -- [-825.275] (-825.071) (-826.847) (-826.247) * (-824.785) [-826.180] (-827.685) (-825.736) -- 0:00:31
468000 -- (-827.774) (-825.827) [-826.980] (-824.946) * (-824.667) (-830.111) (-829.486) [-827.070] -- 0:00:31
468500 -- (-827.326) (-829.071) (-826.654) [-827.829] * [-827.444] (-830.268) (-827.982) (-824.460) -- 0:00:31
469000 -- (-826.559) (-824.588) [-825.650] (-827.699) * [-824.638] (-828.550) (-826.819) (-825.355) -- 0:00:31
469500 -- (-827.457) [-829.443] (-829.305) (-825.746) * (-829.464) (-828.647) (-824.319) [-826.476] -- 0:00:31
470000 -- (-826.214) (-830.421) [-827.035] (-828.373) * (-828.029) (-830.086) (-827.202) [-829.462] -- 0:00:31
Average standard deviation of split frequencies: 0.008847
470500 -- (-827.468) [-828.037] (-825.519) (-825.559) * (-824.765) (-826.732) (-831.173) [-827.669] -- 0:00:31
471000 -- [-825.626] (-828.601) (-825.799) (-824.050) * (-826.240) [-825.636] (-833.570) (-825.816) -- 0:00:31
471500 -- (-827.667) [-826.213] (-827.862) (-826.737) * [-823.876] (-828.691) (-826.377) (-827.197) -- 0:00:31
472000 -- (-826.987) (-826.775) (-831.117) [-824.444] * (-826.691) [-826.656] (-824.237) (-827.325) -- 0:00:32
472500 -- [-826.196] (-829.222) (-827.874) (-827.330) * (-826.678) (-826.910) (-827.506) [-824.990] -- 0:00:32
473000 -- [-825.904] (-827.009) (-824.244) (-826.156) * (-824.700) [-824.354] (-825.734) (-826.871) -- 0:00:32
473500 -- (-826.945) (-826.794) [-826.132] (-825.358) * (-824.515) (-825.552) (-829.043) [-825.612] -- 0:00:32
474000 -- (-825.393) [-824.742] (-824.793) (-826.694) * [-825.157] (-827.061) (-825.590) (-824.772) -- 0:00:32
474500 -- (-826.750) (-824.377) (-826.448) [-826.501] * (-827.921) [-827.144] (-828.231) (-824.496) -- 0:00:32
475000 -- (-825.337) (-827.943) (-824.951) [-824.884] * (-826.684) [-825.451] (-824.226) (-824.461) -- 0:00:32
Average standard deviation of split frequencies: 0.008583
475500 -- (-825.555) [-826.441] (-826.735) (-826.313) * (-825.613) (-827.477) (-824.623) [-824.806] -- 0:00:31
476000 -- [-828.873] (-825.560) (-826.374) (-828.610) * [-825.982] (-825.428) (-825.315) (-825.273) -- 0:00:31
476500 -- (-826.603) [-827.388] (-827.029) (-827.045) * [-827.136] (-828.227) (-825.119) (-826.898) -- 0:00:31
477000 -- (-828.343) (-831.195) [-826.440] (-827.353) * [-829.375] (-830.625) (-826.709) (-826.207) -- 0:00:31
477500 -- (-832.788) (-826.772) [-826.105] (-825.273) * (-831.035) (-835.535) (-828.677) [-825.710] -- 0:00:31
478000 -- (-828.537) [-826.926] (-826.382) (-824.300) * (-829.522) (-827.967) [-824.733] (-825.396) -- 0:00:31
478500 -- (-827.056) (-825.659) (-825.703) [-824.711] * (-829.505) [-826.440] (-828.908) (-825.442) -- 0:00:31
479000 -- (-828.099) (-828.545) [-825.585] (-825.485) * [-828.286] (-830.111) (-824.731) (-826.205) -- 0:00:31
479500 -- (-829.221) (-824.923) [-825.174] (-824.864) * (-826.272) (-825.565) [-825.238] (-827.494) -- 0:00:31
480000 -- (-826.777) (-828.624) (-824.880) [-824.337] * (-826.084) [-826.603] (-825.920) (-828.177) -- 0:00:31
Average standard deviation of split frequencies: 0.007846
480500 -- (-825.822) (-826.148) (-828.989) [-823.935] * (-825.680) (-829.124) [-825.708] (-825.871) -- 0:00:31
481000 -- [-830.209] (-827.219) (-826.520) (-825.815) * (-829.793) (-825.816) (-826.202) [-827.015] -- 0:00:31
481500 -- (-826.517) (-825.369) (-827.776) [-827.771] * (-829.372) [-825.765] (-825.444) (-825.176) -- 0:00:31
482000 -- (-828.606) (-827.734) (-824.159) [-828.823] * [-825.741] (-825.976) (-832.400) (-828.005) -- 0:00:31
482500 -- (-825.695) (-828.540) (-825.785) [-825.519] * (-823.786) [-826.730] (-826.630) (-826.710) -- 0:00:31
483000 -- [-825.492] (-829.810) (-825.230) (-825.439) * (-828.190) [-830.844] (-825.400) (-826.578) -- 0:00:31
483500 -- (-826.581) [-825.315] (-826.945) (-828.647) * (-826.451) [-824.832] (-826.462) (-826.589) -- 0:00:30
484000 -- (-825.588) (-824.213) (-825.581) [-828.472] * (-824.740) [-826.197] (-826.294) (-827.864) -- 0:00:30
484500 -- [-824.206] (-824.943) (-826.075) (-824.373) * (-824.840) [-825.833] (-825.600) (-825.400) -- 0:00:30
485000 -- [-825.962] (-827.287) (-828.038) (-826.237) * (-826.491) [-827.560] (-826.780) (-827.576) -- 0:00:30
Average standard deviation of split frequencies: 0.008568
485500 -- (-824.512) (-825.105) [-825.503] (-827.691) * [-825.239] (-825.360) (-825.494) (-825.999) -- 0:00:30
486000 -- (-826.121) [-824.965] (-825.579) (-824.195) * (-828.325) (-827.244) (-826.384) [-828.429] -- 0:00:30
486500 -- [-826.470] (-827.527) (-829.285) (-828.063) * (-829.002) (-825.241) (-825.966) [-826.943] -- 0:00:30
487000 -- [-827.895] (-828.299) (-827.067) (-825.250) * (-824.698) [-825.689] (-828.071) (-828.329) -- 0:00:30
487500 -- (-828.767) [-826.073] (-826.829) (-824.927) * (-830.488) (-825.859) (-826.093) [-824.304] -- 0:00:30
488000 -- (-825.390) (-826.440) (-824.250) [-824.499] * (-827.687) [-825.138] (-825.113) (-826.556) -- 0:00:30
488500 -- (-825.273) (-825.063) (-824.502) [-827.218] * (-829.543) (-825.171) (-827.438) [-826.944] -- 0:00:31
489000 -- [-824.299] (-826.623) (-828.770) (-824.688) * (-827.969) (-825.679) (-825.649) [-832.381] -- 0:00:31
489500 -- [-829.101] (-825.422) (-825.954) (-826.809) * (-825.750) (-825.328) [-825.282] (-828.346) -- 0:00:31
490000 -- (-826.661) [-825.748] (-825.905) (-827.292) * (-826.578) (-824.623) (-829.983) [-824.438] -- 0:00:31
Average standard deviation of split frequencies: 0.008251
490500 -- (-827.026) [-826.199] (-828.687) (-827.327) * (-826.657) (-826.373) (-826.410) [-824.120] -- 0:00:31
491000 -- (-833.352) (-827.546) (-823.956) [-824.939] * [-825.309] (-824.371) (-824.466) (-825.824) -- 0:00:31
491500 -- [-827.101] (-828.778) (-828.191) (-825.400) * [-826.892] (-829.259) (-828.768) (-828.056) -- 0:00:31
492000 -- (-825.836) (-830.099) [-828.183] (-827.660) * (-825.034) (-825.923) (-826.042) [-828.799] -- 0:00:30
492500 -- (-825.743) (-827.206) (-828.426) [-830.722] * [-824.798] (-831.225) (-825.977) (-826.709) -- 0:00:30
493000 -- (-824.984) (-825.811) [-826.153] (-833.804) * (-826.950) [-825.394] (-827.178) (-824.719) -- 0:00:30
493500 -- (-826.269) (-824.643) [-825.382] (-829.860) * (-828.916) [-825.200] (-828.562) (-830.029) -- 0:00:30
494000 -- (-825.965) [-823.903] (-827.631) (-825.522) * (-829.648) (-824.870) (-827.527) [-825.921] -- 0:00:30
494500 -- (-827.858) (-824.057) (-828.115) [-824.988] * [-825.636] (-824.404) (-828.297) (-826.565) -- 0:00:30
495000 -- [-827.367] (-827.232) (-827.188) (-825.866) * [-824.711] (-827.592) (-830.724) (-827.267) -- 0:00:30
Average standard deviation of split frequencies: 0.008218
495500 -- (-832.295) [-825.042] (-827.362) (-825.129) * (-825.671) (-826.234) (-826.403) [-828.285] -- 0:00:30
496000 -- (-825.744) (-826.652) [-826.481] (-825.232) * (-827.044) (-826.921) (-825.620) [-828.183] -- 0:00:30
496500 -- [-826.811] (-828.994) (-825.962) (-826.582) * (-825.901) [-828.705] (-824.726) (-827.036) -- 0:00:30
497000 -- (-830.499) (-826.014) [-823.916] (-826.644) * (-830.836) (-826.520) (-824.301) [-825.418] -- 0:00:30
497500 -- (-826.769) [-824.939] (-824.671) (-827.410) * [-827.720] (-826.192) (-824.431) (-826.732) -- 0:00:30
498000 -- (-826.811) (-828.048) [-825.564] (-826.675) * (-827.600) [-824.672] (-827.705) (-825.825) -- 0:00:30
498500 -- (-830.503) [-824.544] (-830.929) (-823.932) * (-824.979) (-824.231) (-826.332) [-824.860] -- 0:00:30
499000 -- (-830.848) [-828.432] (-825.319) (-823.932) * (-828.094) (-827.210) [-825.765] (-827.426) -- 0:00:30
499500 -- [-827.077] (-826.118) (-825.395) (-825.712) * (-830.159) (-826.843) [-825.212] (-828.509) -- 0:00:30
500000 -- (-825.516) (-826.659) (-826.885) [-824.795] * (-829.384) (-828.339) [-825.543] (-833.185) -- 0:00:30
Average standard deviation of split frequencies: 0.007976
500500 -- [-826.311] (-826.773) (-826.508) (-829.733) * [-826.826] (-828.009) (-828.786) (-828.502) -- 0:00:29
501000 -- (-825.492) (-825.365) [-827.089] (-825.024) * (-825.043) [-829.234] (-829.933) (-827.087) -- 0:00:29
501500 -- (-826.220) (-829.239) [-827.331] (-825.024) * (-828.968) (-826.082) (-827.053) [-827.304] -- 0:00:29
502000 -- (-830.171) (-828.236) [-829.030] (-825.826) * (-824.107) (-826.574) (-825.780) [-826.520] -- 0:00:29
502500 -- (-825.814) (-827.516) (-828.302) [-825.279] * (-825.148) (-824.630) [-826.051] (-829.697) -- 0:00:29
503000 -- (-829.638) [-827.755] (-825.593) (-831.326) * (-824.435) (-827.707) (-826.903) [-829.087] -- 0:00:29
503500 -- (-827.157) [-828.536] (-825.663) (-830.887) * (-827.763) (-825.423) (-827.025) [-826.760] -- 0:00:29
504000 -- (-825.696) (-825.943) [-825.462] (-825.644) * (-826.816) (-825.423) [-825.636] (-824.344) -- 0:00:29
504500 -- [-825.492] (-828.869) (-825.918) (-825.324) * [-825.483] (-828.713) (-831.409) (-825.735) -- 0:00:29
505000 -- (-826.056) [-827.523] (-824.708) (-824.022) * (-826.543) [-828.989] (-825.660) (-827.304) -- 0:00:30
Average standard deviation of split frequencies: 0.007946
505500 -- (-828.358) [-826.593] (-826.451) (-825.212) * [-824.697] (-830.120) (-827.284) (-824.753) -- 0:00:30
506000 -- (-827.723) (-825.316) [-827.149] (-826.812) * (-824.231) (-824.125) (-826.258) [-825.021] -- 0:00:30
506500 -- (-830.020) [-824.128] (-828.958) (-828.328) * (-824.501) (-824.834) (-827.933) [-826.515] -- 0:00:30
507000 -- (-826.640) (-824.376) [-825.117] (-830.784) * (-824.938) (-825.270) (-827.031) [-830.979] -- 0:00:30
507500 -- (-827.227) (-825.570) [-827.616] (-828.705) * (-826.148) (-824.142) [-827.461] (-826.022) -- 0:00:30
508000 -- (-827.239) (-824.425) (-828.175) [-826.386] * (-824.873) (-824.195) [-826.229] (-824.796) -- 0:00:30
508500 -- [-826.391] (-825.189) (-836.756) (-825.965) * (-824.354) (-824.674) [-828.319] (-825.644) -- 0:00:29
509000 -- (-827.526) (-824.708) [-825.378] (-824.931) * (-826.812) (-824.197) (-825.401) [-826.099] -- 0:00:29
509500 -- (-826.271) (-826.901) [-826.842] (-825.454) * [-825.186] (-825.215) (-828.020) (-824.893) -- 0:00:29
510000 -- (-825.827) (-829.139) (-827.061) [-824.542] * [-825.372] (-825.774) (-826.941) (-825.617) -- 0:00:29
Average standard deviation of split frequencies: 0.008254
510500 -- (-830.720) (-826.391) [-825.987] (-824.915) * [-827.131] (-825.700) (-824.946) (-825.305) -- 0:00:29
511000 -- [-826.853] (-824.975) (-824.459) (-830.648) * (-825.387) (-824.293) (-827.335) [-824.350] -- 0:00:29
511500 -- (-824.207) (-827.217) (-826.080) [-828.186] * (-825.277) (-824.903) [-825.487] (-824.193) -- 0:00:29
512000 -- [-824.062] (-826.126) (-834.706) (-828.864) * (-825.168) (-825.575) [-826.445] (-826.456) -- 0:00:29
512500 -- (-825.909) (-826.639) [-825.354] (-831.267) * [-825.677] (-829.106) (-826.095) (-829.648) -- 0:00:29
513000 -- (-827.581) (-824.754) (-825.898) [-825.810] * (-824.587) (-829.200) (-824.109) [-825.687] -- 0:00:29
513500 -- [-828.228] (-825.294) (-828.845) (-827.360) * (-825.281) (-830.935) [-825.489] (-827.567) -- 0:00:29
514000 -- (-825.131) (-826.474) (-825.349) [-827.186] * (-825.179) (-824.449) [-825.018] (-828.634) -- 0:00:29
514500 -- (-824.173) (-828.345) (-824.859) [-827.419] * (-825.495) (-824.973) (-824.778) [-825.806] -- 0:00:29
515000 -- (-827.430) (-824.222) (-828.729) [-828.914] * (-825.403) (-825.041) [-826.919] (-825.853) -- 0:00:29
Average standard deviation of split frequencies: 0.008706
515500 -- (-828.068) (-828.374) [-825.515] (-827.094) * [-825.049] (-826.240) (-826.765) (-824.723) -- 0:00:29
516000 -- (-827.782) (-827.653) (-828.269) [-829.526] * (-828.989) [-826.583] (-828.786) (-825.980) -- 0:00:29
516500 -- [-828.304] (-826.461) (-824.794) (-825.839) * [-828.243] (-827.362) (-827.910) (-827.498) -- 0:00:29
517000 -- [-825.147] (-826.538) (-826.096) (-825.450) * (-828.895) [-826.039] (-832.204) (-825.752) -- 0:00:28
517500 -- [-825.274] (-827.867) (-826.185) (-826.446) * (-829.765) [-824.581] (-827.552) (-825.735) -- 0:00:28
518000 -- [-827.846] (-827.733) (-827.425) (-826.656) * (-827.187) (-826.106) (-827.519) [-824.529] -- 0:00:28
518500 -- (-827.188) (-826.591) [-825.728] (-824.391) * [-824.582] (-824.871) (-830.175) (-824.354) -- 0:00:28
519000 -- (-826.612) (-826.327) [-826.762] (-828.166) * (-827.821) [-823.877] (-829.859) (-827.132) -- 0:00:28
519500 -- (-829.003) [-824.984] (-824.353) (-826.840) * (-826.504) (-826.112) (-828.866) [-826.241] -- 0:00:28
520000 -- [-824.660] (-827.885) (-824.340) (-824.129) * (-826.596) (-826.620) [-827.695] (-825.600) -- 0:00:29
Average standard deviation of split frequencies: 0.008681
520500 -- (-824.502) (-825.180) (-826.737) [-826.126] * (-824.602) (-826.472) (-824.020) [-826.904] -- 0:00:29
521000 -- (-825.434) (-826.157) (-825.339) [-824.891] * (-830.790) (-826.433) [-826.708] (-825.275) -- 0:00:29
521500 -- (-824.408) (-831.285) (-826.281) [-825.825] * (-825.147) [-824.950] (-825.113) (-826.889) -- 0:00:29
522000 -- (-828.461) (-831.399) [-829.700] (-825.935) * [-824.428] (-833.688) (-825.280) (-823.930) -- 0:00:29
522500 -- (-824.748) (-824.237) (-827.218) [-826.960] * [-824.336] (-828.652) (-829.181) (-825.512) -- 0:00:29
523000 -- (-827.761) (-829.503) [-827.503] (-826.581) * (-827.451) (-824.479) (-825.895) [-827.048] -- 0:00:29
523500 -- (-825.971) (-827.456) [-826.907] (-828.657) * [-827.827] (-828.184) (-827.238) (-827.843) -- 0:00:29
524000 -- (-825.554) (-825.676) [-826.691] (-828.418) * (-826.357) (-825.029) (-826.046) [-829.634] -- 0:00:29
524500 -- [-824.145] (-826.625) (-825.364) (-827.487) * [-824.659] (-828.459) (-825.311) (-826.205) -- 0:00:29
525000 -- (-826.424) (-826.124) (-825.797) [-825.239] * (-825.653) [-827.716] (-826.779) (-829.672) -- 0:00:28
Average standard deviation of split frequencies: 0.008804
525500 -- (-828.265) [-829.368] (-825.221) (-826.299) * (-825.405) [-825.156] (-824.708) (-826.423) -- 0:00:28
526000 -- [-826.022] (-828.437) (-825.425) (-825.779) * (-826.146) (-830.672) [-827.246] (-825.444) -- 0:00:28
526500 -- (-826.871) (-825.295) [-826.327] (-825.148) * (-825.060) (-830.569) [-828.310] (-824.789) -- 0:00:28
527000 -- (-829.413) (-825.644) (-824.593) [-825.118] * (-825.069) (-824.638) [-825.868] (-827.683) -- 0:00:28
527500 -- (-828.026) (-824.339) [-824.709] (-825.511) * (-824.249) (-826.389) [-825.272] (-829.758) -- 0:00:28
528000 -- (-828.235) (-826.824) (-825.606) [-825.431] * (-824.841) (-825.923) (-826.197) [-824.987] -- 0:00:28
528500 -- (-827.543) (-827.707) (-825.034) [-826.564] * (-832.791) (-825.042) (-825.913) [-826.532] -- 0:00:28
529000 -- [-826.575] (-832.720) (-826.553) (-832.128) * [-826.857] (-825.278) (-826.269) (-827.436) -- 0:00:28
529500 -- (-825.565) (-825.713) [-826.496] (-824.988) * (-826.546) (-825.820) [-826.019] (-828.026) -- 0:00:28
530000 -- [-826.491] (-830.565) (-828.528) (-826.379) * [-825.641] (-826.135) (-825.474) (-827.782) -- 0:00:28
Average standard deviation of split frequencies: 0.008094
530500 -- [-829.885] (-827.358) (-824.715) (-827.503) * [-825.938] (-828.710) (-828.249) (-826.528) -- 0:00:28
531000 -- [-827.060] (-826.037) (-825.143) (-826.236) * (-827.574) (-827.562) [-827.197] (-825.891) -- 0:00:28
531500 -- (-829.664) (-824.305) (-825.453) [-830.712] * (-824.773) [-825.837] (-826.968) (-829.792) -- 0:00:28
532000 -- [-826.369] (-827.181) (-826.635) (-828.565) * (-828.302) [-825.204] (-827.203) (-827.343) -- 0:00:28
532500 -- (-825.690) (-825.133) [-825.032] (-826.459) * (-829.116) (-829.554) (-825.893) [-826.896] -- 0:00:28
533000 -- (-825.149) (-824.403) (-825.720) [-824.313] * (-828.276) [-825.465] (-825.958) (-827.006) -- 0:00:28
533500 -- (-825.468) [-824.396] (-835.523) (-830.395) * [-826.063] (-827.743) (-827.508) (-829.270) -- 0:00:27
534000 -- (-826.434) [-829.415] (-826.166) (-826.446) * (-831.700) [-828.313] (-829.452) (-828.104) -- 0:00:27
534500 -- (-825.296) (-824.295) (-827.396) [-827.264] * [-828.590] (-830.989) (-827.309) (-825.197) -- 0:00:27
535000 -- (-827.082) (-824.638) [-829.390] (-825.161) * (-828.840) (-827.393) (-826.771) [-824.938] -- 0:00:27
Average standard deviation of split frequencies: 0.008588
535500 -- (-825.992) [-825.462] (-825.812) (-825.178) * (-829.517) (-826.746) (-826.224) [-827.464] -- 0:00:27
536000 -- (-825.781) (-827.597) (-827.433) [-824.433] * (-825.557) [-829.764] (-826.508) (-827.416) -- 0:00:27
536500 -- (-826.387) [-824.032] (-824.378) (-825.410) * (-826.812) (-830.562) (-827.120) [-824.884] -- 0:00:28
537000 -- [-828.511] (-824.108) (-824.721) (-824.021) * (-825.730) (-827.349) [-824.193] (-824.668) -- 0:00:28
537500 -- (-826.641) (-824.483) [-826.489] (-824.458) * (-825.410) [-825.978] (-827.789) (-826.285) -- 0:00:28
538000 -- [-825.289] (-829.625) (-829.907) (-829.819) * (-830.368) (-826.508) [-824.436] (-824.531) -- 0:00:28
538500 -- [-825.722] (-826.852) (-828.629) (-826.201) * (-827.779) [-826.749] (-828.008) (-823.993) -- 0:00:28
539000 -- (-827.418) (-826.044) (-826.254) [-827.056] * (-825.725) (-827.513) (-827.185) [-823.992] -- 0:00:28
539500 -- [-825.452] (-824.018) (-827.297) (-828.587) * (-828.506) (-832.191) [-826.867] (-824.192) -- 0:00:28
540000 -- (-830.262) (-828.326) (-824.481) [-827.110] * (-825.368) (-830.274) (-825.488) [-824.633] -- 0:00:28
Average standard deviation of split frequencies: 0.008257
540500 -- [-826.966] (-824.926) (-828.881) (-827.247) * (-826.920) (-823.948) (-826.947) [-826.806] -- 0:00:28
541000 -- [-828.530] (-824.273) (-828.186) (-827.942) * (-826.037) [-824.193] (-829.847) (-831.478) -- 0:00:27
541500 -- [-827.315] (-825.264) (-830.161) (-831.028) * (-826.246) [-828.878] (-826.329) (-828.531) -- 0:00:27
542000 -- (-828.803) (-826.176) (-828.223) [-825.238] * (-827.055) (-825.584) (-826.387) [-824.844] -- 0:00:27
542500 -- (-825.997) [-826.192] (-827.566) (-824.047) * [-824.214] (-825.891) (-825.378) (-826.952) -- 0:00:27
543000 -- (-826.394) [-826.591] (-826.546) (-828.515) * (-824.432) (-828.025) (-828.655) [-826.605] -- 0:00:27
543500 -- (-824.546) (-827.034) [-825.541] (-825.913) * [-826.923] (-824.170) (-827.916) (-825.084) -- 0:00:27
544000 -- [-825.233] (-830.260) (-828.776) (-827.619) * (-827.934) (-824.001) (-828.435) [-826.824] -- 0:00:27
544500 -- (-826.728) (-831.992) (-827.562) [-827.023] * (-824.588) (-827.094) [-827.514] (-825.301) -- 0:00:27
545000 -- (-825.761) (-827.604) (-825.957) [-825.100] * (-828.963) (-824.600) (-826.235) [-826.080] -- 0:00:27
Average standard deviation of split frequencies: 0.007770
545500 -- (-824.361) [-828.246] (-824.724) (-824.896) * (-826.886) (-825.550) (-830.996) [-826.061] -- 0:00:27
546000 -- [-824.050] (-826.511) (-824.578) (-825.000) * (-825.998) (-830.305) (-826.929) [-830.472] -- 0:00:27
546500 -- (-824.569) (-824.560) [-824.468] (-830.265) * (-825.363) (-826.477) [-826.415] (-832.237) -- 0:00:27
547000 -- [-824.328] (-824.341) (-825.694) (-831.392) * (-828.882) (-826.960) (-824.949) [-825.934] -- 0:00:27
547500 -- [-825.645] (-824.578) (-825.427) (-825.602) * [-825.435] (-826.880) (-825.376) (-827.192) -- 0:00:27
548000 -- (-829.674) (-826.281) [-825.400] (-826.079) * [-825.863] (-827.731) (-824.001) (-825.093) -- 0:00:27
548500 -- (-830.423) [-826.041] (-824.335) (-826.015) * (-826.335) (-825.517) (-824.225) [-826.933] -- 0:00:27
549000 -- (-827.878) (-828.456) (-825.146) [-827.209] * (-825.134) (-825.893) [-825.188] (-827.646) -- 0:00:27
549500 -- (-825.038) (-826.582) [-825.889] (-830.989) * (-827.306) (-828.920) (-828.656) [-827.760] -- 0:00:27
550000 -- (-825.456) (-827.318) [-824.681] (-828.759) * [-828.667] (-829.242) (-827.846) (-824.996) -- 0:00:27
Average standard deviation of split frequencies: 0.007514
550500 -- (-825.887) [-828.209] (-824.496) (-832.106) * (-824.999) (-829.337) (-826.765) [-825.436] -- 0:00:26
551000 -- [-827.559] (-825.799) (-824.676) (-827.457) * (-827.188) [-826.406] (-828.388) (-827.810) -- 0:00:26
551500 -- (-828.141) (-824.853) [-826.149] (-825.746) * [-825.376] (-825.005) (-828.655) (-828.594) -- 0:00:26
552000 -- (-828.727) [-826.366] (-828.181) (-826.413) * (-824.942) (-825.348) [-824.590] (-826.006) -- 0:00:26
552500 -- (-826.522) [-827.723] (-830.815) (-825.701) * (-824.044) (-827.363) (-826.653) [-826.270] -- 0:00:26
553000 -- (-825.910) (-827.520) [-828.189] (-825.962) * [-825.868] (-829.765) (-826.941) (-826.460) -- 0:00:26
553500 -- (-825.300) (-827.909) [-826.169] (-827.655) * (-824.392) (-830.467) (-827.605) [-826.291] -- 0:00:27
554000 -- (-825.436) (-826.490) [-825.745] (-827.884) * (-826.501) (-827.438) [-827.955] (-826.029) -- 0:00:27
554500 -- (-825.553) (-829.698) (-827.226) [-824.579] * (-825.270) (-828.895) [-827.548] (-828.510) -- 0:00:27
555000 -- (-827.572) (-824.859) [-827.140] (-824.572) * (-826.349) (-824.426) (-826.063) [-829.443] -- 0:00:27
Average standard deviation of split frequencies: 0.008243
555500 -- (-828.046) [-824.967] (-825.618) (-826.225) * (-832.687) (-823.950) [-824.899] (-826.629) -- 0:00:27
556000 -- (-830.601) (-827.696) [-826.443] (-826.254) * (-826.321) (-825.193) [-826.654] (-825.963) -- 0:00:27
556500 -- [-827.804] (-826.119) (-837.439) (-827.218) * (-825.061) (-825.161) [-824.569] (-827.044) -- 0:00:27
557000 -- (-832.090) [-826.573] (-828.585) (-825.011) * (-826.920) (-827.147) (-826.558) [-826.640] -- 0:00:27
557500 -- (-824.224) [-826.648] (-826.378) (-827.900) * (-827.141) (-825.385) (-824.470) [-829.070] -- 0:00:26
558000 -- [-825.863] (-825.092) (-828.813) (-827.974) * (-824.958) (-826.694) (-829.210) [-825.174] -- 0:00:26
558500 -- [-825.257] (-824.529) (-827.439) (-828.774) * [-825.730] (-826.736) (-825.853) (-824.826) -- 0:00:26
559000 -- [-824.562] (-827.375) (-824.405) (-828.070) * [-829.936] (-825.196) (-824.434) (-823.868) -- 0:00:26
559500 -- (-826.611) [-826.330] (-825.448) (-826.982) * (-828.066) (-825.152) [-825.126] (-826.767) -- 0:00:26
560000 -- (-824.883) (-826.329) [-825.639] (-826.833) * (-825.334) [-825.153] (-824.980) (-825.557) -- 0:00:26
Average standard deviation of split frequencies: 0.008062
560500 -- (-826.092) [-827.510] (-828.735) (-827.071) * (-825.370) (-829.139) [-827.579] (-825.081) -- 0:00:26
561000 -- [-824.133] (-834.703) (-826.526) (-825.852) * (-832.261) (-824.593) (-827.652) [-824.077] -- 0:00:26
561500 -- [-825.556] (-827.550) (-825.564) (-826.442) * (-829.809) (-832.920) [-824.311] (-828.233) -- 0:00:26
562000 -- (-825.489) (-831.176) (-831.415) [-826.362] * (-825.954) (-828.022) [-825.425] (-829.008) -- 0:00:26
562500 -- (-830.647) (-824.868) [-827.047] (-824.674) * [-825.930] (-829.192) (-825.164) (-825.063) -- 0:00:26
563000 -- (-825.076) (-828.207) (-824.332) [-824.359] * (-827.156) [-827.809] (-826.509) (-824.545) -- 0:00:26
563500 -- [-824.757] (-831.114) (-826.517) (-824.243) * [-824.974] (-824.486) (-827.563) (-827.998) -- 0:00:26
564000 -- (-828.539) (-832.499) [-825.706] (-824.759) * (-827.858) (-826.638) (-824.521) [-824.745] -- 0:00:26
564500 -- (-827.211) (-827.904) (-824.226) [-824.714] * (-825.008) (-825.476) [-826.359] (-824.710) -- 0:00:26
565000 -- (-824.017) [-828.423] (-825.235) (-824.928) * [-826.361] (-824.797) (-828.228) (-828.659) -- 0:00:26
Average standard deviation of split frequencies: 0.008468
565500 -- (-830.091) [-827.902] (-827.243) (-829.041) * (-828.741) (-827.181) [-827.282] (-829.251) -- 0:00:26
566000 -- (-827.134) (-826.906) [-829.007] (-826.420) * [-827.655] (-825.752) (-828.277) (-824.766) -- 0:00:26
566500 -- (-829.527) (-827.894) [-826.014] (-829.567) * [-827.619] (-824.932) (-825.930) (-826.285) -- 0:00:26
567000 -- [-827.495] (-828.966) (-827.768) (-825.639) * (-826.465) [-824.240] (-826.161) (-826.217) -- 0:00:25
567500 -- [-825.213] (-825.211) (-825.177) (-824.566) * (-826.865) (-825.433) (-828.464) [-826.314] -- 0:00:25
568000 -- [-825.068] (-825.035) (-824.399) (-825.135) * [-827.130] (-825.122) (-827.344) (-825.536) -- 0:00:25
568500 -- (-831.962) [-826.929] (-826.000) (-825.127) * (-826.088) (-825.723) (-824.736) [-824.918] -- 0:00:25
569000 -- (-826.272) (-825.244) [-824.233] (-824.856) * (-825.955) (-825.287) [-825.004] (-824.627) -- 0:00:25
569500 -- (-826.665) (-826.810) [-825.239] (-828.152) * (-828.170) (-824.848) (-825.730) [-825.887] -- 0:00:25
570000 -- [-825.248] (-828.933) (-828.641) (-827.900) * (-825.797) [-827.705] (-826.033) (-824.470) -- 0:00:26
Average standard deviation of split frequencies: 0.008720
570500 -- [-825.216] (-831.632) (-825.077) (-825.416) * [-824.258] (-829.364) (-826.975) (-825.356) -- 0:00:26
571000 -- [-827.041] (-830.426) (-824.882) (-825.177) * (-825.354) (-828.021) (-826.225) [-825.810] -- 0:00:26
571500 -- [-825.931] (-823.939) (-824.571) (-825.714) * (-824.713) [-827.087] (-825.519) (-824.507) -- 0:00:26
572000 -- (-831.168) [-826.814] (-827.385) (-825.065) * [-825.609] (-826.333) (-824.844) (-831.945) -- 0:00:26
572500 -- (-828.680) (-823.895) (-827.014) [-824.975] * (-825.927) (-830.412) [-825.621] (-827.749) -- 0:00:26
573000 -- (-828.719) (-824.981) [-827.089] (-826.433) * (-826.979) [-825.545] (-824.871) (-826.419) -- 0:00:26
573500 -- (-826.703) (-829.761) [-825.153] (-824.480) * (-825.725) (-827.345) [-825.765] (-827.823) -- 0:00:26
574000 -- (-825.066) (-831.893) [-826.095] (-824.483) * [-825.146] (-827.194) (-825.387) (-824.832) -- 0:00:25
574500 -- (-824.840) (-824.022) [-826.179] (-826.386) * (-824.653) (-824.619) [-824.397] (-826.445) -- 0:00:25
575000 -- [-826.041] (-825.629) (-826.054) (-831.075) * (-826.085) (-824.872) (-827.153) [-828.200] -- 0:00:25
Average standard deviation of split frequencies: 0.008473
575500 -- (-825.528) (-826.896) [-825.662] (-826.296) * (-825.549) (-824.657) (-829.136) [-829.472] -- 0:00:25
576000 -- (-827.596) [-826.155] (-827.139) (-825.614) * (-824.984) (-834.977) [-826.834] (-827.672) -- 0:00:25
576500 -- [-826.163] (-826.974) (-824.321) (-827.867) * (-827.466) (-828.834) (-825.730) [-826.541] -- 0:00:25
577000 -- (-831.991) [-825.671] (-826.573) (-824.406) * (-826.007) (-827.791) (-826.532) [-826.716] -- 0:00:25
577500 -- (-826.524) (-827.070) (-826.573) [-826.266] * (-826.382) (-824.628) [-826.311] (-826.306) -- 0:00:25
578000 -- (-825.853) [-824.638] (-824.799) (-826.244) * (-828.072) (-824.452) (-824.550) [-824.720] -- 0:00:25
578500 -- [-828.128] (-826.174) (-827.450) (-828.554) * (-831.009) (-824.303) [-824.894] (-829.913) -- 0:00:25
579000 -- (-824.802) [-829.957] (-827.852) (-826.353) * (-826.887) [-824.216] (-827.869) (-826.291) -- 0:00:25
579500 -- (-824.822) (-829.556) [-829.885] (-825.857) * (-825.467) (-827.665) [-826.542] (-826.999) -- 0:00:25
580000 -- [-826.016] (-827.077) (-831.459) (-825.443) * [-827.627] (-826.966) (-828.660) (-825.790) -- 0:00:25
Average standard deviation of split frequencies: 0.008739
580500 -- (-826.204) [-825.297] (-827.429) (-827.160) * (-825.049) (-826.440) (-826.651) [-825.267] -- 0:00:25
581000 -- (-827.644) (-825.582) [-826.125] (-825.096) * [-826.028] (-830.358) (-826.220) (-826.551) -- 0:00:25
581500 -- (-825.014) (-825.552) [-829.580] (-832.980) * (-825.748) [-825.488] (-826.000) (-824.677) -- 0:00:25
582000 -- (-824.826) [-828.869] (-832.155) (-824.215) * (-826.306) (-826.823) (-826.461) [-826.485] -- 0:00:25
582500 -- (-825.650) (-831.983) (-826.810) [-824.224] * [-826.145] (-824.592) (-824.254) (-826.249) -- 0:00:25
583000 -- (-824.132) [-827.462] (-825.797) (-825.821) * (-825.261) (-830.369) [-825.693] (-828.093) -- 0:00:25
583500 -- (-824.607) [-828.345] (-825.686) (-827.214) * [-825.136] (-825.676) (-824.650) (-825.409) -- 0:00:24
584000 -- (-825.965) [-825.662] (-828.465) (-825.923) * (-827.100) (-825.592) [-828.258] (-824.461) -- 0:00:24
584500 -- (-824.336) [-825.580] (-825.768) (-825.942) * (-824.649) (-825.928) [-824.921] (-830.606) -- 0:00:24
585000 -- (-827.239) (-826.372) (-826.237) [-824.004] * (-824.536) (-824.861) (-825.128) [-828.329] -- 0:00:24
Average standard deviation of split frequencies: 0.008565
585500 -- (-827.561) (-830.449) [-827.450] (-828.064) * (-826.968) [-825.113] (-826.904) (-827.094) -- 0:00:24
586000 -- [-824.793] (-825.300) (-828.269) (-824.349) * (-825.031) (-824.760) [-825.169] (-825.789) -- 0:00:24
586500 -- (-825.371) (-825.811) (-826.680) [-824.179] * (-825.544) (-824.767) [-826.875] (-827.017) -- 0:00:25
587000 -- (-830.164) (-828.115) (-827.993) [-827.104] * (-827.478) [-824.926] (-826.207) (-824.893) -- 0:00:25
587500 -- (-829.124) (-828.965) [-824.819] (-826.204) * (-828.867) (-827.889) [-825.579] (-826.732) -- 0:00:25
588000 -- (-827.671) (-826.057) [-825.039] (-825.511) * (-825.027) [-825.016] (-825.208) (-825.586) -- 0:00:25
588500 -- (-825.288) (-826.090) (-825.061) [-825.708] * (-825.264) (-828.665) [-825.662] (-825.586) -- 0:00:25
589000 -- (-828.365) [-826.798] (-826.828) (-824.665) * (-824.391) (-824.850) (-826.868) [-825.041] -- 0:00:25
589500 -- [-826.074] (-827.225) (-829.416) (-825.570) * (-823.790) [-824.324] (-826.467) (-824.319) -- 0:00:25
590000 -- [-828.667] (-824.632) (-831.443) (-827.464) * (-829.195) [-824.946] (-825.467) (-825.691) -- 0:00:25
Average standard deviation of split frequencies: 0.007746
590500 -- [-826.322] (-825.916) (-826.403) (-827.469) * [-824.938] (-825.816) (-825.450) (-824.088) -- 0:00:24
591000 -- [-827.785] (-828.012) (-828.137) (-826.643) * (-827.199) [-825.157] (-828.479) (-825.662) -- 0:00:24
591500 -- (-833.080) [-827.633] (-826.220) (-826.609) * (-829.054) [-825.321] (-826.320) (-830.114) -- 0:00:24
592000 -- [-828.647] (-824.062) (-825.954) (-825.220) * (-828.759) [-825.136] (-830.761) (-826.343) -- 0:00:24
592500 -- [-828.573] (-824.635) (-825.957) (-825.164) * (-827.476) [-824.790] (-826.848) (-825.891) -- 0:00:24
593000 -- (-826.643) (-824.501) (-826.716) [-824.561] * (-826.543) (-829.976) (-827.710) [-824.384] -- 0:00:24
593500 -- (-825.843) (-825.429) [-826.064] (-827.244) * (-824.999) (-826.315) (-827.670) [-827.209] -- 0:00:24
594000 -- (-829.273) [-824.810] (-825.711) (-824.602) * (-827.693) (-825.206) (-826.522) [-827.679] -- 0:00:24
594500 -- (-829.119) (-824.192) (-830.233) [-825.078] * [-832.730] (-826.969) (-826.700) (-827.676) -- 0:00:24
595000 -- (-826.296) (-825.532) (-827.263) [-829.107] * (-832.184) (-825.735) (-825.920) [-826.135] -- 0:00:24
Average standard deviation of split frequencies: 0.008096
595500 -- (-826.051) [-826.764] (-829.788) (-828.471) * (-824.794) (-826.773) [-827.376] (-826.800) -- 0:00:24
596000 -- (-826.232) [-828.400] (-826.815) (-826.936) * (-825.688) (-826.486) (-827.131) [-829.618] -- 0:00:24
596500 -- (-824.497) (-828.574) [-825.876] (-825.776) * [-827.469] (-827.768) (-827.347) (-828.507) -- 0:00:24
597000 -- (-825.675) (-833.160) [-824.642] (-828.571) * (-824.563) (-830.747) (-825.412) [-825.989] -- 0:00:24
597500 -- (-825.251) (-827.212) (-825.819) [-826.614] * [-830.544] (-827.412) (-825.156) (-824.032) -- 0:00:24
598000 -- (-824.608) [-825.491] (-824.853) (-826.872) * (-825.685) [-826.969] (-824.462) (-825.070) -- 0:00:24
598500 -- (-824.814) (-826.106) (-828.808) [-825.804] * (-825.109) [-826.832] (-825.892) (-824.009) -- 0:00:24
599000 -- (-825.656) (-825.288) (-826.160) [-824.092] * (-831.286) [-825.453] (-824.888) (-828.104) -- 0:00:24
599500 -- (-825.678) (-827.853) [-826.240] (-824.349) * [-830.925] (-823.865) (-824.655) (-825.991) -- 0:00:24
600000 -- [-825.285] (-825.637) (-826.251) (-828.887) * (-828.619) (-826.282) [-825.220] (-826.411) -- 0:00:24
Average standard deviation of split frequencies: 0.008217
600500 -- (-831.595) [-827.296] (-825.226) (-824.374) * (-826.255) (-825.801) [-826.362] (-825.542) -- 0:00:23
601000 -- [-826.724] (-828.664) (-824.686) (-825.521) * (-825.350) (-824.561) (-825.998) [-826.462] -- 0:00:23
601500 -- (-824.996) (-826.760) [-825.601] (-827.121) * (-830.790) (-825.385) [-828.706] (-829.023) -- 0:00:23
602000 -- [-827.138] (-828.400) (-826.845) (-826.015) * [-831.374] (-824.625) (-827.068) (-825.110) -- 0:00:23
602500 -- (-826.576) [-825.536] (-826.126) (-825.168) * (-825.908) (-824.930) [-825.036] (-825.816) -- 0:00:23
603000 -- [-825.402] (-823.943) (-826.324) (-827.868) * [-824.460] (-825.920) (-826.059) (-826.516) -- 0:00:24
603500 -- (-825.755) [-824.870] (-825.205) (-825.871) * (-829.507) [-826.903] (-826.720) (-828.055) -- 0:00:24
604000 -- (-826.622) (-824.610) (-824.900) [-826.521] * (-830.516) [-824.218] (-827.570) (-826.779) -- 0:00:24
604500 -- (-828.001) (-825.160) (-827.301) [-826.073] * [-828.251] (-827.950) (-825.413) (-826.917) -- 0:00:24
605000 -- [-828.635] (-827.661) (-830.550) (-825.718) * (-829.096) (-826.290) (-828.681) [-827.110] -- 0:00:24
Average standard deviation of split frequencies: 0.007779
605500 -- [-827.557] (-826.239) (-829.681) (-827.083) * [-826.973] (-828.512) (-828.108) (-827.335) -- 0:00:24
606000 -- (-827.921) [-828.902] (-825.462) (-826.013) * (-825.245) (-827.649) [-826.118] (-826.499) -- 0:00:24
606500 -- [-825.301] (-824.501) (-826.017) (-826.444) * (-825.097) (-828.100) (-826.738) [-826.096] -- 0:00:24
607000 -- (-828.265) [-825.296] (-824.936) (-827.126) * (-824.514) (-825.947) (-824.135) [-827.279] -- 0:00:23
607500 -- [-828.014] (-827.584) (-825.595) (-828.406) * (-825.503) (-825.662) [-824.135] (-825.009) -- 0:00:23
608000 -- (-824.923) (-825.322) [-825.197] (-824.832) * (-832.571) (-827.501) (-826.705) [-826.394] -- 0:00:23
608500 -- [-825.583] (-826.022) (-825.415) (-828.906) * (-830.461) (-828.788) (-825.969) [-826.074] -- 0:00:23
609000 -- (-827.464) (-824.877) [-826.131] (-827.475) * (-824.512) [-830.754] (-829.345) (-826.247) -- 0:00:23
609500 -- [-824.932] (-825.912) (-827.212) (-826.343) * (-826.307) [-824.880] (-828.025) (-826.017) -- 0:00:23
610000 -- (-826.169) [-825.880] (-827.263) (-827.430) * (-828.588) (-827.134) (-831.904) [-824.911] -- 0:00:23
Average standard deviation of split frequencies: 0.007629
610500 -- [-828.432] (-824.322) (-824.268) (-826.321) * (-826.595) [-826.545] (-828.380) (-828.667) -- 0:00:23
611000 -- [-828.059] (-826.991) (-825.200) (-828.503) * [-826.246] (-824.429) (-833.022) (-825.563) -- 0:00:23
611500 -- (-828.388) (-827.850) [-829.764] (-825.250) * [-825.683] (-826.226) (-828.059) (-827.977) -- 0:00:23
612000 -- [-826.849] (-829.230) (-826.810) (-824.919) * (-825.958) (-825.807) [-825.765] (-825.392) -- 0:00:23
612500 -- [-827.056] (-824.984) (-827.741) (-824.835) * (-826.797) (-826.015) (-825.484) [-825.028] -- 0:00:23
613000 -- (-825.439) (-826.340) (-827.349) [-826.244] * [-825.440] (-824.576) (-826.682) (-825.573) -- 0:00:23
613500 -- (-827.843) [-826.340] (-826.495) (-824.492) * (-824.675) (-824.538) (-824.902) [-827.125] -- 0:00:23
614000 -- (-826.307) (-830.938) [-828.177] (-824.743) * [-827.128] (-826.449) (-826.380) (-826.052) -- 0:00:23
614500 -- (-828.981) [-827.089] (-828.360) (-824.725) * (-826.950) (-824.221) (-827.405) [-825.082] -- 0:00:23
615000 -- (-829.492) [-828.116] (-829.073) (-826.356) * (-825.854) [-825.162] (-826.083) (-825.508) -- 0:00:23
Average standard deviation of split frequencies: 0.007383
615500 -- [-828.585] (-824.869) (-829.994) (-826.509) * [-824.612] (-826.788) (-826.083) (-825.412) -- 0:00:23
616000 -- [-827.883] (-825.393) (-829.799) (-824.352) * [-824.443] (-826.351) (-827.804) (-825.335) -- 0:00:23
616500 -- (-831.119) [-825.742] (-825.181) (-824.528) * (-828.010) (-829.056) (-824.286) [-824.900] -- 0:00:23
617000 -- (-827.277) (-826.001) (-826.328) [-824.358] * [-826.745] (-825.229) (-824.827) (-827.323) -- 0:00:22
617500 -- (-824.388) [-825.705] (-833.871) (-824.149) * (-828.989) (-827.665) (-827.559) [-825.740] -- 0:00:22
618000 -- (-825.159) [-827.708] (-826.896) (-825.476) * (-824.166) (-825.291) (-829.106) [-828.292] -- 0:00:22
618500 -- (-828.862) (-827.435) (-825.547) [-827.124] * [-824.734] (-827.023) (-829.207) (-828.624) -- 0:00:22
619000 -- (-827.164) (-824.525) [-828.328] (-825.395) * (-827.543) [-830.074] (-828.644) (-824.668) -- 0:00:22
619500 -- (-825.552) (-827.552) [-828.274] (-825.739) * (-828.225) (-828.834) [-826.555] (-824.674) -- 0:00:22
620000 -- (-826.338) [-825.104] (-829.518) (-824.739) * (-828.632) [-824.248] (-827.200) (-825.067) -- 0:00:23
Average standard deviation of split frequencies: 0.007643
620500 -- (-825.870) (-825.778) (-832.640) [-825.495] * (-824.235) (-831.755) [-826.594] (-831.112) -- 0:00:23
621000 -- (-825.025) (-829.657) [-829.923] (-824.948) * (-824.406) (-829.864) (-824.480) [-828.084] -- 0:00:23
621500 -- (-825.861) [-824.915] (-829.371) (-825.368) * (-828.841) (-830.901) [-825.329] (-836.524) -- 0:00:23
622000 -- (-824.681) [-826.205] (-828.152) (-826.534) * (-824.359) [-824.838] (-826.360) (-831.992) -- 0:00:23
622500 -- (-825.047) [-826.642] (-826.504) (-827.599) * [-825.884] (-826.099) (-828.019) (-833.869) -- 0:00:23
623000 -- (-825.019) (-824.260) (-824.728) [-826.042] * (-826.336) (-831.459) [-825.919] (-826.479) -- 0:00:22
623500 -- [-827.249] (-825.768) (-825.405) (-830.531) * [-826.906] (-826.308) (-827.539) (-823.761) -- 0:00:22
624000 -- [-825.791] (-825.288) (-825.160) (-828.169) * (-830.299) (-825.516) [-827.512] (-824.797) -- 0:00:22
624500 -- [-824.461] (-825.782) (-825.025) (-824.671) * (-829.667) (-824.316) (-827.281) [-824.626] -- 0:00:22
625000 -- (-831.096) (-825.291) [-825.475] (-828.881) * (-825.490) (-826.279) [-827.062] (-826.185) -- 0:00:22
Average standard deviation of split frequencies: 0.007154
625500 -- (-826.001) (-827.670) (-829.793) [-828.731] * (-827.004) (-829.713) (-831.893) [-826.304] -- 0:00:22
626000 -- (-829.045) (-825.746) [-828.889] (-826.968) * (-825.580) [-826.007] (-829.748) (-826.325) -- 0:00:22
626500 -- (-824.722) (-826.833) (-824.951) [-826.048] * (-829.922) [-826.554] (-826.788) (-825.278) -- 0:00:22
627000 -- [-824.307] (-824.393) (-825.795) (-826.547) * (-823.878) (-827.379) (-832.877) [-824.338] -- 0:00:22
627500 -- (-824.958) (-828.086) [-830.233] (-826.134) * [-825.515] (-827.449) (-831.682) (-826.817) -- 0:00:22
628000 -- [-823.955] (-826.289) (-826.314) (-827.640) * [-826.727] (-827.122) (-824.778) (-827.656) -- 0:00:22
628500 -- (-829.097) [-826.300] (-826.495) (-825.753) * (-825.427) (-828.853) [-824.840] (-826.217) -- 0:00:22
629000 -- (-827.342) [-827.024] (-831.390) (-825.686) * (-828.063) (-826.253) [-826.148] (-828.278) -- 0:00:22
629500 -- (-832.248) [-827.746] (-827.888) (-827.716) * [-828.201] (-826.068) (-827.238) (-824.936) -- 0:00:22
630000 -- [-827.289] (-826.426) (-830.128) (-825.790) * (-827.253) (-825.889) (-825.015) [-825.110] -- 0:00:22
Average standard deviation of split frequencies: 0.007255
630500 -- (-825.661) [-828.510] (-831.320) (-827.272) * [-827.053] (-826.261) (-827.944) (-825.166) -- 0:00:22
631000 -- (-825.177) (-828.991) [-827.469] (-826.260) * [-824.844] (-826.008) (-831.134) (-824.865) -- 0:00:22
631500 -- (-827.343) (-833.245) (-826.549) [-826.458] * (-825.134) [-826.476] (-825.468) (-825.313) -- 0:00:22
632000 -- (-829.547) (-829.315) (-824.441) [-824.431] * (-826.000) (-826.072) (-824.776) [-827.548] -- 0:00:22
632500 -- (-828.975) (-825.526) [-829.031] (-825.999) * (-824.748) [-825.535] (-825.001) (-827.724) -- 0:00:22
633000 -- (-825.522) (-825.872) [-827.071] (-824.371) * (-825.074) (-824.596) (-827.185) [-824.078] -- 0:00:22
633500 -- (-825.997) (-825.924) (-828.162) [-828.072] * (-827.606) [-824.211] (-825.835) (-825.320) -- 0:00:21
634000 -- (-825.305) (-824.713) (-826.317) [-826.943] * (-829.794) (-827.369) [-825.981] (-826.601) -- 0:00:21
634500 -- [-828.852] (-825.044) (-827.506) (-828.098) * (-830.301) (-827.281) [-825.753] (-825.967) -- 0:00:21
635000 -- (-826.443) [-826.440] (-826.550) (-829.662) * [-829.190] (-827.709) (-830.988) (-826.637) -- 0:00:21
Average standard deviation of split frequencies: 0.007063
635500 -- (-825.492) [-825.449] (-825.112) (-825.227) * (-826.537) (-827.298) (-826.001) [-826.948] -- 0:00:21
636000 -- [-824.780] (-828.201) (-830.253) (-824.434) * (-825.080) (-826.305) [-825.238] (-825.209) -- 0:00:21
636500 -- (-824.738) (-825.884) (-825.014) [-830.259] * (-828.866) (-828.695) (-826.324) [-825.497] -- 0:00:22
637000 -- [-825.129] (-825.213) (-826.898) (-827.678) * (-828.325) (-832.630) (-825.967) [-823.980] -- 0:00:22
637500 -- (-827.312) (-825.617) [-827.452] (-827.156) * (-830.007) [-824.353] (-824.645) (-825.033) -- 0:00:22
638000 -- (-826.249) [-824.227] (-825.324) (-828.692) * (-826.398) (-827.750) [-824.067] (-825.386) -- 0:00:22
638500 -- (-827.932) [-827.831] (-826.674) (-824.974) * (-828.344) (-825.712) [-824.045] (-826.011) -- 0:00:22
639000 -- [-824.271] (-825.514) (-827.459) (-825.402) * (-827.207) (-825.817) [-825.865] (-827.607) -- 0:00:22
639500 -- (-829.693) (-823.807) [-825.100] (-824.855) * [-825.962] (-824.574) (-825.631) (-825.627) -- 0:00:21
640000 -- (-833.839) [-824.525] (-825.506) (-824.089) * (-829.759) (-827.683) (-826.632) [-826.617] -- 0:00:21
Average standard deviation of split frequencies: 0.006944
640500 -- (-828.400) (-825.893) [-826.251] (-826.020) * (-829.303) (-825.283) (-829.580) [-824.532] -- 0:00:21
641000 -- (-826.673) (-826.131) (-825.083) [-827.481] * (-828.016) (-824.829) (-824.752) [-825.337] -- 0:00:21
641500 -- (-825.168) [-825.224] (-824.834) (-826.084) * [-825.124] (-825.137) (-824.482) (-825.257) -- 0:00:21
642000 -- (-824.358) [-825.435] (-824.834) (-828.113) * (-825.397) [-827.708] (-824.967) (-827.135) -- 0:00:21
642500 -- [-824.819] (-826.808) (-825.778) (-827.233) * (-824.345) (-827.388) (-824.723) [-828.424] -- 0:00:21
643000 -- [-827.318] (-827.646) (-825.518) (-826.962) * (-824.986) [-826.904] (-823.988) (-828.958) -- 0:00:21
643500 -- (-828.545) [-826.683] (-825.072) (-827.536) * [-824.769] (-826.499) (-824.461) (-828.505) -- 0:00:21
644000 -- [-825.130] (-826.702) (-828.519) (-827.061) * (-829.671) (-825.714) [-827.079] (-825.635) -- 0:00:21
644500 -- (-826.367) [-825.724] (-827.835) (-825.847) * [-825.623] (-827.657) (-828.400) (-824.703) -- 0:00:21
645000 -- (-828.543) [-825.416] (-829.498) (-825.117) * [-827.182] (-824.693) (-825.476) (-824.445) -- 0:00:21
Average standard deviation of split frequencies: 0.006659
645500 -- (-825.344) (-825.096) [-826.864] (-825.384) * (-824.953) (-824.884) (-825.863) [-824.553] -- 0:00:21
646000 -- [-826.343] (-827.427) (-826.537) (-824.474) * (-824.790) (-827.358) [-826.372] (-824.948) -- 0:00:21
646500 -- (-824.798) [-830.880] (-827.045) (-828.420) * [-826.875] (-830.595) (-829.000) (-824.868) -- 0:00:21
647000 -- (-827.213) [-827.852] (-830.619) (-826.242) * (-827.316) (-828.396) [-826.049] (-825.131) -- 0:00:21
647500 -- (-824.953) (-826.907) [-826.502] (-824.813) * (-827.819) (-831.233) (-825.425) [-825.781] -- 0:00:21
648000 -- [-827.854] (-828.573) (-827.791) (-825.241) * [-827.313] (-827.238) (-825.016) (-824.893) -- 0:00:21
648500 -- [-826.247] (-832.805) (-827.392) (-826.931) * [-829.230] (-824.540) (-824.823) (-825.864) -- 0:00:21
649000 -- (-825.233) [-825.504] (-825.641) (-827.252) * (-826.332) (-826.069) (-831.204) [-825.392] -- 0:00:21
649500 -- [-828.736] (-825.971) (-825.467) (-825.262) * [-825.496] (-826.376) (-826.327) (-824.826) -- 0:00:21
650000 -- [-827.986] (-825.525) (-825.562) (-825.273) * (-828.576) (-825.911) (-826.333) [-824.666] -- 0:00:21
Average standard deviation of split frequencies: 0.006656
650500 -- (-825.362) [-825.804] (-824.843) (-825.469) * [-827.821] (-826.094) (-832.569) (-829.677) -- 0:00:20
651000 -- (-826.218) [-828.130] (-824.566) (-825.006) * (-825.199) [-825.477] (-828.996) (-827.489) -- 0:00:20
651500 -- [-823.904] (-832.247) (-824.933) (-825.915) * [-826.703] (-829.761) (-825.897) (-829.025) -- 0:00:20
652000 -- [-823.823] (-827.131) (-825.192) (-827.162) * [-826.299] (-825.919) (-824.783) (-827.459) -- 0:00:20
652500 -- (-827.363) [-825.169] (-825.640) (-830.764) * (-825.481) [-825.998] (-826.400) (-827.407) -- 0:00:20
653000 -- (-826.432) (-825.167) (-827.419) [-825.193] * [-825.586] (-825.882) (-824.191) (-827.108) -- 0:00:20
653500 -- (-826.870) (-826.381) (-826.218) [-826.480] * (-825.354) (-827.419) (-826.280) [-827.023] -- 0:00:21
654000 -- (-826.612) (-828.271) (-825.636) [-824.259] * (-825.152) (-827.058) [-828.861] (-825.855) -- 0:00:21
654500 -- [-829.376] (-827.585) (-832.702) (-824.661) * (-824.370) (-825.313) (-827.609) [-825.681] -- 0:00:21
655000 -- (-827.459) [-827.613] (-836.206) (-825.159) * (-824.281) (-825.524) (-825.448) [-825.477] -- 0:00:21
Average standard deviation of split frequencies: 0.006288
655500 -- (-827.927) (-825.821) (-826.528) [-824.564] * (-823.978) (-824.723) [-826.021] (-827.176) -- 0:00:21
656000 -- [-828.628] (-826.709) (-828.313) (-823.994) * (-824.476) (-823.868) (-825.489) [-827.149] -- 0:00:20
656500 -- (-828.735) [-826.725] (-825.205) (-828.134) * (-825.048) [-826.023] (-824.652) (-826.386) -- 0:00:20
657000 -- (-826.794) (-825.650) [-826.516] (-827.963) * (-825.211) [-824.636] (-825.865) (-824.950) -- 0:00:20
657500 -- (-829.476) (-825.870) (-825.623) [-825.109] * (-824.529) [-824.165] (-833.688) (-829.251) -- 0:00:20
658000 -- [-824.684] (-829.596) (-825.993) (-825.576) * [-824.696] (-826.449) (-824.766) (-825.822) -- 0:00:20
658500 -- [-824.875] (-829.774) (-828.826) (-824.980) * [-827.565] (-825.293) (-827.283) (-824.679) -- 0:00:20
659000 -- [-826.867] (-831.828) (-824.939) (-823.919) * (-826.615) (-826.737) (-827.069) [-825.004] -- 0:00:20
659500 -- (-833.562) [-826.451] (-828.504) (-823.950) * [-828.347] (-826.984) (-826.597) (-825.150) -- 0:00:20
660000 -- [-828.537] (-831.442) (-825.392) (-824.104) * [-828.447] (-825.772) (-826.060) (-826.358) -- 0:00:20
Average standard deviation of split frequencies: 0.006957
660500 -- (-829.379) (-827.471) (-826.894) [-826.229] * (-826.488) (-825.438) (-828.246) [-825.379] -- 0:00:20
661000 -- (-827.073) (-827.897) (-826.486) [-826.587] * [-825.675] (-832.250) (-830.702) (-826.998) -- 0:00:20
661500 -- (-827.711) (-824.572) [-826.527] (-826.139) * (-824.401) (-830.656) (-830.656) [-827.532] -- 0:00:20
662000 -- (-825.896) [-827.649] (-826.172) (-825.669) * (-828.022) [-824.816] (-829.059) (-825.289) -- 0:00:20
662500 -- (-825.394) (-824.798) [-829.970] (-824.888) * (-831.777) (-824.224) [-824.181] (-826.741) -- 0:00:20
663000 -- (-826.552) (-826.974) [-824.855] (-825.599) * (-825.783) (-826.834) (-826.786) [-827.071] -- 0:00:20
663500 -- [-825.869] (-827.444) (-824.210) (-824.457) * (-826.636) (-825.772) [-823.801] (-825.448) -- 0:00:20
664000 -- (-825.008) (-827.208) [-824.912] (-825.051) * (-825.476) [-825.862] (-829.874) (-825.145) -- 0:00:20
664500 -- (-823.945) (-830.533) [-824.186] (-825.107) * (-825.499) (-830.937) (-828.409) [-827.557] -- 0:00:20
665000 -- (-824.298) (-827.620) [-825.442] (-824.124) * (-828.800) [-828.462] (-825.725) (-826.644) -- 0:00:20
Average standard deviation of split frequencies: 0.006813
665500 -- (-825.883) (-829.005) [-824.784] (-824.754) * (-824.684) (-829.148) [-825.607] (-826.030) -- 0:00:20
666000 -- (-828.461) [-824.972] (-826.755) (-825.066) * [-826.178] (-828.707) (-832.651) (-824.384) -- 0:00:20
666500 -- (-830.905) (-827.843) [-825.060] (-826.157) * (-830.009) [-825.104] (-831.973) (-824.284) -- 0:00:20
667000 -- (-828.589) (-825.358) (-824.469) [-825.158] * (-826.131) [-826.135] (-831.269) (-825.980) -- 0:00:19
667500 -- (-824.883) (-825.721) (-824.215) [-826.538] * (-826.015) (-824.554) [-825.551] (-826.087) -- 0:00:19
668000 -- [-824.147] (-827.774) (-823.851) (-828.017) * (-825.573) (-827.156) [-824.578] (-827.379) -- 0:00:19
668500 -- (-825.196) [-827.215] (-826.161) (-829.812) * (-824.630) (-825.641) [-825.742] (-827.047) -- 0:00:19
669000 -- (-825.023) (-826.880) (-827.353) [-826.520] * [-825.394] (-824.662) (-824.793) (-833.069) -- 0:00:19
669500 -- (-826.475) (-826.460) [-826.136] (-827.072) * [-826.136] (-827.136) (-824.750) (-824.547) -- 0:00:19
670000 -- (-825.207) (-828.591) [-825.452] (-825.547) * (-828.731) [-824.177] (-827.253) (-827.179) -- 0:00:20
Average standard deviation of split frequencies: 0.006985
670500 -- (-827.038) (-828.091) [-825.348] (-826.453) * (-828.125) (-824.975) [-825.218] (-830.628) -- 0:00:20
671000 -- (-825.560) (-824.641) (-827.746) [-825.793] * (-825.258) (-827.428) [-825.329] (-826.846) -- 0:00:20
671500 -- (-825.336) (-825.100) [-826.252] (-825.656) * (-824.808) [-824.736] (-825.529) (-825.648) -- 0:00:20
672000 -- (-828.920) (-826.444) (-826.508) [-825.232] * (-825.141) [-824.587] (-824.469) (-828.131) -- 0:00:20
672500 -- (-825.985) [-826.355] (-828.729) (-825.538) * (-827.400) [-824.712] (-826.614) (-825.935) -- 0:00:19
673000 -- (-825.985) (-826.706) [-828.576] (-826.288) * (-825.290) (-825.620) (-825.948) [-826.461] -- 0:00:19
673500 -- (-825.723) (-824.671) (-834.499) [-827.072] * (-825.244) (-827.783) [-825.149] (-824.129) -- 0:00:19
674000 -- (-824.405) (-824.633) [-827.596] (-827.479) * (-825.810) (-830.397) [-825.105] (-826.842) -- 0:00:19
674500 -- (-824.221) (-832.102) [-826.043] (-825.423) * (-826.222) (-826.080) (-824.205) [-827.794] -- 0:00:19
675000 -- (-829.429) (-840.569) (-825.589) [-827.935] * (-824.339) [-825.151] (-827.185) (-826.349) -- 0:00:19
Average standard deviation of split frequencies: 0.006843
675500 -- (-825.868) [-827.788] (-829.398) (-828.688) * (-824.075) [-824.314] (-828.890) (-825.515) -- 0:00:19
676000 -- (-829.055) (-833.879) (-829.733) [-825.000] * [-825.752] (-827.182) (-825.376) (-825.605) -- 0:00:19
676500 -- (-824.181) (-834.891) [-828.525] (-825.760) * [-827.350] (-824.409) (-827.622) (-826.516) -- 0:00:19
677000 -- [-823.935] (-831.731) (-825.893) (-826.184) * (-833.284) [-825.583] (-832.197) (-826.585) -- 0:00:19
677500 -- [-823.987] (-829.887) (-825.282) (-824.421) * [-827.756] (-830.052) (-824.830) (-830.645) -- 0:00:19
678000 -- (-824.050) [-823.910] (-824.729) (-824.445) * [-825.231] (-831.438) (-827.167) (-825.324) -- 0:00:19
678500 -- [-823.909] (-826.388) (-824.901) (-826.194) * (-824.197) [-825.603] (-827.181) (-826.727) -- 0:00:19
679000 -- [-825.566] (-828.105) (-824.851) (-825.566) * [-824.437] (-826.596) (-826.867) (-825.334) -- 0:00:19
679500 -- (-826.238) (-825.247) (-826.676) [-824.010] * (-824.927) (-825.218) [-826.517] (-827.463) -- 0:00:19
680000 -- (-825.494) (-824.036) (-824.336) [-825.219] * [-825.156] (-824.138) (-826.516) (-825.065) -- 0:00:19
Average standard deviation of split frequencies: 0.006602
680500 -- (-827.291) (-825.780) [-825.056] (-825.080) * (-825.951) [-824.512] (-826.851) (-825.189) -- 0:00:19
681000 -- (-825.712) [-827.741] (-825.702) (-824.995) * (-827.444) (-824.294) [-830.300] (-825.095) -- 0:00:19
681500 -- (-830.607) [-825.815] (-825.653) (-826.943) * (-825.880) [-826.760] (-826.899) (-824.714) -- 0:00:19
682000 -- (-827.372) (-824.867) (-825.516) [-827.088] * (-824.157) (-824.767) (-827.544) [-824.600] -- 0:00:19
682500 -- [-825.378] (-825.413) (-827.042) (-829.793) * (-826.652) (-824.198) (-830.119) [-828.617] -- 0:00:19
683000 -- (-831.399) (-824.242) [-824.326] (-825.790) * [-826.735] (-824.444) (-827.692) (-826.105) -- 0:00:19
683500 -- (-829.975) [-824.635] (-824.603) (-825.130) * [-825.019] (-826.371) (-828.538) (-824.270) -- 0:00:18
684000 -- (-829.578) (-823.917) (-825.359) [-825.089] * [-824.714] (-825.724) (-829.077) (-826.385) -- 0:00:18
684500 -- (-828.960) [-824.516] (-827.722) (-828.554) * (-825.759) (-824.388) (-827.174) [-826.811] -- 0:00:18
685000 -- (-826.542) (-825.100) [-826.825] (-825.966) * [-825.034] (-824.301) (-826.895) (-826.097) -- 0:00:18
Average standard deviation of split frequencies: 0.006551
685500 -- [-825.782] (-827.636) (-826.023) (-825.183) * (-833.203) [-827.999] (-825.057) (-824.087) -- 0:00:18
686000 -- (-825.247) (-825.190) (-826.732) [-827.056] * (-824.705) (-827.537) [-825.271] (-825.713) -- 0:00:18
686500 -- (-827.441) (-826.750) (-824.418) [-826.535] * (-825.072) [-826.177] (-827.235) (-829.005) -- 0:00:19
687000 -- (-825.987) (-831.330) (-827.243) [-824.620] * [-829.083] (-826.623) (-824.126) (-824.910) -- 0:00:19
687500 -- [-826.811] (-825.539) (-827.316) (-824.752) * [-828.316] (-828.742) (-824.976) (-828.903) -- 0:00:19
688000 -- (-824.492) (-828.220) [-825.385] (-826.994) * (-825.993) [-824.469] (-824.030) (-826.525) -- 0:00:19
688500 -- (-825.769) (-830.619) [-824.580] (-825.777) * (-829.932) (-824.747) [-825.290] (-829.675) -- 0:00:19
689000 -- (-824.246) (-830.002) (-826.727) [-825.127] * [-825.068] (-826.359) (-828.003) (-825.864) -- 0:00:18
689500 -- (-825.181) [-824.925] (-825.628) (-828.080) * [-825.120] (-828.543) (-824.349) (-827.706) -- 0:00:18
690000 -- (-824.542) [-824.639] (-825.713) (-827.282) * [-824.764] (-825.312) (-828.028) (-826.515) -- 0:00:18
Average standard deviation of split frequencies: 0.006097
690500 -- (-825.747) (-825.408) [-825.505] (-827.550) * (-829.467) (-824.401) (-827.770) [-824.622] -- 0:00:18
691000 -- (-824.252) (-824.153) (-825.290) [-826.655] * (-828.528) (-824.970) [-825.501] (-826.721) -- 0:00:18
691500 -- (-833.043) [-824.292] (-827.333) (-826.456) * (-824.325) (-829.652) [-825.140] (-827.501) -- 0:00:18
692000 -- [-825.118] (-824.706) (-828.662) (-825.581) * [-825.049] (-830.305) (-826.344) (-825.234) -- 0:00:18
692500 -- (-827.645) [-826.587] (-825.224) (-825.674) * (-827.477) [-829.349] (-824.916) (-825.369) -- 0:00:18
693000 -- [-826.570] (-824.805) (-824.585) (-825.472) * [-825.933] (-826.396) (-828.704) (-825.710) -- 0:00:18
693500 -- (-825.731) [-824.343] (-826.852) (-826.598) * [-825.650] (-832.397) (-826.588) (-824.712) -- 0:00:18
694000 -- [-825.543] (-824.765) (-824.710) (-826.004) * (-826.141) [-824.213] (-825.645) (-825.448) -- 0:00:18
694500 -- (-825.008) [-824.764] (-827.878) (-826.569) * (-825.942) (-828.039) (-831.439) [-825.843] -- 0:00:18
695000 -- (-824.655) [-825.853] (-827.364) (-825.984) * (-827.220) [-824.413] (-829.111) (-825.472) -- 0:00:18
Average standard deviation of split frequencies: 0.006051
695500 -- [-824.595] (-828.324) (-827.561) (-827.631) * (-827.155) (-830.916) (-825.389) [-824.778] -- 0:00:18
696000 -- [-826.485] (-829.700) (-828.001) (-825.503) * (-825.546) (-825.794) (-829.863) [-827.202] -- 0:00:18
696500 -- [-824.768] (-825.359) (-824.144) (-826.364) * (-826.354) [-826.125] (-826.868) (-825.134) -- 0:00:18
697000 -- [-824.075] (-824.489) (-825.010) (-826.336) * [-828.829] (-824.319) (-829.365) (-824.851) -- 0:00:18
697500 -- (-826.849) [-824.489] (-827.461) (-826.234) * (-828.224) (-824.977) [-825.522] (-827.306) -- 0:00:18
698000 -- (-825.927) [-825.622] (-826.078) (-827.183) * (-825.559) (-826.643) [-827.860] (-829.115) -- 0:00:18
698500 -- (-826.290) (-824.102) (-825.189) [-827.659] * (-827.901) [-829.487] (-825.154) (-827.771) -- 0:00:18
699000 -- (-824.024) [-824.299] (-825.529) (-824.473) * (-829.679) (-825.951) (-825.333) [-827.750] -- 0:00:18
699500 -- [-826.687] (-825.586) (-825.777) (-827.423) * (-825.546) (-825.919) [-827.205] (-828.213) -- 0:00:18
700000 -- (-826.546) (-826.689) (-826.088) [-827.851] * (-824.571) (-824.309) [-829.587] (-826.431) -- 0:00:18
Average standard deviation of split frequencies: 0.006476
700500 -- (-826.765) (-825.909) [-826.634] (-826.579) * (-826.268) (-825.182) (-824.591) [-828.026] -- 0:00:17
701000 -- (-825.213) (-826.038) (-824.157) [-825.439] * [-825.148] (-826.382) (-825.219) (-827.913) -- 0:00:17
701500 -- [-828.461] (-829.355) (-824.765) (-828.554) * (-824.745) (-829.216) [-829.348] (-825.260) -- 0:00:17
702000 -- (-828.386) (-826.283) [-826.922] (-826.912) * (-824.604) (-824.634) (-827.234) [-825.660] -- 0:00:17
702500 -- [-827.591] (-825.471) (-825.606) (-827.466) * (-827.100) [-824.867] (-824.862) (-824.704) -- 0:00:17
703000 -- [-827.820] (-831.374) (-826.973) (-824.534) * (-826.468) (-824.867) [-824.696] (-828.438) -- 0:00:18
703500 -- (-826.330) (-824.966) (-828.215) [-825.750] * (-824.294) [-826.046] (-824.151) (-828.254) -- 0:00:18
704000 -- (-828.797) [-825.982] (-825.355) (-829.368) * (-824.607) (-824.853) (-825.435) [-827.211] -- 0:00:18
704500 -- (-826.111) (-824.896) [-825.392] (-830.735) * (-825.557) (-826.300) (-826.595) [-826.753] -- 0:00:18
705000 -- (-826.728) [-827.607] (-828.694) (-826.890) * (-828.071) (-825.870) (-825.107) [-828.383] -- 0:00:17
Average standard deviation of split frequencies: 0.006552
705500 -- (-829.376) [-824.608] (-826.529) (-825.500) * [-826.897] (-825.704) (-824.940) (-827.658) -- 0:00:17
706000 -- (-828.641) (-831.230) [-824.741] (-826.719) * [-824.597] (-827.843) (-824.905) (-825.164) -- 0:00:17
706500 -- (-830.259) [-829.820] (-825.470) (-825.511) * (-824.781) (-833.326) (-829.165) [-825.337] -- 0:00:17
707000 -- (-829.511) (-826.858) (-826.333) [-827.040] * (-824.974) [-830.990] (-825.739) (-831.232) -- 0:00:17
707500 -- [-826.135] (-826.843) (-826.485) (-828.593) * (-824.184) [-825.210] (-826.338) (-833.496) -- 0:00:17
708000 -- [-826.726] (-830.547) (-828.050) (-824.346) * (-826.152) (-824.211) (-826.980) [-825.007] -- 0:00:17
708500 -- (-827.276) (-828.135) (-827.840) [-824.586] * [-825.041] (-825.820) (-827.102) (-824.844) -- 0:00:17
709000 -- (-823.897) (-826.120) (-828.104) [-824.208] * [-826.504] (-827.646) (-828.260) (-824.809) -- 0:00:17
709500 -- (-824.667) (-826.123) (-825.506) [-824.169] * [-826.256] (-827.277) (-825.668) (-825.659) -- 0:00:17
710000 -- [-826.037] (-827.000) (-827.229) (-826.656) * (-825.897) (-824.411) (-826.108) [-826.174] -- 0:00:17
Average standard deviation of split frequencies: 0.006716
710500 -- [-828.187] (-829.190) (-825.882) (-830.062) * [-828.401] (-825.910) (-827.219) (-826.698) -- 0:00:17
711000 -- (-826.938) (-829.513) (-826.200) [-825.566] * (-827.583) [-825.614] (-827.005) (-825.306) -- 0:00:17
711500 -- [-824.999] (-827.227) (-826.127) (-828.791) * (-824.668) [-825.007] (-829.375) (-827.393) -- 0:00:17
712000 -- (-826.007) (-824.609) (-825.268) [-826.566] * [-828.423] (-825.400) (-827.931) (-830.948) -- 0:00:17
712500 -- (-831.392) [-824.884] (-827.126) (-827.999) * (-826.357) (-825.956) [-824.887] (-836.268) -- 0:00:17
713000 -- (-830.017) (-824.885) (-826.187) [-825.433] * (-830.157) (-824.307) (-827.216) [-827.826] -- 0:00:17
713500 -- (-832.330) [-823.837] (-826.351) (-824.420) * (-830.078) [-823.960] (-827.513) (-825.422) -- 0:00:17
714000 -- (-831.306) (-827.283) [-826.851] (-830.156) * (-828.432) (-826.899) [-827.899] (-827.032) -- 0:00:17
714500 -- (-828.528) (-826.397) [-826.213] (-827.351) * (-827.538) (-825.254) (-828.357) [-826.942] -- 0:00:17
715000 -- (-825.145) (-827.252) [-826.442] (-825.657) * [-826.738] (-824.410) (-827.440) (-826.241) -- 0:00:17
Average standard deviation of split frequencies: 0.006543
715500 -- (-825.405) [-826.291] (-826.417) (-828.479) * (-828.794) (-826.923) (-827.315) [-826.869] -- 0:00:17
716000 -- (-825.394) (-826.185) (-825.581) [-825.717] * (-826.126) (-827.075) (-825.244) [-826.463] -- 0:00:17
716500 -- [-827.251] (-824.158) (-826.269) (-828.298) * [-826.976] (-828.338) (-824.474) (-827.852) -- 0:00:17
717000 -- [-825.990] (-825.393) (-827.030) (-828.594) * (-827.133) (-827.715) [-825.596] (-828.165) -- 0:00:16
717500 -- [-825.684] (-823.841) (-825.240) (-825.952) * [-825.488] (-826.679) (-825.424) (-828.671) -- 0:00:16
718000 -- (-827.496) (-825.856) [-825.261] (-826.128) * (-827.531) (-826.397) (-824.569) [-828.942] -- 0:00:16
718500 -- (-825.321) (-828.901) [-826.809] (-827.741) * (-825.316) (-825.788) (-825.296) [-825.331] -- 0:00:16
719000 -- (-825.179) (-828.417) [-824.076] (-828.574) * (-826.619) (-829.431) (-827.904) [-826.069] -- 0:00:16
719500 -- (-826.331) (-824.075) [-825.989] (-825.584) * (-827.260) (-826.455) (-832.153) [-824.516] -- 0:00:16
720000 -- (-825.598) (-826.973) [-826.803] (-825.025) * (-825.257) [-826.654] (-824.787) (-827.176) -- 0:00:17
Average standard deviation of split frequencies: 0.005843
720500 -- (-829.031) [-827.624] (-823.877) (-827.118) * (-827.163) [-825.634] (-827.160) (-827.697) -- 0:00:17
721000 -- (-827.278) (-826.442) [-826.286] (-827.416) * (-826.322) [-826.082] (-829.366) (-826.883) -- 0:00:17
721500 -- (-825.666) (-825.571) [-825.627] (-826.081) * (-826.844) [-825.104] (-827.409) (-826.326) -- 0:00:16
722000 -- (-827.234) [-827.909] (-826.071) (-826.191) * [-827.041] (-829.378) (-829.380) (-828.534) -- 0:00:16
722500 -- (-827.503) (-826.796) (-824.335) [-824.437] * (-824.433) (-825.165) [-824.245] (-824.623) -- 0:00:16
723000 -- (-827.409) [-826.539] (-824.041) (-824.123) * (-824.611) [-824.746] (-826.777) (-824.156) -- 0:00:16
723500 -- (-826.661) (-828.798) [-827.038] (-828.196) * (-828.924) (-825.533) [-825.564] (-824.851) -- 0:00:16
724000 -- (-828.255) (-825.570) [-827.963] (-826.345) * (-826.428) (-832.761) (-824.354) [-827.330] -- 0:00:16
724500 -- (-834.433) (-824.542) (-825.843) [-825.803] * (-826.750) (-826.008) [-825.803] (-827.177) -- 0:00:16
725000 -- (-825.912) [-826.943] (-825.256) (-826.624) * (-824.970) (-825.237) (-825.992) [-824.555] -- 0:00:16
Average standard deviation of split frequencies: 0.005238
725500 -- (-826.510) [-826.416] (-827.307) (-829.632) * (-825.580) (-824.794) (-824.726) [-825.163] -- 0:00:16
726000 -- (-825.739) (-826.071) [-827.431] (-828.100) * [-825.806] (-826.608) (-830.417) (-825.202) -- 0:00:16
726500 -- (-831.681) (-830.758) (-825.613) [-826.177] * (-831.802) [-826.453] (-829.831) (-827.214) -- 0:00:16
727000 -- (-832.430) (-825.094) (-831.644) [-825.200] * (-824.746) [-825.234] (-828.321) (-830.008) -- 0:00:16
727500 -- (-827.144) (-826.676) (-828.162) [-828.262] * (-829.306) (-824.851) [-828.679] (-826.527) -- 0:00:16
728000 -- (-827.970) [-826.741] (-825.038) (-829.008) * [-827.863] (-824.267) (-827.829) (-831.036) -- 0:00:16
728500 -- [-825.837] (-828.232) (-824.600) (-828.623) * (-825.507) [-824.468] (-828.365) (-828.041) -- 0:00:16
729000 -- (-825.835) (-825.818) [-824.948] (-824.772) * [-824.604] (-826.099) (-829.087) (-828.436) -- 0:00:16
729500 -- (-824.753) (-828.381) (-827.379) [-824.749] * [-825.686] (-825.261) (-824.996) (-825.247) -- 0:00:16
730000 -- (-825.999) [-824.198] (-825.444) (-827.832) * (-826.216) [-825.702] (-826.052) (-826.190) -- 0:00:16
Average standard deviation of split frequencies: 0.004879
730500 -- (-826.613) [-826.642] (-828.777) (-825.038) * [-825.332] (-831.281) (-827.061) (-824.840) -- 0:00:16
731000 -- (-824.764) [-827.683] (-825.953) (-826.166) * (-826.000) (-827.935) [-824.992] (-826.601) -- 0:00:16
731500 -- (-826.223) [-825.857] (-828.036) (-825.675) * [-824.901] (-826.268) (-824.508) (-826.745) -- 0:00:16
732000 -- (-824.976) (-824.892) [-826.820] (-826.602) * (-826.122) (-827.752) [-831.482] (-826.592) -- 0:00:16
732500 -- (-826.399) [-828.959] (-831.015) (-827.530) * (-824.714) [-824.503] (-826.134) (-828.045) -- 0:00:16
733000 -- (-830.030) (-829.947) [-827.742] (-827.659) * [-824.388] (-827.028) (-824.408) (-829.579) -- 0:00:16
733500 -- (-827.820) [-827.657] (-824.673) (-824.462) * (-824.594) (-828.152) (-824.399) [-825.034] -- 0:00:15
734000 -- [-825.242] (-827.623) (-824.754) (-824.638) * (-830.659) [-824.841] (-827.439) (-829.444) -- 0:00:15
734500 -- [-825.401] (-826.932) (-824.841) (-826.651) * (-826.514) [-826.322] (-824.896) (-828.128) -- 0:00:15
735000 -- [-828.060] (-826.358) (-825.237) (-825.131) * [-824.845] (-826.004) (-825.504) (-826.012) -- 0:00:15
Average standard deviation of split frequencies: 0.004782
735500 -- (-828.863) (-825.604) (-824.451) [-826.214] * (-825.525) (-830.889) (-825.044) [-825.516] -- 0:00:16
736000 -- (-826.645) (-826.055) (-824.492) [-825.463] * (-824.818) (-826.466) (-825.567) [-826.036] -- 0:00:16
736500 -- (-828.148) (-825.821) [-826.443] (-826.215) * (-827.202) [-824.466] (-825.917) (-827.057) -- 0:00:16
737000 -- (-829.154) [-826.107] (-826.200) (-829.715) * (-827.888) [-824.305] (-828.730) (-825.193) -- 0:00:16
737500 -- (-824.082) (-824.822) [-827.331] (-825.021) * [-826.827] (-827.872) (-825.045) (-825.653) -- 0:00:16
738000 -- (-827.342) (-826.295) (-831.080) [-827.696] * (-826.064) [-826.035] (-826.705) (-825.378) -- 0:00:15
738500 -- (-826.038) (-824.160) (-828.524) [-826.867] * [-824.510] (-826.739) (-824.732) (-827.383) -- 0:00:15
739000 -- (-825.946) (-824.727) (-825.370) [-823.763] * (-826.491) [-826.229] (-825.638) (-827.083) -- 0:00:15
739500 -- (-829.616) (-824.544) (-824.953) [-824.466] * [-828.752] (-825.099) (-826.569) (-827.489) -- 0:00:15
740000 -- [-824.965] (-826.751) (-825.034) (-825.916) * (-827.829) (-826.008) [-826.878] (-826.564) -- 0:00:15
Average standard deviation of split frequencies: 0.004625
740500 -- [-826.067] (-828.087) (-829.544) (-824.931) * (-826.209) (-826.860) [-826.501] (-825.680) -- 0:00:15
741000 -- (-825.760) (-828.172) [-830.548] (-825.152) * [-826.004] (-825.518) (-829.017) (-824.795) -- 0:00:15
741500 -- (-828.221) (-827.164) (-828.701) [-828.062] * (-824.047) (-827.913) (-825.067) [-828.570] -- 0:00:15
742000 -- (-824.245) (-833.067) [-826.444] (-827.551) * (-826.261) (-828.838) (-823.871) [-827.203] -- 0:00:15
742500 -- (-825.258) (-827.146) (-827.119) [-826.329] * [-824.936] (-825.911) (-826.713) (-825.566) -- 0:00:15
743000 -- (-828.677) (-828.236) [-823.923] (-824.862) * [-825.599] (-825.598) (-825.977) (-825.689) -- 0:00:15
743500 -- (-825.026) (-824.414) [-826.475] (-824.510) * [-825.305] (-825.550) (-825.875) (-825.892) -- 0:00:15
744000 -- (-827.189) (-824.999) (-825.163) [-824.796] * (-825.666) (-828.933) [-825.786] (-824.895) -- 0:00:15
744500 -- (-826.049) (-826.766) (-826.095) [-828.237] * [-830.659] (-829.218) (-825.147) (-824.351) -- 0:00:15
745000 -- (-826.322) [-826.598] (-826.665) (-824.510) * (-826.995) [-827.795] (-825.052) (-825.050) -- 0:00:15
Average standard deviation of split frequencies: 0.004502
745500 -- (-825.989) (-827.980) (-831.389) [-825.168] * (-827.141) [-825.242] (-825.157) (-824.822) -- 0:00:15
746000 -- (-831.588) (-825.259) [-825.294] (-825.002) * [-827.465] (-826.954) (-824.387) (-825.286) -- 0:00:15
746500 -- (-826.874) (-824.680) [-829.478] (-824.729) * (-828.160) [-827.442] (-824.652) (-825.610) -- 0:00:15
747000 -- (-827.959) (-827.888) (-826.520) [-827.304] * (-832.969) (-827.095) (-827.241) [-825.387] -- 0:00:15
747500 -- (-826.847) (-824.472) [-825.757] (-829.249) * (-833.115) (-826.802) [-825.036] (-828.497) -- 0:00:15
748000 -- [-825.049] (-824.796) (-825.957) (-826.191) * (-827.719) (-827.210) (-827.421) [-827.898] -- 0:00:15
748500 -- (-826.449) (-824.234) (-826.789) [-827.068] * (-829.816) [-826.571] (-831.457) (-827.847) -- 0:00:15
749000 -- [-824.969] (-827.003) (-828.296) (-827.068) * [-824.577] (-826.602) (-836.473) (-828.658) -- 0:00:15
749500 -- (-825.900) (-824.661) [-825.521] (-824.981) * (-826.593) (-825.400) (-825.369) [-825.815] -- 0:00:15
750000 -- (-827.102) [-824.146] (-826.223) (-825.554) * (-825.696) [-825.608] (-826.475) (-825.684) -- 0:00:15
Average standard deviation of split frequencies: 0.004160
750500 -- (-826.379) [-824.136] (-827.593) (-826.344) * (-832.802) [-825.698] (-827.154) (-827.604) -- 0:00:15
751000 -- (-825.496) [-830.408] (-827.765) (-826.010) * [-825.225] (-829.710) (-825.567) (-826.521) -- 0:00:15
751500 -- (-828.302) (-826.743) [-829.746] (-824.610) * (-826.071) (-837.327) [-825.858] (-833.115) -- 0:00:15
752000 -- (-826.269) (-827.809) [-827.088] (-826.983) * (-824.312) (-827.906) (-832.246) [-826.034] -- 0:00:15
752500 -- (-825.849) (-827.625) [-827.374] (-827.773) * (-824.469) (-826.427) [-824.023] (-824.735) -- 0:00:15
753000 -- (-827.844) [-826.102] (-830.090) (-827.656) * (-824.443) (-827.604) [-824.013] (-825.676) -- 0:00:15
753500 -- (-825.543) (-825.889) (-825.212) [-827.241] * (-825.271) (-827.791) [-824.014] (-824.426) -- 0:00:15
754000 -- (-825.284) [-824.204] (-826.179) (-826.290) * [-825.106] (-827.774) (-826.968) (-825.064) -- 0:00:15
754500 -- [-826.716] (-824.954) (-828.533) (-827.018) * (-824.623) (-824.848) (-827.631) [-826.685] -- 0:00:14
755000 -- (-826.437) [-826.254] (-827.015) (-831.080) * (-825.474) (-828.807) [-832.558] (-825.626) -- 0:00:14
Average standard deviation of split frequencies: 0.004157
755500 -- (-829.572) (-826.214) [-826.963] (-826.585) * [-824.482] (-826.485) (-824.063) (-824.829) -- 0:00:14
756000 -- (-824.731) [-827.967] (-828.423) (-825.470) * (-824.119) (-825.149) [-826.109] (-826.450) -- 0:00:14
756500 -- (-825.338) (-825.778) (-827.674) [-825.407] * (-830.540) (-830.038) [-827.581] (-826.775) -- 0:00:14
757000 -- (-825.010) (-826.841) [-826.046] (-824.354) * (-826.883) [-829.633] (-826.317) (-824.824) -- 0:00:14
757500 -- (-825.438) (-825.813) [-826.809] (-824.765) * (-827.492) (-826.970) [-825.995] (-827.293) -- 0:00:14
758000 -- [-826.700] (-832.779) (-825.221) (-826.139) * [-826.264] (-825.763) (-827.765) (-826.446) -- 0:00:14
758500 -- (-826.818) [-828.128] (-826.440) (-826.667) * (-825.366) (-830.590) (-830.480) [-825.046] -- 0:00:14
759000 -- [-826.742] (-826.074) (-825.249) (-825.696) * (-826.244) [-826.299] (-829.199) (-826.378) -- 0:00:14
759500 -- (-829.041) [-824.230] (-825.869) (-824.134) * (-830.215) (-825.094) [-824.980] (-827.761) -- 0:00:14
760000 -- (-825.450) (-826.143) [-824.069] (-829.053) * (-827.852) [-825.235] (-824.406) (-826.602) -- 0:00:14
Average standard deviation of split frequencies: 0.004421
760500 -- [-824.425] (-825.334) (-830.006) (-828.040) * [-828.736] (-830.727) (-825.924) (-825.323) -- 0:00:14
761000 -- (-830.697) (-824.879) [-826.778] (-827.048) * (-824.578) [-827.042] (-825.518) (-827.176) -- 0:00:14
761500 -- (-826.320) (-829.017) [-826.770] (-826.295) * (-824.576) (-828.989) (-827.311) [-829.436] -- 0:00:14
762000 -- [-824.799] (-830.853) (-828.685) (-830.517) * (-828.492) [-824.018] (-834.241) (-827.786) -- 0:00:14
762500 -- [-825.475] (-824.129) (-825.347) (-823.892) * (-828.105) [-825.094] (-825.696) (-825.517) -- 0:00:14
763000 -- [-825.732] (-824.138) (-825.007) (-824.561) * (-827.301) [-826.573] (-825.726) (-827.737) -- 0:00:14
763500 -- (-825.721) (-827.577) (-829.411) [-824.682] * (-826.001) (-824.232) (-828.681) [-827.932] -- 0:00:14
764000 -- (-824.485) [-824.398] (-828.824) (-825.507) * (-832.468) (-826.309) (-830.546) [-828.501] -- 0:00:14
764500 -- (-825.965) (-825.276) [-824.211] (-827.290) * (-825.780) (-827.984) [-826.364] (-826.415) -- 0:00:14
765000 -- (-830.292) (-828.898) [-826.118] (-829.004) * (-824.420) (-826.754) [-827.505] (-824.937) -- 0:00:14
Average standard deviation of split frequencies: 0.004039
765500 -- (-830.221) [-824.737] (-828.775) (-831.084) * (-826.974) (-827.255) [-830.383] (-825.162) -- 0:00:14
766000 -- (-824.630) (-825.748) [-826.117] (-826.319) * (-828.272) [-826.901] (-825.489) (-824.964) -- 0:00:14
766500 -- (-825.006) (-825.463) (-825.668) [-829.664] * (-825.006) (-827.498) (-825.296) [-823.955] -- 0:00:14
767000 -- (-825.861) [-824.807] (-824.098) (-827.364) * [-826.154] (-828.590) (-826.977) (-824.510) -- 0:00:14
767500 -- (-825.150) (-826.245) [-823.898] (-827.929) * [-827.302] (-828.543) (-824.679) (-826.572) -- 0:00:14
768000 -- (-824.930) (-826.856) [-824.723] (-825.647) * [-826.788] (-828.835) (-825.009) (-824.918) -- 0:00:14
768500 -- (-828.453) (-824.349) [-825.808] (-827.916) * (-827.394) [-825.800] (-826.971) (-825.162) -- 0:00:14
769000 -- (-829.416) (-826.354) (-826.959) [-826.213] * [-824.672] (-830.194) (-825.230) (-826.606) -- 0:00:14
769500 -- (-825.221) [-827.147] (-830.033) (-825.072) * (-824.940) [-826.071] (-825.174) (-828.015) -- 0:00:14
770000 -- (-825.316) (-826.279) (-824.028) [-824.906] * [-826.161] (-827.140) (-824.309) (-825.644) -- 0:00:14
Average standard deviation of split frequencies: 0.004037
770500 -- [-826.223] (-825.376) (-825.890) (-824.897) * [-824.734] (-825.486) (-824.958) (-827.060) -- 0:00:13
771000 -- [-828.240] (-832.419) (-825.960) (-824.187) * (-827.488) [-825.275] (-830.092) (-826.154) -- 0:00:13
771500 -- (-825.725) (-828.170) [-827.888] (-826.207) * (-826.675) (-826.029) (-832.648) [-825.713] -- 0:00:13
772000 -- [-825.610] (-828.014) (-826.173) (-827.684) * (-825.543) (-827.819) (-827.676) [-824.829] -- 0:00:13
772500 -- (-827.987) [-829.462] (-828.782) (-826.590) * [-830.252] (-826.158) (-826.061) (-826.808) -- 0:00:13
773000 -- (-825.122) [-825.378] (-831.143) (-827.656) * [-825.142] (-826.029) (-825.708) (-827.213) -- 0:00:13
773500 -- (-825.371) [-824.633] (-825.008) (-831.751) * (-825.953) (-824.091) (-827.405) [-827.607] -- 0:00:13
774000 -- (-830.009) [-825.412] (-824.289) (-825.498) * [-824.631] (-827.404) (-825.437) (-826.327) -- 0:00:13
774500 -- (-824.783) [-824.894] (-825.530) (-826.104) * (-827.587) (-825.733) (-828.866) [-824.780] -- 0:00:13
775000 -- (-823.968) [-824.447] (-824.472) (-824.239) * (-825.320) [-825.112] (-826.315) (-826.226) -- 0:00:13
Average standard deviation of split frequencies: 0.004252
775500 -- (-827.985) (-830.130) [-824.948] (-830.086) * (-826.766) [-825.372] (-825.401) (-826.321) -- 0:00:13
776000 -- (-824.249) [-826.168] (-824.575) (-826.241) * (-826.397) [-827.241] (-827.037) (-824.734) -- 0:00:13
776500 -- (-824.473) (-824.829) [-827.279] (-827.612) * (-827.139) (-827.177) (-825.170) [-824.434] -- 0:00:13
777000 -- [-829.836] (-824.661) (-829.724) (-827.306) * (-824.788) (-829.238) [-824.836] (-826.256) -- 0:00:13
777500 -- (-826.925) [-824.625] (-825.655) (-826.481) * [-828.222] (-827.124) (-827.171) (-825.673) -- 0:00:13
778000 -- (-826.236) (-827.187) [-826.149] (-826.378) * [-824.775] (-825.813) (-825.352) (-825.499) -- 0:00:13
778500 -- (-826.058) (-826.138) [-826.191] (-824.459) * (-826.549) [-825.558] (-827.046) (-827.836) -- 0:00:13
779000 -- [-827.705] (-824.433) (-827.449) (-828.268) * (-825.789) (-824.805) [-824.730] (-828.510) -- 0:00:13
779500 -- (-831.797) (-825.069) (-827.510) [-827.634] * (-824.851) [-826.601] (-827.825) (-825.091) -- 0:00:13
780000 -- (-825.058) (-825.603) (-826.501) [-827.480] * (-825.757) (-824.245) (-826.690) [-825.241] -- 0:00:13
Average standard deviation of split frequencies: 0.004307
780500 -- (-825.931) (-828.613) [-827.779] (-825.146) * (-828.538) [-824.569] (-825.246) (-825.323) -- 0:00:13
781000 -- [-827.768] (-827.491) (-832.222) (-827.051) * [-825.342] (-826.657) (-825.716) (-828.755) -- 0:00:13
781500 -- [-825.322] (-825.519) (-828.564) (-825.155) * [-826.823] (-825.492) (-828.009) (-827.133) -- 0:00:13
782000 -- [-825.073] (-828.434) (-829.216) (-825.819) * (-825.048) (-824.968) (-827.622) [-825.327] -- 0:00:13
782500 -- (-827.608) (-825.878) (-825.585) [-825.144] * (-824.961) (-825.228) (-824.769) [-826.934] -- 0:00:13
783000 -- [-826.703] (-824.095) (-827.004) (-825.615) * [-826.587] (-827.977) (-828.857) (-828.138) -- 0:00:13
783500 -- (-824.653) (-824.822) (-826.266) [-827.575] * (-825.616) (-825.554) (-824.910) [-825.683] -- 0:00:13
784000 -- (-827.956) (-828.497) (-827.155) [-827.034] * [-825.725] (-825.372) (-824.692) (-829.096) -- 0:00:13
784500 -- (-826.528) (-831.168) (-832.223) [-827.174] * [-829.711] (-830.320) (-827.189) (-826.590) -- 0:00:13
785000 -- (-824.305) (-828.729) [-827.660] (-827.635) * [-827.238] (-826.359) (-825.994) (-826.663) -- 0:00:13
Average standard deviation of split frequencies: 0.004638
785500 -- (-829.081) (-825.837) [-826.161] (-828.164) * [-825.968] (-824.980) (-824.957) (-824.613) -- 0:00:13
786000 -- [-825.377] (-824.789) (-826.100) (-826.984) * (-825.496) (-825.925) [-827.692] (-826.042) -- 0:00:13
786500 -- (-824.853) (-829.664) [-827.754] (-826.602) * [-826.707] (-826.605) (-826.670) (-824.232) -- 0:00:13
787000 -- (-826.042) [-826.826] (-826.723) (-826.027) * (-826.291) [-826.377] (-833.428) (-827.652) -- 0:00:12
787500 -- (-827.215) (-826.929) [-826.085] (-826.100) * [-827.815] (-827.860) (-829.360) (-825.326) -- 0:00:12
788000 -- (-827.351) (-826.819) (-824.926) [-825.464] * (-828.341) [-834.901] (-827.242) (-825.892) -- 0:00:12
788500 -- (-827.860) (-829.344) (-825.093) [-823.822] * (-831.620) [-827.419] (-824.552) (-825.189) -- 0:00:12
789000 -- [-826.608] (-828.574) (-826.964) (-824.416) * [-831.007] (-824.685) (-826.105) (-824.770) -- 0:00:12
789500 -- [-826.526] (-829.122) (-826.549) (-828.681) * (-829.281) (-825.550) (-824.108) [-824.956] -- 0:00:12
790000 -- (-824.563) (-824.099) [-826.686] (-829.264) * (-825.450) (-828.774) (-824.681) [-825.951] -- 0:00:12
Average standard deviation of split frequencies: 0.004730
790500 -- (-824.759) [-826.354] (-828.269) (-824.477) * (-827.126) [-826.117] (-824.374) (-829.168) -- 0:00:12
791000 -- (-825.435) [-826.685] (-826.873) (-825.845) * (-826.706) (-828.423) (-824.338) [-825.629] -- 0:00:12
791500 -- (-826.450) (-828.843) [-828.233] (-826.953) * (-825.214) (-825.731) [-824.191] (-832.240) -- 0:00:12
792000 -- (-829.166) (-825.486) [-825.864] (-825.313) * (-824.659) (-825.404) [-826.480] (-830.910) -- 0:00:12
792500 -- (-825.757) (-825.177) [-826.533] (-827.316) * (-825.501) [-825.674] (-825.504) (-826.014) -- 0:00:12
793000 -- [-828.797] (-825.767) (-829.779) (-827.618) * (-824.881) (-829.679) [-825.815] (-828.238) -- 0:00:12
793500 -- (-828.855) [-826.981] (-826.867) (-825.051) * [-825.127] (-829.667) (-826.014) (-830.841) -- 0:00:12
794000 -- (-826.791) (-826.334) [-826.351] (-825.391) * (-826.873) (-824.601) (-827.403) [-825.573] -- 0:00:12
794500 -- (-825.664) (-826.045) (-827.341) [-824.660] * [-828.649] (-826.281) (-828.547) (-824.588) -- 0:00:12
795000 -- [-826.824] (-826.306) (-825.634) (-825.378) * (-825.288) (-826.536) [-828.547] (-827.798) -- 0:00:12
Average standard deviation of split frequencies: 0.004817
795500 -- (-826.610) (-826.520) (-825.399) [-823.961] * (-826.964) [-825.001] (-827.230) (-825.701) -- 0:00:12
796000 -- (-826.838) (-827.968) [-825.723] (-824.302) * (-825.091) (-827.847) [-826.729] (-825.913) -- 0:00:12
796500 -- [-827.057] (-828.867) (-825.919) (-825.915) * (-825.056) [-828.137] (-826.334) (-827.291) -- 0:00:12
797000 -- (-827.105) (-826.491) (-824.655) [-825.481] * [-826.841] (-827.615) (-825.359) (-825.249) -- 0:00:12
797500 -- (-824.719) (-826.949) (-827.653) [-824.487] * (-825.267) (-830.553) [-826.244] (-824.172) -- 0:00:12
798000 -- (-827.634) (-828.308) [-825.934] (-825.796) * (-824.717) (-827.276) (-827.606) [-825.292] -- 0:00:12
798500 -- (-828.133) [-826.455] (-824.902) (-827.215) * [-825.434] (-832.291) (-826.426) (-826.147) -- 0:00:12
799000 -- (-828.656) (-824.938) [-825.912] (-827.513) * [-827.027] (-826.240) (-825.022) (-826.334) -- 0:00:12
799500 -- (-828.037) [-826.678] (-830.077) (-824.759) * (-825.693) [-826.613] (-825.047) (-827.563) -- 0:00:12
800000 -- (-826.152) (-827.257) [-824.871] (-824.804) * (-827.949) (-825.378) [-824.914] (-827.539) -- 0:00:12
Average standard deviation of split frequencies: 0.005142
800500 -- (-824.888) (-827.600) [-827.503] (-825.669) * (-824.995) [-826.391] (-824.966) (-826.671) -- 0:00:12
801000 -- [-825.369] (-825.670) (-826.209) (-833.384) * (-823.859) (-826.494) (-826.170) [-825.474] -- 0:00:12
801500 -- (-825.726) [-825.853] (-826.908) (-829.053) * (-823.951) (-825.725) (-826.584) [-825.898] -- 0:00:12
802000 -- (-825.081) (-826.060) [-825.936] (-826.780) * (-825.894) (-827.146) (-828.814) [-825.923] -- 0:00:12
802500 -- (-828.210) (-827.531) (-825.932) [-825.938] * (-824.933) [-827.856] (-826.612) (-830.731) -- 0:00:12
803000 -- (-827.123) (-825.880) [-826.475] (-826.109) * (-826.385) [-825.212] (-828.710) (-831.736) -- 0:00:12
803500 -- (-827.940) (-827.298) [-826.151] (-824.895) * (-826.189) (-825.586) [-827.715] (-825.800) -- 0:00:11
804000 -- (-828.514) (-827.507) [-824.902] (-823.945) * (-826.149) (-826.090) [-826.120] (-825.613) -- 0:00:11
804500 -- (-826.178) (-826.221) [-826.932] (-828.876) * (-825.548) (-826.804) (-824.887) [-825.654] -- 0:00:11
805000 -- (-825.879) (-826.485) (-825.558) [-824.937] * [-825.266] (-825.467) (-826.720) (-827.780) -- 0:00:11
Average standard deviation of split frequencies: 0.005556
805500 -- [-825.363] (-825.277) (-827.303) (-830.309) * [-825.839] (-827.401) (-831.071) (-830.242) -- 0:00:11
806000 -- [-824.875] (-827.129) (-826.949) (-827.627) * (-824.517) [-828.713] (-828.611) (-826.277) -- 0:00:11
806500 -- [-824.639] (-824.881) (-827.656) (-826.236) * [-826.811] (-829.175) (-826.046) (-827.208) -- 0:00:11
807000 -- (-825.985) [-829.600] (-829.785) (-825.521) * (-825.832) [-829.497] (-829.000) (-826.967) -- 0:00:11
807500 -- [-824.658] (-827.547) (-831.512) (-827.338) * (-825.702) (-827.921) (-827.723) [-825.494] -- 0:00:11
808000 -- [-830.599] (-824.238) (-829.539) (-824.790) * (-824.864) [-825.295] (-826.927) (-824.764) -- 0:00:11
808500 -- (-826.168) [-827.241] (-824.118) (-824.909) * [-826.530] (-825.764) (-828.112) (-824.795) -- 0:00:11
809000 -- (-825.365) (-829.263) (-825.967) [-828.513] * [-824.803] (-826.093) (-825.653) (-824.706) -- 0:00:11
809500 -- (-824.585) (-827.258) (-829.009) [-826.112] * (-828.247) (-824.756) (-829.316) [-828.069] -- 0:00:11
810000 -- [-824.120] (-829.673) (-827.502) (-824.828) * [-823.967] (-826.102) (-826.444) (-828.162) -- 0:00:11
Average standard deviation of split frequencies: 0.004730
810500 -- [-824.117] (-826.393) (-824.786) (-828.164) * (-825.839) (-828.656) (-826.849) [-826.305] -- 0:00:11
811000 -- [-829.156] (-824.595) (-825.244) (-827.602) * (-825.138) [-827.890] (-827.323) (-824.750) -- 0:00:11
811500 -- (-827.205) [-826.113] (-826.420) (-828.936) * (-829.914) [-826.677] (-826.500) (-824.302) -- 0:00:11
812000 -- [-825.498] (-823.931) (-826.627) (-828.230) * (-827.167) (-827.156) [-827.682] (-826.369) -- 0:00:11
812500 -- (-826.562) [-824.916] (-831.042) (-825.546) * (-827.192) [-826.639] (-828.403) (-825.434) -- 0:00:11
813000 -- (-827.067) (-824.870) [-829.524] (-828.198) * (-828.952) [-826.510] (-829.328) (-825.604) -- 0:00:11
813500 -- [-825.204] (-825.840) (-824.832) (-825.724) * (-826.073) (-824.841) (-824.472) [-825.760] -- 0:00:11
814000 -- (-827.608) (-824.179) [-824.894] (-825.405) * (-825.637) (-824.372) (-826.421) [-825.614] -- 0:00:11
814500 -- (-827.561) (-824.509) [-830.088] (-826.236) * (-827.264) [-824.597] (-826.819) (-825.503) -- 0:00:11
815000 -- (-827.524) [-826.095] (-824.888) (-824.903) * (-825.364) (-824.867) (-825.270) [-825.354] -- 0:00:11
Average standard deviation of split frequencies: 0.005235
815500 -- (-827.089) (-824.361) (-828.725) [-826.285] * (-825.372) (-825.493) [-830.486] (-825.320) -- 0:00:11
816000 -- (-824.821) [-824.364] (-832.537) (-825.623) * (-826.972) [-826.988] (-826.495) (-828.039) -- 0:00:11
816500 -- (-824.974) [-824.013] (-826.657) (-833.000) * (-824.570) [-826.598] (-826.584) (-824.324) -- 0:00:11
817000 -- (-828.315) (-825.196) (-826.734) [-826.568] * [-825.097] (-825.171) (-824.008) (-829.554) -- 0:00:11
817500 -- (-829.949) [-824.215] (-827.421) (-825.941) * [-824.089] (-825.053) (-824.155) (-828.271) -- 0:00:11
818000 -- (-832.584) [-824.213] (-826.775) (-828.238) * (-824.669) (-826.267) [-825.224] (-832.658) -- 0:00:11
818500 -- (-828.965) (-826.010) [-826.558] (-825.238) * [-825.242] (-827.180) (-825.934) (-825.775) -- 0:00:11
819000 -- (-824.368) (-826.011) [-824.875] (-825.756) * (-827.208) (-825.291) (-825.827) [-825.621] -- 0:00:11
819500 -- [-825.325] (-826.894) (-825.610) (-823.756) * (-827.515) [-825.008] (-827.176) (-826.440) -- 0:00:11
820000 -- [-825.757] (-825.206) (-826.287) (-824.733) * (-832.825) [-829.800] (-829.000) (-825.850) -- 0:00:10
Average standard deviation of split frequencies: 0.004863
820500 -- (-825.468) (-824.905) (-825.887) [-825.718] * (-829.238) [-825.489] (-828.673) (-825.480) -- 0:00:10
821000 -- (-826.350) (-824.157) [-826.048] (-828.343) * [-824.601] (-825.740) (-827.455) (-828.832) -- 0:00:10
821500 -- (-824.770) [-824.957] (-826.059) (-827.236) * (-825.103) (-825.113) [-825.510] (-826.848) -- 0:00:10
822000 -- (-824.914) [-825.735] (-826.367) (-824.516) * [-825.523] (-825.590) (-824.609) (-825.335) -- 0:00:10
822500 -- (-827.897) [-825.452] (-828.780) (-828.081) * [-827.117] (-824.158) (-826.282) (-824.506) -- 0:00:10
823000 -- (-828.023) (-827.577) [-828.284] (-825.928) * (-826.640) [-825.232] (-825.277) (-825.084) -- 0:00:10
823500 -- (-826.095) [-824.467] (-826.752) (-825.337) * (-828.331) (-825.041) [-826.706] (-826.259) -- 0:00:10
824000 -- [-826.154] (-825.173) (-824.845) (-825.864) * (-825.044) (-827.628) [-826.426] (-825.352) -- 0:00:10
824500 -- (-825.584) [-826.541] (-824.709) (-826.040) * (-826.214) (-830.511) (-825.571) [-825.203] -- 0:00:10
825000 -- [-826.442] (-826.239) (-824.164) (-826.909) * (-825.884) (-824.896) [-824.191] (-826.411) -- 0:00:10
Average standard deviation of split frequencies: 0.005778
825500 -- (-831.209) (-826.185) (-826.492) [-824.633] * (-826.432) (-825.844) (-825.696) [-826.302] -- 0:00:10
826000 -- (-828.950) [-826.511] (-824.720) (-825.186) * (-825.355) (-827.379) (-825.651) [-824.639] -- 0:00:10
826500 -- (-828.978) (-828.487) (-826.827) [-825.796] * [-824.659] (-828.662) (-826.617) (-824.960) -- 0:00:10
827000 -- (-824.790) [-826.259] (-827.857) (-824.718) * (-830.556) (-828.357) [-825.565] (-825.243) -- 0:00:10
827500 -- (-824.243) (-824.138) [-825.898] (-824.197) * (-824.133) [-829.480] (-825.573) (-825.393) -- 0:00:10
828000 -- (-826.889) [-827.818] (-830.864) (-824.269) * [-824.317] (-826.120) (-825.574) (-825.927) -- 0:00:10
828500 -- [-824.157] (-826.278) (-827.458) (-826.275) * (-826.646) [-827.392] (-827.319) (-826.277) -- 0:00:10
829000 -- (-824.422) [-829.772] (-825.932) (-829.094) * [-826.076] (-829.586) (-825.422) (-825.506) -- 0:00:10
829500 -- (-824.565) (-828.581) [-826.513] (-830.129) * (-826.380) [-828.872] (-826.317) (-829.353) -- 0:00:10
830000 -- (-828.257) (-825.957) [-826.719] (-824.224) * (-828.339) [-827.660] (-830.777) (-824.841) -- 0:00:10
Average standard deviation of split frequencies: 0.005781
830500 -- (-826.802) (-830.504) [-826.030] (-828.197) * (-827.264) [-827.077] (-830.252) (-825.013) -- 0:00:10
831000 -- (-827.396) [-826.364] (-828.613) (-827.360) * [-825.758] (-826.056) (-827.778) (-824.758) -- 0:00:10
831500 -- (-824.628) [-826.428] (-824.574) (-827.332) * [-825.845] (-826.045) (-827.877) (-828.676) -- 0:00:10
832000 -- (-824.177) (-825.054) (-826.535) [-827.815] * [-824.599] (-827.060) (-827.261) (-824.196) -- 0:00:10
832500 -- (-823.959) (-829.130) (-826.923) [-827.613] * (-825.868) (-824.723) (-828.373) [-824.964] -- 0:00:10
833000 -- (-824.623) (-829.243) (-829.567) [-824.314] * [-824.755] (-828.567) (-826.257) (-825.470) -- 0:00:10
833500 -- (-824.623) (-826.126) (-824.904) [-825.385] * [-824.686] (-835.785) (-825.460) (-824.707) -- 0:00:10
834000 -- (-825.222) (-824.151) [-826.216] (-832.822) * [-827.742] (-828.195) (-825.534) (-827.308) -- 0:00:10
834500 -- (-825.292) (-824.673) (-824.593) [-829.328] * [-825.049] (-825.581) (-825.325) (-827.122) -- 0:00:10
835000 -- (-826.692) [-824.800] (-825.204) (-825.808) * (-826.756) (-825.407) [-825.580] (-826.635) -- 0:00:10
Average standard deviation of split frequencies: 0.005850
835500 -- (-825.890) (-829.074) (-825.866) [-823.782] * (-825.370) [-825.211] (-830.782) (-827.190) -- 0:00:10
836000 -- [-825.405] (-829.801) (-825.643) (-829.932) * (-827.569) (-823.994) (-831.348) [-825.504] -- 0:00:10
836500 -- (-826.624) (-825.374) [-826.012] (-827.549) * (-826.710) (-829.915) (-831.914) [-826.777] -- 0:00:09
837000 -- [-826.066] (-825.123) (-826.206) (-824.445) * (-828.572) (-829.598) (-826.197) [-830.724] -- 0:00:09
837500 -- (-824.952) (-825.763) [-825.738] (-825.062) * (-827.335) [-825.879] (-830.163) (-827.311) -- 0:00:09
838000 -- (-825.409) [-826.442] (-825.088) (-824.708) * (-827.098) (-824.409) (-825.410) [-827.846] -- 0:00:09
838500 -- (-829.658) (-827.016) (-825.034) [-825.419] * (-826.085) [-827.797] (-825.936) (-824.033) -- 0:00:09
839000 -- (-826.936) [-824.821] (-826.017) (-824.684) * (-824.914) (-830.238) [-824.821] (-824.402) -- 0:00:09
839500 -- (-826.304) [-825.413] (-826.727) (-826.310) * (-824.338) [-825.022] (-824.915) (-825.782) -- 0:00:09
840000 -- [-827.874] (-825.723) (-825.447) (-827.931) * (-826.823) (-828.016) (-825.493) [-825.778] -- 0:00:09
Average standard deviation of split frequencies: 0.005502
840500 -- (-825.119) (-827.609) [-825.008] (-827.413) * (-827.538) (-826.758) [-827.277] (-826.538) -- 0:00:09
841000 -- (-827.220) (-825.643) (-825.814) [-824.592] * (-830.849) (-830.707) (-826.010) [-826.672] -- 0:00:09
841500 -- (-826.263) (-824.917) (-824.398) [-824.703] * (-830.610) [-828.347] (-825.655) (-832.021) -- 0:00:09
842000 -- [-825.266] (-829.803) (-824.236) (-824.653) * (-826.459) (-825.283) (-827.395) [-828.657] -- 0:00:09
842500 -- (-827.853) [-825.278] (-826.909) (-827.492) * (-825.720) (-825.442) (-828.800) [-828.177] -- 0:00:09
843000 -- (-825.674) [-827.699] (-827.491) (-825.573) * (-827.516) (-824.377) (-831.985) [-827.136] -- 0:00:09
843500 -- (-825.279) [-824.431] (-833.286) (-825.013) * (-824.992) (-826.328) (-829.119) [-826.190] -- 0:00:09
844000 -- (-827.314) [-825.635] (-825.409) (-826.778) * [-824.147] (-827.693) (-826.288) (-827.321) -- 0:00:09
844500 -- [-826.727] (-826.030) (-827.706) (-824.507) * (-826.105) (-827.381) (-827.170) [-826.381] -- 0:00:09
845000 -- (-827.138) (-827.690) [-827.261] (-824.703) * (-827.518) (-826.052) [-830.178] (-826.057) -- 0:00:09
Average standard deviation of split frequencies: 0.005433
845500 -- (-826.153) (-831.721) [-824.746] (-824.838) * (-826.362) [-826.007] (-827.923) (-830.035) -- 0:00:09
846000 -- (-827.385) (-826.042) [-824.974] (-827.530) * (-825.485) (-826.885) (-826.764) [-827.755] -- 0:00:09
846500 -- [-827.945] (-826.018) (-825.977) (-825.690) * (-824.162) [-824.972] (-824.749) (-826.788) -- 0:00:09
847000 -- [-824.417] (-827.851) (-824.524) (-825.102) * [-824.969] (-825.888) (-829.714) (-825.874) -- 0:00:09
847500 -- [-825.678] (-828.770) (-824.019) (-824.765) * (-824.362) (-824.774) (-825.624) [-827.846] -- 0:00:09
848000 -- (-824.677) (-828.811) (-826.979) [-824.685] * [-827.906] (-825.484) (-826.283) (-826.455) -- 0:00:09
848500 -- [-827.908] (-829.083) (-824.457) (-824.790) * (-827.776) (-824.934) (-826.773) [-825.600] -- 0:00:09
849000 -- (-826.898) (-826.279) [-824.755] (-824.909) * (-826.159) (-829.088) (-825.037) [-824.124] -- 0:00:09
849500 -- (-828.144) (-826.380) (-828.055) [-826.103] * [-825.903] (-827.148) (-824.728) (-825.334) -- 0:00:09
850000 -- (-829.846) (-827.050) (-824.293) [-826.567] * (-831.085) (-827.444) (-824.659) [-825.619] -- 0:00:09
Average standard deviation of split frequencies: 0.005611
850500 -- (-826.824) [-830.496] (-826.712) (-828.414) * [-824.997] (-824.775) (-824.538) (-829.522) -- 0:00:09
851000 -- (-824.956) (-825.587) (-825.497) [-825.717] * [-824.639] (-826.848) (-826.653) (-824.702) -- 0:00:09
851500 -- (-825.662) (-824.719) [-825.893] (-824.383) * (-825.306) (-831.246) (-827.408) [-824.669] -- 0:00:09
852000 -- (-825.444) [-824.324] (-826.241) (-825.452) * (-825.267) [-827.423] (-829.020) (-827.857) -- 0:00:09
852500 -- (-826.083) (-825.422) (-825.772) [-824.690] * (-827.100) (-824.777) (-824.974) [-825.836] -- 0:00:08
853000 -- (-826.507) (-825.272) (-825.232) [-827.607] * (-824.893) (-826.655) [-825.824] (-826.701) -- 0:00:08
853500 -- (-824.729) (-825.081) (-825.982) [-825.751] * (-826.875) [-826.426] (-828.478) (-827.412) -- 0:00:08
854000 -- (-824.287) (-824.948) [-828.311] (-824.767) * (-824.792) (-825.123) (-826.851) [-823.771] -- 0:00:08
854500 -- (-827.581) (-825.709) [-826.406] (-826.912) * (-824.910) [-829.598] (-826.195) (-829.422) -- 0:00:08
855000 -- (-827.054) [-825.414] (-826.113) (-825.697) * (-824.995) [-830.680] (-828.162) (-830.563) -- 0:00:08
Average standard deviation of split frequencies: 0.005369
855500 -- (-826.379) (-828.417) (-825.246) [-825.706] * (-826.406) [-826.125] (-828.231) (-826.513) -- 0:00:08
856000 -- (-825.122) (-826.308) [-831.534] (-825.564) * (-825.853) [-827.321] (-830.738) (-826.500) -- 0:00:08
856500 -- [-825.716] (-828.131) (-828.149) (-830.625) * (-825.761) [-827.865] (-832.126) (-825.452) -- 0:00:08
857000 -- (-826.300) (-827.984) (-829.436) [-826.945] * (-824.884) [-828.551] (-829.456) (-824.591) -- 0:00:08
857500 -- (-823.952) (-828.619) (-826.504) [-825.245] * (-827.933) (-824.564) [-826.061] (-824.251) -- 0:00:08
858000 -- (-826.277) (-824.959) (-825.944) [-824.591] * [-825.352] (-825.287) (-825.253) (-826.455) -- 0:00:08
858500 -- (-825.403) (-825.254) [-826.713] (-824.175) * [-824.160] (-824.025) (-827.627) (-836.452) -- 0:00:08
859000 -- [-826.943] (-825.130) (-825.175) (-827.068) * (-824.168) [-824.253] (-826.542) (-824.718) -- 0:00:08
859500 -- (-826.784) (-825.961) (-826.268) [-827.058] * (-825.532) (-825.198) [-828.448] (-828.466) -- 0:00:08
860000 -- (-825.823) [-829.506] (-826.666) (-824.689) * (-824.444) [-826.537] (-826.184) (-827.278) -- 0:00:08
Average standard deviation of split frequencies: 0.005409
860500 -- (-824.056) [-824.472] (-823.863) (-827.450) * [-824.205] (-826.666) (-826.390) (-828.037) -- 0:00:08
861000 -- [-825.714] (-825.250) (-830.514) (-827.279) * (-825.033) (-827.529) [-824.218] (-827.175) -- 0:00:08
861500 -- (-826.106) [-824.706] (-826.087) (-828.587) * [-830.406] (-826.348) (-823.946) (-825.757) -- 0:00:08
862000 -- (-824.313) (-826.740) (-827.268) [-824.551] * (-828.210) (-824.991) (-824.081) [-827.467] -- 0:00:08
862500 -- (-827.803) [-824.035] (-827.003) (-827.485) * (-829.129) (-825.847) (-826.318) [-829.813] -- 0:00:08
863000 -- (-824.808) (-824.980) (-831.744) [-827.600] * (-826.905) [-825.837] (-824.033) (-824.944) -- 0:00:08
863500 -- (-824.783) (-824.069) (-825.884) [-828.294] * [-825.203] (-824.808) (-824.574) (-825.808) -- 0:00:08
864000 -- [-828.524] (-824.027) (-825.450) (-827.366) * (-826.686) (-826.489) [-828.131] (-827.404) -- 0:00:08
864500 -- [-827.286] (-826.162) (-826.374) (-825.043) * (-824.810) [-829.308] (-826.479) (-830.640) -- 0:00:08
865000 -- [-825.739] (-825.263) (-827.794) (-830.702) * (-826.136) [-825.715] (-826.839) (-824.568) -- 0:00:08
Average standard deviation of split frequencies: 0.005103
865500 -- (-828.048) (-824.725) (-830.381) [-827.738] * (-829.161) [-824.388] (-827.522) (-824.572) -- 0:00:08
866000 -- (-824.691) [-825.024] (-831.720) (-827.608) * (-826.087) (-827.609) (-826.773) [-827.570] -- 0:00:08
866500 -- [-827.721] (-826.200) (-824.839) (-825.177) * (-826.165) (-826.763) (-828.025) [-825.374] -- 0:00:08
867000 -- (-827.619) [-824.953] (-825.431) (-825.988) * (-827.721) (-827.169) [-825.715] (-825.509) -- 0:00:08
867500 -- [-823.904] (-829.797) (-826.667) (-825.253) * (-824.825) (-826.293) (-827.644) [-824.842] -- 0:00:08
868000 -- (-829.649) [-826.165] (-824.789) (-826.410) * (-825.117) [-824.224] (-825.344) (-826.005) -- 0:00:08
868500 -- (-825.691) (-827.358) (-826.253) [-824.616] * [-827.991] (-832.565) (-824.713) (-826.236) -- 0:00:08
869000 -- [-825.103] (-827.132) (-827.717) (-826.320) * (-824.249) (-829.290) [-824.552] (-825.802) -- 0:00:07
869500 -- (-827.716) (-826.080) (-825.837) [-826.172] * (-828.818) (-827.176) [-825.472] (-827.236) -- 0:00:07
870000 -- [-826.615] (-825.836) (-825.085) (-827.889) * (-827.318) (-826.756) (-825.692) [-825.358] -- 0:00:07
Average standard deviation of split frequencies: 0.005211
870500 -- (-826.851) [-829.931] (-828.221) (-829.746) * (-824.649) (-828.520) [-830.138] (-826.329) -- 0:00:07
871000 -- (-824.926) (-828.505) [-826.701] (-826.985) * (-823.998) (-828.387) [-826.628] (-827.965) -- 0:00:07
871500 -- [-828.018] (-827.481) (-824.622) (-824.370) * (-825.525) [-825.230] (-825.880) (-825.510) -- 0:00:07
872000 -- (-825.698) (-824.750) (-826.367) [-825.599] * [-825.058] (-826.898) (-824.951) (-828.462) -- 0:00:07
872500 -- [-824.697] (-826.610) (-828.280) (-825.255) * (-824.233) (-827.502) [-826.023] (-825.480) -- 0:00:07
873000 -- [-824.431] (-824.144) (-827.790) (-832.928) * [-828.578] (-826.973) (-825.984) (-825.717) -- 0:00:07
873500 -- (-828.148) [-827.573] (-828.256) (-826.282) * (-828.595) (-825.746) (-826.391) [-829.493] -- 0:00:07
874000 -- (-828.780) (-836.511) [-825.159] (-826.791) * (-827.797) (-826.004) (-825.355) [-825.547] -- 0:00:07
874500 -- (-827.234) (-825.586) [-825.846] (-828.655) * (-828.454) (-824.660) (-825.236) [-826.733] -- 0:00:07
875000 -- (-825.165) (-830.247) (-827.624) [-824.408] * (-825.067) [-824.735] (-824.036) (-828.919) -- 0:00:07
Average standard deviation of split frequencies: 0.005146
875500 -- (-825.359) [-824.713] (-827.422) (-824.174) * (-826.463) (-825.277) (-824.319) [-827.554] -- 0:00:07
876000 -- (-826.567) (-826.211) [-826.082] (-825.612) * (-825.995) (-826.554) (-824.864) [-830.960] -- 0:00:07
876500 -- (-825.092) (-824.324) (-826.730) [-825.314] * [-824.717] (-826.500) (-824.887) (-832.889) -- 0:00:07
877000 -- (-824.281) (-825.688) [-826.611] (-824.288) * (-825.838) (-827.777) [-825.628] (-827.460) -- 0:00:07
877500 -- (-827.075) (-827.676) (-828.405) [-824.119] * [-825.515] (-826.892) (-824.731) (-826.050) -- 0:00:07
878000 -- [-825.044] (-826.481) (-833.432) (-824.526) * (-825.834) (-825.700) (-824.973) [-828.337] -- 0:00:07
878500 -- (-825.031) (-826.821) (-825.195) [-826.671] * (-824.063) [-825.942] (-831.285) (-824.965) -- 0:00:07
879000 -- [-824.687] (-825.615) (-832.072) (-825.527) * [-824.218] (-829.460) (-831.658) (-824.483) -- 0:00:07
879500 -- (-824.848) [-827.116] (-828.018) (-824.748) * (-828.151) [-824.701] (-829.590) (-829.384) -- 0:00:07
880000 -- (-830.218) (-828.596) [-828.075] (-824.287) * [-824.529] (-825.203) (-825.676) (-829.591) -- 0:00:07
Average standard deviation of split frequencies: 0.005219
880500 -- (-824.327) [-826.772] (-829.935) (-825.000) * [-824.587] (-825.583) (-826.727) (-829.392) -- 0:00:07
881000 -- (-825.572) (-826.159) (-826.895) [-825.777] * [-825.423] (-827.755) (-828.684) (-829.120) -- 0:00:07
881500 -- (-825.322) (-824.885) (-827.526) [-826.914] * (-824.695) (-825.167) [-826.380] (-825.566) -- 0:00:07
882000 -- (-824.563) (-824.558) (-826.373) [-824.855] * (-828.538) (-825.028) [-826.323] (-824.769) -- 0:00:07
882500 -- [-824.154] (-824.298) (-825.251) (-824.150) * (-826.721) (-825.162) (-824.701) [-824.108] -- 0:00:07
883000 -- (-828.984) (-825.549) [-825.355] (-824.149) * (-825.536) (-825.610) (-826.174) [-825.976] -- 0:00:07
883500 -- [-824.001] (-824.933) (-825.880) (-827.324) * (-826.735) (-825.091) [-831.513] (-827.299) -- 0:00:07
884000 -- [-824.893] (-826.279) (-826.010) (-826.603) * (-826.060) [-824.992] (-826.513) (-827.236) -- 0:00:07
884500 -- (-824.923) (-827.155) [-826.419] (-826.093) * [-824.408] (-829.682) (-825.720) (-824.748) -- 0:00:07
885000 -- (-826.557) [-825.940] (-830.209) (-824.278) * (-825.404) (-824.397) [-830.207] (-824.826) -- 0:00:07
Average standard deviation of split frequencies: 0.004855
885500 -- (-825.389) (-826.618) [-825.109] (-825.734) * (-830.602) (-824.441) (-825.743) [-825.909] -- 0:00:06
886000 -- [-825.362] (-826.807) (-824.566) (-826.446) * [-826.606] (-829.136) (-828.396) (-829.415) -- 0:00:06
886500 -- (-824.315) [-827.970] (-825.370) (-824.642) * [-826.465] (-826.813) (-826.897) (-834.320) -- 0:00:06
887000 -- (-824.259) (-826.874) (-825.808) [-824.144] * [-825.098] (-824.491) (-826.310) (-827.643) -- 0:00:06
887500 -- (-824.952) (-825.690) (-827.411) [-826.780] * [-824.817] (-824.676) (-825.587) (-828.306) -- 0:00:06
888000 -- (-825.256) (-826.868) (-824.599) [-827.263] * (-825.026) (-825.312) (-827.474) [-826.935] -- 0:00:06
888500 -- (-827.054) (-825.406) [-827.152] (-824.464) * (-825.793) [-827.258] (-826.002) (-824.418) -- 0:00:06
889000 -- (-826.782) [-824.541] (-825.543) (-825.976) * [-826.293] (-827.499) (-825.032) (-824.563) -- 0:00:06
889500 -- (-829.922) (-825.437) (-826.849) [-825.272] * [-824.734] (-825.548) (-825.901) (-824.720) -- 0:00:06
890000 -- (-824.572) [-824.397] (-824.244) (-826.238) * (-824.681) [-824.507] (-825.511) (-830.490) -- 0:00:06
Average standard deviation of split frequencies: 0.005160
890500 -- (-830.786) (-828.709) [-824.966] (-826.188) * (-828.020) [-827.812] (-833.434) (-824.312) -- 0:00:06
891000 -- (-824.964) (-829.392) [-826.712] (-826.329) * (-826.602) (-826.737) (-828.836) [-828.021] -- 0:00:06
891500 -- (-827.057) [-824.192] (-826.464) (-824.102) * (-826.732) [-828.674] (-825.334) (-831.436) -- 0:00:06
892000 -- [-829.403] (-825.989) (-831.084) (-827.583) * (-825.132) (-828.848) (-825.092) [-827.049] -- 0:00:06
892500 -- (-827.636) [-825.006] (-830.388) (-824.221) * [-825.736] (-828.720) (-825.159) (-827.818) -- 0:00:06
893000 -- [-828.871] (-825.640) (-828.249) (-824.366) * (-825.113) (-826.476) (-824.361) [-825.570] -- 0:00:06
893500 -- (-825.275) (-824.354) [-826.174] (-825.173) * [-827.080] (-825.862) (-828.486) (-826.498) -- 0:00:06
894000 -- [-827.441] (-825.583) (-824.422) (-825.936) * [-826.359] (-826.565) (-826.107) (-831.013) -- 0:00:06
894500 -- (-826.043) (-827.641) [-824.428] (-825.892) * (-831.422) (-824.974) (-828.877) [-824.638] -- 0:00:06
895000 -- (-824.976) [-826.014] (-824.746) (-827.063) * (-827.486) (-828.488) (-829.153) [-824.374] -- 0:00:06
Average standard deviation of split frequencies: 0.005327
895500 -- (-825.999) (-826.062) (-827.520) [-827.751] * (-825.829) [-825.170] (-829.715) (-825.381) -- 0:00:06
896000 -- [-827.646] (-825.790) (-826.498) (-827.542) * (-827.378) [-824.949] (-827.596) (-833.398) -- 0:00:06
896500 -- [-828.042] (-824.418) (-830.483) (-831.783) * (-827.231) (-825.058) [-826.730] (-826.888) -- 0:00:06
897000 -- (-830.880) (-826.303) [-828.382] (-830.104) * (-827.710) (-826.119) (-828.132) [-827.135] -- 0:00:06
897500 -- [-830.081] (-825.466) (-825.559) (-830.525) * [-824.246] (-825.467) (-826.177) (-827.042) -- 0:00:06
898000 -- (-830.967) (-830.004) [-826.926] (-829.523) * (-824.872) [-825.910] (-825.514) (-827.118) -- 0:00:06
898500 -- (-831.055) [-827.692] (-830.866) (-826.449) * (-824.333) (-825.645) [-826.230] (-826.429) -- 0:00:06
899000 -- (-827.819) (-826.816) (-825.763) [-825.008] * (-827.986) [-825.670] (-826.786) (-825.285) -- 0:00:06
899500 -- [-824.677] (-826.166) (-824.685) (-826.611) * (-827.099) (-827.961) [-827.021] (-825.927) -- 0:00:06
900000 -- (-825.899) [-826.094] (-833.893) (-824.717) * (-827.571) [-825.530] (-824.902) (-825.888) -- 0:00:06
Average standard deviation of split frequencies: 0.004920
900500 -- (-826.883) (-825.483) (-837.890) [-826.483] * (-826.684) (-827.368) [-824.406] (-829.042) -- 0:00:06
901000 -- [-827.987] (-824.487) (-825.113) (-825.320) * (-829.313) (-825.732) [-824.782] (-827.514) -- 0:00:06
901500 -- (-826.970) (-826.198) [-824.871] (-825.107) * (-825.195) (-825.500) [-826.889] (-828.317) -- 0:00:06
902000 -- (-828.922) (-828.585) [-826.668] (-826.861) * (-827.469) (-826.159) [-825.944] (-827.703) -- 0:00:05
902500 -- [-825.972] (-825.716) (-828.373) (-824.481) * (-830.301) [-825.393] (-825.386) (-827.309) -- 0:00:05
903000 -- (-825.607) (-824.737) (-825.259) [-825.139] * (-828.541) [-828.615] (-823.850) (-825.436) -- 0:00:05
903500 -- (-830.604) [-827.374] (-829.686) (-826.293) * (-827.011) (-828.537) (-827.274) [-828.109] -- 0:00:05
904000 -- (-827.727) (-826.557) [-825.422] (-824.502) * (-824.355) (-828.123) [-827.334] (-827.933) -- 0:00:05
904500 -- (-826.011) [-828.038] (-824.970) (-826.208) * (-825.881) (-825.775) (-825.360) [-825.211] -- 0:00:05
905000 -- [-827.632] (-834.396) (-828.048) (-825.657) * [-826.628] (-826.523) (-827.224) (-828.122) -- 0:00:05
Average standard deviation of split frequencies: 0.004718
905500 -- (-824.757) [-825.949] (-825.583) (-829.249) * (-825.320) (-827.306) [-828.703] (-832.119) -- 0:00:05
906000 -- (-826.845) (-825.722) (-825.393) [-825.405] * [-824.871] (-825.123) (-830.116) (-824.861) -- 0:00:05
906500 -- (-827.160) (-830.169) [-828.051] (-825.822) * [-824.748] (-826.028) (-827.489) (-824.650) -- 0:00:05
907000 -- (-826.474) (-828.623) [-826.039] (-830.477) * (-824.736) [-826.571] (-826.759) (-825.333) -- 0:00:05
907500 -- (-828.305) [-824.115] (-825.230) (-827.010) * (-826.192) (-828.248) [-824.461] (-825.998) -- 0:00:05
908000 -- (-825.975) [-824.976] (-824.998) (-825.627) * (-824.550) [-825.921] (-824.339) (-826.675) -- 0:00:05
908500 -- (-832.896) (-829.206) [-825.976] (-827.421) * (-824.112) (-827.202) (-826.061) [-825.341] -- 0:00:05
909000 -- (-825.089) [-827.298] (-824.645) (-824.788) * (-825.019) (-825.365) [-826.139] (-824.147) -- 0:00:05
909500 -- (-833.521) [-825.687] (-824.807) (-827.539) * (-827.437) [-825.717] (-826.128) (-824.233) -- 0:00:05
910000 -- (-830.271) (-826.789) (-827.532) [-825.897] * [-826.318] (-829.224) (-834.936) (-824.165) -- 0:00:05
Average standard deviation of split frequencies: 0.005824
910500 -- (-834.466) (-827.792) (-829.589) [-826.923] * (-824.516) (-824.372) (-831.988) [-824.578] -- 0:00:05
911000 -- (-824.592) [-824.503] (-829.714) (-826.000) * (-826.478) [-824.460] (-826.484) (-824.754) -- 0:00:05
911500 -- (-828.190) (-825.651) (-827.013) [-824.668] * (-827.259) [-824.528] (-826.322) (-825.684) -- 0:00:05
912000 -- (-825.431) (-825.041) (-826.345) [-825.427] * (-826.054) (-824.686) [-832.338] (-826.044) -- 0:00:05
912500 -- [-824.712] (-824.574) (-824.045) (-826.959) * (-826.762) (-830.878) [-824.861] (-826.181) -- 0:00:05
913000 -- (-823.896) [-825.249] (-825.436) (-827.869) * [-826.464] (-830.431) (-825.430) (-829.155) -- 0:00:05
913500 -- (-823.896) (-825.825) (-824.962) [-824.705] * [-826.061] (-826.219) (-826.974) (-826.693) -- 0:00:05
914000 -- (-824.076) [-828.663] (-825.967) (-825.030) * (-827.657) [-824.412] (-825.687) (-827.902) -- 0:00:05
914500 -- (-825.013) (-827.815) [-824.388] (-824.934) * (-825.677) [-824.258] (-830.699) (-824.832) -- 0:00:05
915000 -- (-826.687) (-824.045) [-824.053] (-825.267) * (-825.539) (-824.879) (-827.584) [-826.510] -- 0:00:05
Average standard deviation of split frequencies: 0.005725
915500 -- (-826.299) (-825.123) [-825.547] (-828.436) * (-825.815) (-824.971) (-826.058) [-826.948] -- 0:00:05
916000 -- (-827.957) (-825.911) (-829.687) [-823.903] * (-828.048) (-825.738) (-825.975) [-827.975] -- 0:00:05
916500 -- (-826.364) (-824.971) (-824.768) [-827.222] * [-824.257] (-826.027) (-825.087) (-825.030) -- 0:00:05
917000 -- [-824.720] (-824.407) (-826.983) (-825.482) * (-825.481) [-827.466] (-825.194) (-825.116) -- 0:00:05
917500 -- (-828.751) [-828.906] (-826.711) (-825.979) * (-824.720) [-825.199] (-826.890) (-824.844) -- 0:00:05
918000 -- (-827.033) (-823.791) (-824.719) [-825.467] * (-829.927) [-825.626] (-829.272) (-825.740) -- 0:00:05
918500 -- (-825.586) (-825.066) (-827.860) [-826.681] * (-826.422) (-828.259) (-830.004) [-826.678] -- 0:00:04
919000 -- (-826.109) (-825.413) [-825.105] (-826.038) * [-824.914] (-828.333) (-829.536) (-826.584) -- 0:00:04
919500 -- [-824.114] (-827.001) (-827.222) (-824.042) * [-826.504] (-828.478) (-830.194) (-826.020) -- 0:00:04
920000 -- (-827.352) [-826.712] (-825.233) (-827.355) * (-826.195) (-827.870) (-824.475) [-825.255] -- 0:00:04
Average standard deviation of split frequencies: 0.006080
920500 -- [-825.599] (-827.234) (-825.398) (-831.550) * (-826.234) (-825.601) (-824.377) [-824.245] -- 0:00:04
921000 -- (-826.892) [-828.651] (-825.125) (-827.898) * [-830.856] (-825.378) (-827.689) (-825.571) -- 0:00:04
921500 -- (-825.436) [-824.490] (-825.451) (-827.623) * (-829.290) (-824.986) [-827.296] (-825.608) -- 0:00:04
922000 -- [-826.445] (-824.594) (-825.649) (-828.592) * (-827.712) (-826.483) (-826.873) [-825.660] -- 0:00:04
922500 -- (-826.348) [-823.861] (-825.021) (-829.807) * (-830.697) (-825.031) (-827.594) [-825.712] -- 0:00:04
923000 -- (-825.673) [-824.577] (-827.199) (-825.605) * (-826.038) [-825.179] (-826.864) (-829.819) -- 0:00:04
923500 -- (-824.515) (-824.980) (-824.896) [-825.337] * (-826.633) (-828.565) [-826.384] (-827.299) -- 0:00:04
924000 -- (-825.239) (-824.779) [-825.301] (-827.205) * (-828.299) (-829.957) [-827.127] (-827.356) -- 0:00:04
924500 -- (-831.345) (-829.345) (-826.014) [-831.257] * (-829.169) (-830.966) [-827.612] (-829.269) -- 0:00:04
925000 -- [-827.272] (-826.653) (-827.964) (-826.813) * (-827.334) [-827.463] (-827.928) (-828.776) -- 0:00:04
Average standard deviation of split frequencies: 0.005982
925500 -- (-829.268) (-825.810) [-825.933] (-828.225) * (-827.645) (-830.178) [-825.674] (-826.740) -- 0:00:04
926000 -- [-825.561] (-825.510) (-825.891) (-825.984) * (-827.103) (-829.377) (-826.567) [-824.945] -- 0:00:04
926500 -- (-831.939) (-825.571) (-826.075) [-826.735] * [-829.155] (-826.333) (-828.291) (-825.736) -- 0:00:04
927000 -- [-824.443] (-826.214) (-828.609) (-828.945) * [-828.969] (-826.787) (-824.334) (-824.056) -- 0:00:04
927500 -- (-826.676) (-826.337) [-824.194] (-824.867) * (-828.287) (-826.482) (-825.775) [-824.316] -- 0:00:04
928000 -- [-825.573] (-830.912) (-824.327) (-826.258) * (-825.877) (-826.462) (-826.509) [-823.829] -- 0:00:04
928500 -- (-827.969) (-827.573) [-826.860] (-827.140) * [-825.527] (-828.125) (-824.583) (-825.461) -- 0:00:04
929000 -- (-825.714) (-827.670) (-827.244) [-825.903] * [-825.435] (-824.236) (-825.461) (-824.353) -- 0:00:04
929500 -- (-827.943) [-826.144] (-827.326) (-824.542) * [-827.293] (-824.619) (-825.406) (-825.180) -- 0:00:04
930000 -- (-826.000) [-828.043] (-827.327) (-833.084) * (-824.885) [-824.230] (-828.739) (-829.128) -- 0:00:04
Average standard deviation of split frequencies: 0.005793
930500 -- [-827.109] (-829.057) (-826.015) (-830.857) * [-824.703] (-825.647) (-825.303) (-830.005) -- 0:00:04
931000 -- (-825.323) (-835.357) [-826.383] (-826.380) * (-824.785) (-826.845) (-825.456) [-826.503] -- 0:00:04
931500 -- [-827.774] (-825.096) (-826.397) (-826.155) * (-829.159) [-825.949] (-826.158) (-825.960) -- 0:00:04
932000 -- (-828.656) (-827.674) (-828.217) [-824.555] * (-827.427) (-825.501) [-826.533] (-825.446) -- 0:00:04
932500 -- (-824.625) (-824.346) (-826.263) [-825.888] * (-825.173) (-825.962) [-827.396] (-826.522) -- 0:00:04
933000 -- (-824.933) (-826.354) [-824.740] (-827.796) * [-824.789] (-829.190) (-824.567) (-824.686) -- 0:00:04
933500 -- (-825.332) [-825.067] (-827.354) (-825.899) * (-825.161) (-827.406) [-825.860] (-825.160) -- 0:00:04
934000 -- [-824.899] (-826.709) (-825.880) (-824.686) * (-827.010) (-831.394) [-825.039] (-824.561) -- 0:00:04
934500 -- (-824.899) (-825.258) [-830.591] (-825.861) * [-825.952] (-829.573) (-824.394) (-824.563) -- 0:00:03
935000 -- (-826.346) (-827.140) (-829.220) [-827.348] * (-827.044) (-827.217) (-824.204) [-825.213] -- 0:00:03
Average standard deviation of split frequencies: 0.005238
935500 -- (-832.306) (-825.883) (-824.673) [-825.617] * (-829.234) (-825.565) [-823.982] (-827.413) -- 0:00:03
936000 -- (-829.448) [-826.421] (-824.717) (-827.439) * (-826.947) [-824.763] (-824.232) (-828.207) -- 0:00:03
936500 -- (-827.498) (-824.389) [-824.734] (-829.391) * (-826.996) (-824.697) (-825.844) [-829.622] -- 0:00:03
937000 -- (-825.442) [-825.580] (-826.648) (-829.207) * [-826.432] (-824.522) (-826.209) (-825.807) -- 0:00:03
937500 -- [-827.783] (-829.369) (-826.266) (-826.882) * (-827.366) (-825.678) [-826.012] (-826.141) -- 0:00:03
938000 -- (-827.754) (-827.555) [-826.465] (-831.362) * [-825.577] (-827.555) (-827.060) (-827.556) -- 0:00:03
938500 -- (-824.821) (-829.192) (-832.361) [-827.469] * [-825.437] (-830.108) (-832.389) (-829.475) -- 0:00:03
939000 -- (-826.725) (-828.799) (-828.304) [-826.777] * (-825.650) (-828.060) [-832.031] (-827.718) -- 0:00:03
939500 -- [-824.760] (-827.694) (-826.051) (-825.286) * (-828.272) (-825.048) [-824.459] (-828.431) -- 0:00:03
940000 -- (-825.674) (-824.826) (-825.167) [-824.464] * (-825.624) [-826.298] (-824.967) (-827.472) -- 0:00:03
Average standard deviation of split frequencies: 0.005212
940500 -- (-825.852) [-832.261] (-826.016) (-824.951) * (-824.540) [-828.023] (-827.701) (-826.117) -- 0:00:03
941000 -- (-828.124) (-828.201) [-825.566] (-826.674) * (-825.916) (-826.515) (-827.083) [-831.612] -- 0:00:03
941500 -- (-826.137) (-825.654) (-825.962) [-826.797] * [-829.000] (-826.292) (-831.962) (-825.965) -- 0:00:03
942000 -- [-825.683] (-825.568) (-826.596) (-825.493) * [-824.912] (-826.420) (-832.009) (-827.485) -- 0:00:03
942500 -- [-826.517] (-825.538) (-827.150) (-826.128) * [-825.535] (-824.540) (-824.382) (-829.248) -- 0:00:03
943000 -- (-826.061) (-830.388) (-833.267) [-824.047] * (-825.027) (-824.247) (-829.355) [-825.802] -- 0:00:03
943500 -- (-827.717) [-830.294] (-826.142) (-825.839) * (-827.224) (-827.620) (-831.989) [-825.464] -- 0:00:03
944000 -- (-825.809) (-827.354) (-828.479) [-824.842] * (-829.652) (-824.752) [-825.275] (-825.495) -- 0:00:03
944500 -- (-824.593) (-825.895) (-834.088) [-824.821] * [-826.218] (-824.988) (-824.342) (-826.692) -- 0:00:03
945000 -- [-824.638] (-827.700) (-828.138) (-827.788) * (-831.632) (-825.533) (-824.519) [-825.170] -- 0:00:03
Average standard deviation of split frequencies: 0.005824
945500 -- [-826.195] (-825.489) (-828.491) (-831.311) * (-827.367) (-825.020) [-824.893] (-824.753) -- 0:00:03
946000 -- (-826.289) (-825.289) [-829.790] (-830.748) * (-830.873) [-825.151] (-826.262) (-825.459) -- 0:00:03
946500 -- (-826.827) [-823.971] (-826.804) (-826.715) * (-827.476) [-826.481] (-824.335) (-824.863) -- 0:00:03
947000 -- (-825.962) (-826.446) [-827.260] (-824.689) * (-825.940) (-827.149) (-824.510) [-827.191] -- 0:00:03
947500 -- (-825.971) [-825.318] (-825.202) (-829.521) * (-825.677) (-827.567) (-825.234) [-826.180] -- 0:00:03
948000 -- (-825.770) [-827.172] (-825.899) (-825.797) * (-824.792) (-824.821) [-828.144] (-827.477) -- 0:00:03
948500 -- [-826.623] (-828.808) (-826.309) (-826.588) * (-825.596) [-824.317] (-823.851) (-825.922) -- 0:00:03
949000 -- [-832.006] (-827.266) (-832.665) (-827.901) * [-827.757] (-824.189) (-829.309) (-825.580) -- 0:00:03
949500 -- (-829.631) [-828.645] (-825.730) (-834.497) * (-826.446) (-826.675) (-828.688) [-826.214] -- 0:00:03
950000 -- (-830.466) (-829.807) (-824.143) [-824.695] * (-826.042) (-824.898) (-825.753) [-825.532] -- 0:00:03
Average standard deviation of split frequencies: 0.005888
950500 -- (-827.225) (-826.576) [-823.804] (-825.134) * [-825.865] (-828.692) (-825.181) (-827.057) -- 0:00:03
951000 -- (-825.860) (-826.945) [-827.616] (-826.802) * (-827.016) (-824.559) (-828.228) [-825.306] -- 0:00:02
951500 -- [-829.370] (-827.017) (-826.802) (-829.932) * (-826.685) (-826.072) (-826.777) [-826.780] -- 0:00:02
952000 -- (-825.797) (-826.526) (-825.504) [-827.092] * (-829.124) (-827.769) [-826.578] (-825.974) -- 0:00:02
952500 -- (-825.665) (-823.976) [-825.288] (-827.597) * (-830.831) (-828.525) [-827.417] (-826.090) -- 0:00:02
953000 -- [-825.916] (-826.555) (-825.040) (-824.999) * [-826.839] (-828.896) (-825.944) (-826.871) -- 0:00:02
953500 -- (-832.377) (-830.686) (-824.309) [-828.171] * (-826.292) (-824.541) [-824.368] (-824.976) -- 0:00:02
954000 -- [-829.194] (-828.134) (-826.640) (-829.215) * (-830.437) (-825.639) [-825.220] (-828.073) -- 0:00:02
954500 -- [-825.329] (-825.600) (-824.456) (-825.206) * (-827.196) (-826.674) (-826.926) [-826.528] -- 0:00:02
955000 -- [-827.115] (-826.374) (-827.992) (-825.286) * (-827.840) (-825.047) (-825.986) [-828.056] -- 0:00:02
Average standard deviation of split frequencies: 0.005671
955500 -- (-826.354) (-824.721) (-826.612) [-825.596] * (-825.523) [-825.352] (-831.739) (-825.728) -- 0:00:02
956000 -- (-825.501) (-825.448) (-829.665) [-830.663] * (-826.392) (-826.134) [-826.723] (-824.832) -- 0:00:02
956500 -- (-827.051) (-826.700) (-829.588) [-826.059] * (-825.711) (-827.348) [-827.192] (-825.662) -- 0:00:02
957000 -- (-824.836) [-827.798] (-824.982) (-824.332) * (-825.181) [-827.153] (-824.765) (-824.191) -- 0:00:02
957500 -- (-825.449) (-827.337) (-826.252) [-825.806] * (-825.791) (-828.516) (-828.867) [-824.438] -- 0:00:02
958000 -- (-825.067) (-829.294) [-826.267] (-828.342) * (-825.914) (-825.390) [-824.992] (-824.587) -- 0:00:02
958500 -- [-826.328] (-827.336) (-825.150) (-825.842) * (-825.720) (-824.723) [-828.843] (-824.588) -- 0:00:02
959000 -- (-827.031) (-827.085) [-825.230] (-825.842) * (-825.231) (-829.275) (-825.460) [-823.990] -- 0:00:02
959500 -- [-829.437] (-825.363) (-825.868) (-825.657) * [-825.742] (-828.420) (-827.354) (-824.239) -- 0:00:02
960000 -- (-828.640) (-824.409) (-828.049) [-824.451] * (-828.566) [-824.517] (-826.855) (-827.905) -- 0:00:02
Average standard deviation of split frequencies: 0.005766
960500 -- (-825.921) (-824.558) (-826.209) [-824.186] * (-826.831) (-824.904) [-825.602] (-825.851) -- 0:00:02
961000 -- [-827.022] (-828.726) (-826.577) (-824.171) * (-828.508) (-829.667) [-824.977] (-824.007) -- 0:00:02
961500 -- (-827.202) [-825.176] (-826.550) (-825.103) * (-828.057) [-827.063] (-827.092) (-824.024) -- 0:00:02
962000 -- (-826.635) [-824.787] (-824.866) (-830.846) * (-824.539) [-828.612] (-826.832) (-824.183) -- 0:00:02
962500 -- (-828.515) (-826.477) [-824.465] (-826.183) * (-826.145) (-827.681) [-824.994] (-827.012) -- 0:00:02
963000 -- [-825.304] (-825.669) (-825.152) (-824.955) * [-825.339] (-826.835) (-828.908) (-824.471) -- 0:00:02
963500 -- [-827.281] (-825.223) (-826.368) (-828.871) * (-825.663) (-829.480) (-828.136) [-824.664] -- 0:00:02
964000 -- [-827.548] (-826.622) (-827.166) (-825.289) * (-823.822) (-825.716) [-825.489] (-824.609) -- 0:00:02
964500 -- (-825.661) (-829.020) [-826.385] (-825.242) * (-825.801) (-824.784) (-824.518) [-823.879] -- 0:00:02
965000 -- (-829.180) (-824.714) [-826.128] (-825.689) * (-825.422) [-825.883] (-825.538) (-824.222) -- 0:00:02
Average standard deviation of split frequencies: 0.005581
965500 -- [-826.280] (-826.152) (-826.645) (-828.123) * (-826.441) [-825.156] (-824.854) (-825.873) -- 0:00:02
966000 -- (-825.908) [-826.277] (-824.086) (-825.159) * [-824.918] (-824.562) (-825.709) (-825.478) -- 0:00:02
966500 -- (-824.792) (-825.808) [-825.312] (-824.694) * (-825.882) (-826.137) (-829.879) [-827.289] -- 0:00:02
967000 -- (-829.211) (-825.366) [-830.440] (-825.992) * [-826.600] (-825.118) (-830.955) (-825.663) -- 0:00:02
967500 -- (-830.014) (-828.629) [-826.239] (-825.276) * (-826.944) (-828.891) [-824.888] (-824.504) -- 0:00:01
968000 -- [-825.612] (-828.568) (-824.546) (-825.296) * (-831.483) (-824.935) [-825.032] (-824.147) -- 0:00:01
968500 -- (-826.829) (-823.727) [-824.583] (-825.975) * (-827.864) (-829.755) (-824.856) [-826.416] -- 0:00:01
969000 -- (-825.753) (-825.294) (-824.615) [-828.737] * [-824.628] (-827.784) (-826.479) (-826.729) -- 0:00:01
969500 -- (-826.648) [-824.827] (-824.946) (-823.928) * (-825.077) (-830.102) (-829.716) [-825.002] -- 0:00:01
970000 -- [-826.625] (-828.408) (-825.085) (-824.443) * (-824.786) [-825.906] (-828.530) (-825.596) -- 0:00:01
Average standard deviation of split frequencies: 0.005039
970500 -- [-826.643] (-829.026) (-827.944) (-825.401) * (-824.256) (-826.261) [-828.430] (-825.540) -- 0:00:01
971000 -- [-826.919] (-825.242) (-827.418) (-827.946) * [-824.099] (-827.612) (-825.506) (-828.099) -- 0:00:01
971500 -- [-826.814] (-827.863) (-827.079) (-825.527) * [-824.015] (-827.871) (-828.249) (-826.440) -- 0:00:01
972000 -- (-828.836) (-825.899) [-827.258] (-827.038) * (-824.972) (-824.563) [-827.136] (-826.556) -- 0:00:01
972500 -- (-824.693) [-825.113] (-824.483) (-824.390) * (-827.554) (-824.084) [-827.184] (-826.784) -- 0:00:01
973000 -- [-825.178] (-825.719) (-828.774) (-824.440) * (-830.608) [-824.067] (-825.977) (-824.498) -- 0:00:01
973500 -- (-825.061) [-824.471] (-827.924) (-826.329) * (-827.017) (-828.655) (-827.013) [-824.689] -- 0:00:01
974000 -- [-826.557] (-824.829) (-828.830) (-824.207) * (-826.570) (-825.890) (-828.371) [-824.838] -- 0:00:01
974500 -- (-827.133) (-826.135) [-829.092] (-824.843) * [-831.378] (-825.220) (-826.542) (-827.424) -- 0:00:01
975000 -- (-828.850) [-828.566] (-826.597) (-827.727) * (-824.660) [-825.178] (-824.555) (-827.535) -- 0:00:01
Average standard deviation of split frequencies: 0.005222
975500 -- (-827.736) (-825.703) [-828.122] (-827.634) * [-825.518] (-826.887) (-831.220) (-827.834) -- 0:00:01
976000 -- (-828.277) [-826.432] (-829.824) (-825.587) * (-823.941) (-827.836) (-827.434) [-826.153] -- 0:00:01
976500 -- (-825.447) (-829.192) (-827.497) [-827.510] * [-824.202] (-826.951) (-825.681) (-824.882) -- 0:00:01
977000 -- (-825.166) (-826.925) (-826.376) [-824.534] * [-824.543] (-830.201) (-824.253) (-825.483) -- 0:00:01
977500 -- (-827.797) (-831.989) (-826.602) [-824.805] * [-826.459] (-825.686) (-826.212) (-824.709) -- 0:00:01
978000 -- (-824.871) (-827.321) (-827.458) [-827.333] * (-825.435) [-827.544] (-826.321) (-825.905) -- 0:00:01
978500 -- (-826.511) [-826.836] (-828.618) (-825.743) * (-828.638) (-827.620) [-825.953] (-824.787) -- 0:00:01
979000 -- (-827.312) (-826.866) [-824.929] (-824.832) * (-830.467) [-824.164] (-825.293) (-825.605) -- 0:00:01
979500 -- [-828.451] (-833.672) (-823.998) (-824.262) * (-825.006) [-824.830] (-827.011) (-825.960) -- 0:00:01
980000 -- (-826.553) [-825.603] (-826.855) (-826.722) * [-825.513] (-824.632) (-826.724) (-827.232) -- 0:00:01
Average standard deviation of split frequencies: 0.005258
980500 -- (-825.261) (-827.086) [-828.267] (-825.778) * [-825.971] (-827.189) (-826.641) (-827.421) -- 0:00:01
981000 -- (-826.049) [-829.205] (-824.543) (-826.016) * (-826.061) (-826.503) (-831.043) [-824.196] -- 0:00:01
981500 -- (-827.320) (-826.402) (-827.978) [-824.932] * (-825.732) (-825.568) (-830.475) [-827.653] -- 0:00:01
982000 -- (-826.912) [-825.766] (-830.363) (-826.195) * (-824.863) (-824.037) (-833.124) [-825.447] -- 0:00:01
982500 -- (-828.852) [-825.996] (-827.598) (-827.224) * (-825.892) [-825.255] (-830.225) (-826.240) -- 0:00:01
983000 -- (-828.854) [-825.752] (-827.290) (-829.573) * (-826.174) [-826.361] (-825.055) (-825.960) -- 0:00:01
983500 -- (-827.024) (-827.001) [-826.900] (-825.335) * [-825.862] (-826.275) (-826.962) (-826.832) -- 0:00:01
984000 -- (-827.614) [-826.319] (-826.985) (-824.387) * [-825.823] (-827.492) (-825.966) (-826.366) -- 0:00:00
984500 -- [-829.836] (-828.383) (-824.213) (-824.896) * [-825.622] (-827.684) (-826.324) (-825.855) -- 0:00:00
985000 -- (-827.629) (-827.866) [-825.917] (-824.203) * [-826.032] (-829.271) (-827.848) (-827.383) -- 0:00:00
Average standard deviation of split frequencies: 0.005498
985500 -- (-828.304) (-825.509) [-826.670] (-824.063) * (-824.290) [-824.852] (-829.864) (-827.582) -- 0:00:00
986000 -- (-825.773) (-825.439) (-826.987) [-824.772] * [-827.039] (-825.352) (-825.122) (-824.815) -- 0:00:00
986500 -- (-826.620) [-824.103] (-827.852) (-825.807) * [-828.228] (-826.461) (-824.831) (-824.872) -- 0:00:00
987000 -- (-826.054) (-824.128) [-824.122] (-824.857) * (-829.924) (-827.651) [-825.981] (-825.720) -- 0:00:00
987500 -- (-825.121) (-825.598) (-824.063) [-824.240] * [-827.405] (-824.966) (-824.385) (-828.484) -- 0:00:00
988000 -- [-827.457] (-826.217) (-828.042) (-824.135) * (-829.351) [-826.083] (-826.066) (-826.630) -- 0:00:00
988500 -- [-829.101] (-827.216) (-826.155) (-824.165) * (-825.776) (-828.087) (-825.713) [-826.106] -- 0:00:00
989000 -- (-828.338) (-830.863) (-826.739) [-826.716] * (-826.551) (-827.187) (-825.543) [-824.977] -- 0:00:00
989500 -- (-829.419) (-830.442) [-827.676] (-825.416) * [-825.290] (-825.960) (-825.072) (-826.997) -- 0:00:00
990000 -- (-828.945) [-825.127] (-824.811) (-828.419) * [-827.304] (-825.853) (-828.290) (-826.826) -- 0:00:00
Average standard deviation of split frequencies: 0.005442
990500 -- (-826.599) [-825.436] (-828.331) (-827.774) * [-826.892] (-824.809) (-827.942) (-824.469) -- 0:00:00
991000 -- (-825.644) [-825.992] (-827.780) (-826.529) * (-826.249) (-826.216) [-828.540] (-825.579) -- 0:00:00
991500 -- (-825.768) [-824.942] (-826.189) (-826.489) * [-825.511] (-824.489) (-826.957) (-826.803) -- 0:00:00
992000 -- (-827.923) (-826.774) (-825.454) [-824.722] * (-826.445) (-828.264) [-827.416] (-828.964) -- 0:00:00
992500 -- (-828.979) (-827.055) (-824.540) [-825.538] * [-824.896] (-828.433) (-832.405) (-828.102) -- 0:00:00
993000 -- (-827.559) (-829.002) [-824.535] (-827.769) * (-826.041) (-826.167) (-825.655) [-826.625] -- 0:00:00
993500 -- (-826.639) (-827.022) (-826.896) [-826.685] * [-825.811] (-825.683) (-833.017) (-825.431) -- 0:00:00
994000 -- (-828.609) (-828.418) (-826.924) [-825.077] * [-826.448] (-829.797) (-828.322) (-829.861) -- 0:00:00
994500 -- (-825.596) (-824.460) (-827.545) [-824.121] * (-829.046) (-824.073) (-831.668) [-830.491] -- 0:00:00
995000 -- [-823.918] (-824.635) (-826.459) (-825.850) * [-827.930] (-827.265) (-830.592) (-829.699) -- 0:00:00
Average standard deviation of split frequencies: 0.004733
995500 -- [-823.923] (-824.463) (-826.215) (-826.991) * (-829.061) (-827.051) (-825.505) [-825.590] -- 0:00:00
996000 -- (-827.264) [-825.920] (-825.742) (-825.701) * (-825.278) (-824.665) [-826.827] (-826.647) -- 0:00:00
996500 -- (-824.058) (-824.497) [-825.255] (-825.438) * (-824.038) (-825.385) [-827.893] (-826.318) -- 0:00:00
997000 -- [-824.177] (-828.080) (-827.542) (-825.638) * [-828.050] (-826.743) (-825.727) (-826.078) -- 0:00:00
997500 -- (-826.473) [-825.587] (-830.372) (-827.784) * (-825.845) (-827.144) (-826.621) [-826.430] -- 0:00:00
998000 -- (-826.342) (-824.601) [-824.567] (-826.705) * (-825.110) (-824.614) [-825.940] (-825.577) -- 0:00:00
998500 -- (-823.958) [-825.057] (-824.731) (-824.670) * (-826.151) (-823.972) (-825.727) [-825.244] -- 0:00:00
999000 -- (-825.320) [-825.183] (-828.279) (-825.525) * (-826.644) (-829.443) (-830.261) [-825.213] -- 0:00:00
999500 -- (-824.816) [-825.520] (-825.017) (-826.640) * (-824.322) (-827.690) [-827.618] (-825.520) -- 0:00:00
1000000 -- (-827.911) [-824.944] (-826.932) (-825.370) * (-825.901) (-824.478) (-826.599) [-825.547] -- 0:00:00
Average standard deviation of split frequencies: 0.005119
Analysis completed in 1 mins 1 seconds
Analysis used 59.83 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -823.71
Likelihood of best state for "cold" chain of run 2 was -823.71
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
74.7 % ( 70 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.1 % ( 26 %) Dirichlet(Pi{all})
30.3 % ( 24 %) Slider(Pi{all})
79.0 % ( 49 %) Multiplier(Alpha{1,2})
77.9 % ( 50 %) Multiplier(Alpha{3})
21.9 % ( 23 %) Slider(Pinvar{all})
98.6 % ( 96 %) ExtSPR(Tau{all},V{all})
70.0 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.6 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 71 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.7 % ( 26 %) Dirichlet(Pi{all})
30.1 % ( 23 %) Slider(Pi{all})
79.0 % ( 54 %) Multiplier(Alpha{1,2})
77.7 % ( 55 %) Multiplier(Alpha{3})
22.0 % ( 32 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 70 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 81 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166795 0.82 0.67
3 | 166797 165827 0.84
4 | 167057 166723 166801
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166718 0.82 0.67
3 | 166399 166852 0.84
4 | 166569 167209 166253
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -825.42
| 1 1|
| 21 1 |
| 2 2 1 2 |
|12 111 1 1 1 2 |
| 11 2 2 2 2 1 2 |
| 12 1 1 1 2 2 2 1 |
| 1 21 111 * 2 22 * 21 2 22221 2 |
|2 1 22 2 11 2* 2 1 12 1 1 1 |
| 2 21 1 2 1 1 1 1 12 2 * 1 |
| 2 21 22 1 2 2 2 21 1 |
| 2 2 211 21 2 1 2 1 2|
| 21 1 |
| 2 1 |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -827.14
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -825.43 -827.81
2 -825.48 -828.92
--------------------------------------
TOTAL -825.45 -828.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901742 0.091404 0.388019 1.527727 0.873962 1375.92 1438.46 1.000
r(A<->C){all} 0.175366 0.021393 0.000021 0.474018 0.135516 268.45 273.78 1.000
r(A<->G){all} 0.159486 0.018451 0.000064 0.429465 0.121300 89.10 236.02 1.001
r(A<->T){all} 0.163765 0.019931 0.000023 0.446071 0.125153 176.91 188.00 1.003
r(C<->G){all} 0.165156 0.020004 0.000037 0.450170 0.129160 160.19 188.82 1.003
r(C<->T){all} 0.164775 0.020301 0.000113 0.446831 0.125995 142.82 232.74 1.000
r(G<->T){all} 0.171452 0.021909 0.000011 0.469094 0.129492 95.88 120.17 1.010
pi(A){all} 0.217930 0.000285 0.186038 0.251278 0.217836 1082.65 1095.13 1.000
pi(C){all} 0.291273 0.000340 0.254464 0.326423 0.290762 1345.43 1358.52 1.000
pi(G){all} 0.304685 0.000352 0.267899 0.340114 0.304274 1163.26 1285.33 1.000
pi(T){all} 0.186112 0.000248 0.157413 0.218566 0.185981 1120.30 1160.47 1.000
alpha{1,2} 0.415517 0.223336 0.000163 1.357792 0.255930 1014.46 1208.36 1.001
alpha{3} 0.452236 0.223850 0.000138 1.357836 0.296607 1179.04 1284.75 1.000
pinvar{all} 0.997418 0.000009 0.991741 1.000000 0.998423 1126.43 1296.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*.*..
9 -- ..*.*.
10 -- ..*..*
11 -- .*...*
12 -- .*.***
13 -- ..**..
14 -- ...**.
15 -- .**.**
16 -- .****.
17 -- .*..*.
18 -- .***.*
19 -- .**...
20 -- ....**
21 -- ..****
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 448 0.149234 0.008480 0.143238 0.155230 2
8 441 0.146902 0.001413 0.145903 0.147901 2
9 441 0.146902 0.015546 0.135909 0.157895 2
10 441 0.146902 0.003298 0.144570 0.149234 2
11 436 0.145237 0.009422 0.138574 0.151899 2
12 434 0.144570 0.000942 0.143904 0.145237 2
13 434 0.144570 0.003769 0.141905 0.147235 2
14 432 0.143904 0.003769 0.141239 0.146569 2
15 430 0.143238 0.002827 0.141239 0.145237 2
16 423 0.140906 0.001413 0.139907 0.141905 2
17 418 0.139241 0.007537 0.133911 0.144570 2
18 413 0.137575 0.003298 0.135243 0.139907 2
19 408 0.135909 0.008480 0.129913 0.141905 2
20 407 0.135576 0.004240 0.132578 0.138574 2
21 389 0.129580 0.002355 0.127915 0.131246 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.102419 0.010368 0.000066 0.301274 0.070094 1.000 2
length{all}[2] 0.101998 0.010734 0.000083 0.299501 0.070440 1.000 2
length{all}[3] 0.098859 0.009811 0.000029 0.300523 0.068892 1.000 2
length{all}[4] 0.101366 0.010077 0.000038 0.296937 0.070813 1.000 2
length{all}[5] 0.104147 0.010730 0.000007 0.305975 0.072291 1.000 2
length{all}[6] 0.098493 0.009397 0.000001 0.290966 0.067490 1.000 2
length{all}[7] 0.094395 0.008508 0.000036 0.289377 0.066065 0.998 2
length{all}[8] 0.095760 0.010011 0.000086 0.304675 0.065078 0.999 2
length{all}[9] 0.098847 0.010224 0.000071 0.291837 0.071838 0.998 2
length{all}[10] 0.097013 0.010514 0.000033 0.339025 0.061818 1.012 2
length{all}[11] 0.099148 0.009489 0.000059 0.275219 0.070529 0.999 2
length{all}[12] 0.101743 0.012224 0.000207 0.310190 0.066091 1.002 2
length{all}[13] 0.090935 0.009208 0.000024 0.282887 0.058649 1.001 2
length{all}[14] 0.104501 0.012782 0.000044 0.338180 0.063897 1.002 2
length{all}[15] 0.101621 0.012877 0.000618 0.331582 0.065213 0.998 2
length{all}[16] 0.100149 0.008853 0.000894 0.274622 0.074838 1.000 2
length{all}[17] 0.095930 0.010050 0.000149 0.280317 0.064945 1.000 2
length{all}[18] 0.099985 0.008392 0.000027 0.284140 0.074796 0.999 2
length{all}[19] 0.100748 0.010067 0.000239 0.295118 0.073508 0.998 2
length{all}[20] 0.101502 0.011034 0.000283 0.291545 0.076782 0.999 2
length{all}[21] 0.098781 0.010729 0.000301 0.301434 0.062592 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005119
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|----------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 603
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 49 patterns at 201 / 201 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 49 patterns at 201 / 201 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
47824 bytes for conP
4312 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.075698 0.015946 0.092237 0.066478 0.064579 0.055620 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -852.702367
Iterating by ming2
Initial: fx= 852.702367
x= 0.07570 0.01595 0.09224 0.06648 0.06458 0.05562 0.30000 1.30000
1 h-m-p 0.0000 0.0001 478.4921 ++ 834.147894 m 0.0001 13 | 1/8
2 h-m-p 0.0004 0.0036 82.9645 ++ 828.254567 m 0.0036 24 | 2/8
3 h-m-p 0.0001 0.0004 138.6683 ++ 822.545790 m 0.0004 35 | 3/8
4 h-m-p 0.0002 0.0008 77.5600 ++ 803.618910 m 0.0008 46 | 4/8
5 h-m-p 0.0035 0.0874 16.5823 ------------.. | 4/8
6 h-m-p 0.0000 0.0000 338.2341 ++ 800.317460 m 0.0000 78 | 5/8
7 h-m-p 0.0010 0.2304 8.2814 -----------.. | 5/8
8 h-m-p 0.0000 0.0001 275.4313 ++ 789.632632 m 0.0001 109 | 6/8
9 h-m-p 0.0048 0.3477 5.6973 ------------.. | 6/8
10 h-m-p 0.0000 0.0003 194.8755 +++ 779.965131 m 0.0003 142 | 7/8
11 h-m-p 1.6000 8.0000 0.0000 Y 779.965131 0 1.6000 153 | 7/8
12 h-m-p 0.0213 8.0000 0.0000 ----------Y 779.965131 0 0.0000 175
Out..
lnL = -779.965131
176 lfun, 176 eigenQcodon, 1056 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.045082 0.078622 0.060180 0.062333 0.107172 0.104123 0.000100 0.817682 0.579509
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.164384
np = 9
lnL0 = -868.191602
Iterating by ming2
Initial: fx= 868.191602
x= 0.04508 0.07862 0.06018 0.06233 0.10717 0.10412 0.00011 0.81768 0.57951
1 h-m-p 0.0000 0.0000 464.7211 ++ 867.691728 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 473.8118 +++ 816.098053 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0001 401.9125 ++ 802.482438 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0002 130.3226 ++ 799.401674 m 0.0002 51 | 4/9
5 h-m-p 0.0000 0.0000 4834.4117 ++ 785.133642 m 0.0000 63 | 5/9
6 h-m-p 0.0001 0.0003 331.0247 ++ 780.220940 m 0.0003 75 | 6/9
7 h-m-p 0.0000 0.0000 9908.9508 ++ 779.965098 m 0.0000 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0002 ++ 779.965098 m 8.0000 99 | 7/9
9 h-m-p 0.0067 3.1602 0.2725 ----------Y 779.965098 0 0.0000 123 | 7/9
10 h-m-p 0.0155 7.7504 0.0281 +++++ 779.965048 m 7.7504 140 | 8/9
11 h-m-p 0.7927 8.0000 0.1110 --------------Y 779.965048 0 0.0000 168 | 8/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 779.965047 m 8.0000 184 | 8/9
13 h-m-p 0.0140 7.0065 0.1317 ----------C 779.965047 0 0.0000 207 | 8/9
14 h-m-p 0.0160 8.0000 0.0001 ---------N 779.965047 0 0.0000 229 | 8/9
15 h-m-p 0.0001 0.0269 2.8702 +++++ 779.965005 m 0.0269 245 | 9/9
16 h-m-p 0.0160 8.0000 0.0000 C 779.965005 0 0.0160 257 | 9/9
17 h-m-p 0.0160 8.0000 0.0000 C 779.965005 0 0.0160 269
Out..
lnL = -779.965005
270 lfun, 810 eigenQcodon, 3240 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.052046 0.092540 0.095372 0.082009 0.013941 0.023680 0.000100 1.237747 0.475983 0.333328 1.368358
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.840093
np = 11
lnL0 = -846.754268
Iterating by ming2
Initial: fx= 846.754268
x= 0.05205 0.09254 0.09537 0.08201 0.01394 0.02368 0.00011 1.23775 0.47598 0.33333 1.36836
1 h-m-p 0.0000 0.0000 432.6974 ++ 846.329941 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 276.1161 +++ 830.877348 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0002 125.4213 ++ 823.532588 m 0.0002 45 | 3/11
4 h-m-p 0.0003 0.0028 59.6315 ++ 804.388815 m 0.0028 59 | 4/11
5 h-m-p 0.0000 0.0001 878.3800 ++ 786.340086 m 0.0001 73 | 5/11
6 h-m-p 0.0000 0.0002 354.8091 ++ 782.965904 m 0.0002 87 | 6/11
7 h-m-p 0.0014 0.0068 5.4457 -----------.. | 6/11
8 h-m-p 0.0000 0.0000 272.2296 ++ 780.755521 m 0.0000 124 | 7/11
9 h-m-p 0.0160 8.0000 2.1096 -------------.. | 7/11
10 h-m-p 0.0000 0.0000 194.8615 ++ 779.965105 m 0.0000 163 | 8/11
11 h-m-p 0.0194 8.0000 0.0000 +++++ 779.965105 m 8.0000 180 | 8/11
12 h-m-p 0.0160 8.0000 0.0035 -----Y 779.965105 0 0.0000 202 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 ----------Y 779.965105 0 0.0000 229 | 8/11
14 h-m-p 0.0160 8.0000 0.0000 -----Y 779.965105 0 0.0000 251
Out..
lnL = -779.965105
252 lfun, 1008 eigenQcodon, 4536 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -779.981457 S = -779.962215 -0.007378
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:02
did 20 / 49 patterns 0:02
did 30 / 49 patterns 0:02
did 40 / 49 patterns 0:02
did 49 / 49 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103135 0.039571 0.019008 0.100650 0.093084 0.048161 0.000100 0.938845 1.269516
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.405949
np = 9
lnL0 = -854.581590
Iterating by ming2
Initial: fx= 854.581590
x= 0.10313 0.03957 0.01901 0.10065 0.09308 0.04816 0.00011 0.93884 1.26952
1 h-m-p 0.0000 0.0000 429.1011 ++ 854.296355 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0073 67.9623 +++++ 826.233739 m 0.0073 29 | 2/9
3 h-m-p 0.0001 0.0004 85.3698 ++ 817.371087 m 0.0004 41 | 3/9
4 h-m-p 0.0002 0.0016 121.2775 ++ 809.676419 m 0.0016 53 | 4/9
5 h-m-p 0.0001 0.0005 344.8709 ++ 786.283088 m 0.0005 65 | 5/9
6 h-m-p 0.0002 0.0012 169.6275 ++ 782.177822 m 0.0012 77 | 6/9
7 h-m-p 0.0000 0.0001 199.0531 ++ 781.456387 m 0.0001 89 | 7/9
8 h-m-p 0.0064 0.2845 3.5700 ------------.. | 7/9
9 h-m-p 0.0000 0.0000 189.8558 ++ 779.965005 m 0.0000 123 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 N 779.965005 0 0.4000 135 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 N 779.965005 0 1.6000 148
Out..
lnL = -779.965005
149 lfun, 1639 eigenQcodon, 8940 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.030686 0.096873 0.046727 0.013800 0.079382 0.023959 0.000100 0.900000 0.269873 1.043830 1.288748
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 18.882385
np = 11
lnL0 = -830.675709
Iterating by ming2
Initial: fx= 830.675709
x= 0.03069 0.09687 0.04673 0.01380 0.07938 0.02396 0.00011 0.90000 0.26987 1.04383 1.28875
1 h-m-p 0.0000 0.0000 384.7196 ++ 830.468539 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0009 135.0363 ++++ 815.717321 m 0.0009 32 | 2/11
3 h-m-p 0.0000 0.0001 301.7315 ++ 807.717880 m 0.0001 46 | 3/11
4 h-m-p 0.0000 0.0001 867.0297 ++ 802.567699 m 0.0001 60 | 4/11
5 h-m-p 0.0000 0.0000 5551.5451 ++ 795.539085 m 0.0000 74 | 5/11
6 h-m-p 0.0002 0.0008 89.1186 ++ 788.762582 m 0.0008 88 | 6/11
7 h-m-p 0.0000 0.0000 2319.8616 ++ 785.539824 m 0.0000 102 | 7/11
8 h-m-p 0.0028 0.0139 14.0031 ++ 779.965070 m 0.0139 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 779.965070 m 8.0000 130 | 8/11
10 h-m-p 0.0160 8.0000 0.0777 ------------Y 779.965070 0 0.0000 159 | 8/11
11 h-m-p 0.0160 8.0000 0.0002 +++++ 779.965070 m 8.0000 179 | 8/11
12 h-m-p 0.0057 2.6427 0.2367 ----------Y 779.965070 0 0.0000 206 | 8/11
13 h-m-p 0.0160 8.0000 0.0006 +++++ 779.965070 m 8.0000 226 | 8/11
14 h-m-p 0.0206 2.4977 0.2348 -----------Y 779.965070 0 0.0000 254 | 8/11
15 h-m-p 0.0160 8.0000 0.0001 ------Y 779.965070 0 0.0000 277 | 8/11
16 h-m-p 0.0160 8.0000 0.0003 +++++ 779.965069 m 8.0000 297 | 8/11
17 h-m-p 0.0119 2.8994 0.2224 ----------Y 779.965069 0 0.0000 324 | 8/11
18 h-m-p 0.0160 8.0000 0.0005 -------Y 779.965069 0 0.0000 348 | 8/11
19 h-m-p 0.0160 8.0000 0.0000 +++++ 779.965069 m 8.0000 368 | 8/11
20 h-m-p 0.0051 2.5436 0.2338 ------------.. | 8/11
21 h-m-p 0.0160 8.0000 0.0004 +++++ 779.965068 m 8.0000 415 | 8/11
22 h-m-p 0.0270 8.0000 0.1100 -------------Y 779.965068 0 0.0000 445 | 8/11
23 h-m-p 0.0160 8.0000 0.0003 +++++ 779.965068 m 8.0000 465 | 8/11
24 h-m-p 0.0155 7.7529 0.2259 ----------C 779.965068 0 0.0000 492 | 8/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 779.965067 m 8.0000 512 | 8/11
26 h-m-p 0.0160 8.0000 0.2241 -------------.. | 8/11
27 h-m-p 0.0160 8.0000 0.0004 +++++ 779.965066 m 8.0000 560 | 8/11
28 h-m-p 0.0288 8.0000 0.1076 -----------Y 779.965066 0 0.0000 588 | 8/11
29 h-m-p 0.0160 8.0000 0.0016 +++++ 779.965062 m 8.0000 608 | 8/11
30 h-m-p 0.1042 8.0000 0.1205 --------------.. | 8/11
31 h-m-p 0.0160 8.0000 0.0004 +++++ 779.965060 m 8.0000 657 | 8/11
32 h-m-p 0.0355 8.0000 0.1004 -----------C 779.965060 0 0.0000 685 | 8/11
33 h-m-p 0.0160 8.0000 0.0023 +++++ 779.965052 m 8.0000 705 | 8/11
34 h-m-p 0.1577 8.0000 0.1162 ---------------.. | 8/11
35 h-m-p 0.0160 8.0000 0.0005 +++++ 779.965049 m 8.0000 755 | 8/11
36 h-m-p 0.0484 8.0000 0.0907 ------------C 779.965049 0 0.0000 784 | 8/11
37 h-m-p 0.0160 8.0000 0.0013 +++++ 779.965044 m 8.0000 804 | 8/11
38 h-m-p 0.0903 8.0000 0.1163 ------------Y 779.965044 0 0.0000 833 | 8/11
39 h-m-p 0.0160 8.0000 0.0005 +++++ 779.965043 m 8.0000 853 | 8/11
40 h-m-p 0.0231 8.0000 0.1681 -------------.. | 8/11
41 h-m-p 0.0160 8.0000 0.0007 +++++ 779.965039 m 8.0000 901 | 8/11
42 h-m-p 0.0622 8.0000 0.0836 -----------C 779.965039 0 0.0000 929 | 8/11
43 h-m-p 0.0160 8.0000 0.0022 +++++ 779.965028 m 8.0000 949 | 8/11
44 h-m-p 0.1690 8.0000 0.1028 --------------C 779.965028 0 0.0000 980 | 8/11
45 h-m-p 0.0160 8.0000 0.0001 ----------Y 779.965028 0 0.0000 1007 | 8/11
46 h-m-p 0.0053 2.6707 0.0095 +++++ 779.965005 m 2.6707 1027 | 9/11
47 h-m-p 0.7604 8.0000 0.0132 ++ 779.965005 m 8.0000 1044 | 9/11
48 h-m-p 0.2393 8.0000 0.4417 +
QuantileBeta(0.15, 0.00500, 2.94365) = 8.368055e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
+ 779.965005 m 8.0000 1061
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.961589e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78670) = 4.794023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78633) = 4.794426e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78652) = 4.794224e-161 2000 rounds
| 9/11
49 h-m-p 1.6000 8.0000 0.4189
QuantileBeta(0.15, 0.00500, 5.45681) = 4.148571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.46770) = 2.954160e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
+ 779.965005 m 8.0000 1077
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.789473e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13824) = 2.695292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13775) = 2.695465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.13800) = 2.695379e-161 2000 rounds
| 9/11
50 h-m-p 0.3605 8.0000 9.2965
QuantileBeta(0.15, 0.00500, 11.48948) = 1.874239e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.54393) = 9.791094e-162 2000 rounds
++
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
Y 779.965005 0 4.5556 1095
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 2.056845e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48893) = 1.987337e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.48891) = 1.987338e-162 2000 rounds
| 9/11
51 h-m-p 0.2273 1.1364 44.4253
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 10.10178) = 2.144815e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 44.28659) = 3.791581e-162 2000 rounds
Y 779.965005 0 0.2273 1109
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.304006e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39215) = 4.161689e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
| 9/11
52 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
Y 779.965005 0 1.6000 1123
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.304006e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39281) = 4.161621e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39145) = 4.161762e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
| 9/11
53 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
N 779.965005 0 0.0080 1139
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
Out..
lnL = -779.965005
1140 lfun, 13680 eigenQcodon, 75240 P(t)
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -780.046537 S = -779.966285 -0.035856
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 49 patterns 0:24
did 20 / 49 patterns 0:24
did 30 / 49 patterns 0:24
did 40 / 49 patterns 0:25
did 49 / 49 patterns 0:25
QuantileBeta(0.15, 0.00500, 40.39213) = 4.161691e-162 2000 rounds
Time used: 0:25
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=201
NC_011896_1_WP_010908644_1_2090_MLBR_RS09925 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
NC_002677_1_NP_302323_1_1195_rpsD MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
NZ_CP029543_1_WP_010908644_1_2112_rpsD MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
NZ_AP014567_1_WP_010908644_1_2171_rpsD MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
**************************************************
NC_011896_1_WP_010908644_1_2090_MLBR_RS09925 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
NC_002677_1_NP_302323_1_1195_rpsD QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785 QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
NZ_CP029543_1_WP_010908644_1_2112_rpsD QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
NZ_AP014567_1_WP_010908644_1_2171_rpsD QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
**************************************************
NC_011896_1_WP_010908644_1_2090_MLBR_RS09925 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
NC_002677_1_NP_302323_1_1195_rpsD GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785 GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
NZ_CP029543_1_WP_010908644_1_2112_rpsD GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
NZ_AP014567_1_WP_010908644_1_2171_rpsD GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
**************************************************
NC_011896_1_WP_010908644_1_2090_MLBR_RS09925 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
NC_002677_1_NP_302323_1_1195_rpsD QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785 QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
NZ_CP029543_1_WP_010908644_1_2112_rpsD QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
NZ_AP014567_1_WP_010908644_1_2171_rpsD QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
**************************************************
NC_011896_1_WP_010908644_1_2090_MLBR_RS09925 K
NC_002677_1_NP_302323_1_1195_rpsD K
NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475 K
NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785 K
NZ_CP029543_1_WP_010908644_1_2112_rpsD K
NZ_AP014567_1_WP_010908644_1_2171_rpsD K
*
>NC_011896_1_WP_010908644_1_2090_MLBR_RS09925 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG AAG >NC_002677_1_NP_302323_1_1195_rpsD ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG AAG >NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG AAG >NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785 ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG AAG >NZ_CP029543_1_WP_010908644_1_2112_rpsD ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG AAG >NZ_AP014567_1_WP_010908644_1_2171_rpsD ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG AAG
>NC_011896_1_WP_010908644_1_2090_MLBR_RS09925 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS K >NC_002677_1_NP_302323_1_1195_rpsD MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS K >NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS K >NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785 MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS K >NZ_CP029543_1_WP_010908644_1_2112_rpsD MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS K >NZ_AP014567_1_WP_010908644_1_2171_rpsD MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS K
#NEXUS
[ID: 0651545885]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908644_1_2090_MLBR_RS09925
NC_002677_1_NP_302323_1_1195_rpsD
NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475
NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785
NZ_CP029543_1_WP_010908644_1_2112_rpsD
NZ_AP014567_1_WP_010908644_1_2171_rpsD
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908644_1_2090_MLBR_RS09925,
2 NC_002677_1_NP_302323_1_1195_rpsD,
3 NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475,
4 NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785,
5 NZ_CP029543_1_WP_010908644_1_2112_rpsD,
6 NZ_AP014567_1_WP_010908644_1_2171_rpsD
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07009429,2:0.07043999,3:0.06889233,4:0.07081327,5:0.07229118,6:0.06748961);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07009429,2:0.07043999,3:0.06889233,4:0.07081327,5:0.07229118,6:0.06748961);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -825.43 -827.81
2 -825.48 -828.92
--------------------------------------
TOTAL -825.45 -828.51
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.901742 0.091404 0.388019 1.527727 0.873962 1375.92 1438.46 1.000
r(A<->C){all} 0.175366 0.021393 0.000021 0.474018 0.135516 268.45 273.78 1.000
r(A<->G){all} 0.159486 0.018451 0.000064 0.429465 0.121300 89.10 236.02 1.001
r(A<->T){all} 0.163765 0.019931 0.000023 0.446071 0.125153 176.91 188.00 1.003
r(C<->G){all} 0.165156 0.020004 0.000037 0.450170 0.129160 160.19 188.82 1.003
r(C<->T){all} 0.164775 0.020301 0.000113 0.446831 0.125995 142.82 232.74 1.000
r(G<->T){all} 0.171452 0.021909 0.000011 0.469094 0.129492 95.88 120.17 1.010
pi(A){all} 0.217930 0.000285 0.186038 0.251278 0.217836 1082.65 1095.13 1.000
pi(C){all} 0.291273 0.000340 0.254464 0.326423 0.290762 1345.43 1358.52 1.000
pi(G){all} 0.304685 0.000352 0.267899 0.340114 0.304274 1163.26 1285.33 1.000
pi(T){all} 0.186112 0.000248 0.157413 0.218566 0.185981 1120.30 1160.47 1.000
alpha{1,2} 0.415517 0.223336 0.000163 1.357792 0.255930 1014.46 1208.36 1.001
alpha{3} 0.452236 0.223850 0.000138 1.357836 0.296607 1179.04 1284.75 1.000
pinvar{all} 0.997418 0.000009 0.991741 1.000000 0.998423 1126.43 1296.01 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/11res/rpsD/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 201
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 0 0 0 0 0 0 | TAC 10 10 10 10 10 10 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 7 7 7 7 7 7
CTC 3 3 3 3 3 3 | CCC 4 4 4 4 4 4 | CAC 4 4 4 4 4 4 | CGC 8 8 8 8 8 8
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 4 4 4 4 4 4 | CGA 1 1 1 1 1 1
CTG 9 9 9 9 9 9 | CCG 5 5 5 5 5 5 | CAG 11 11 11 11 11 11 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 12 12 12 12 12 12 | ACC 3 3 3 3 3 3 | AAC 2 2 2 2 2 2 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 2 2 2 2 2 2 | AAG 9 9 9 9 9 9 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 2 2 2 2 2 2 | Asp GAT 4 4 4 4 4 4 | Gly GGT 4 4 4 4 4 4
GTC 7 7 7 7 7 7 | GCC 3 3 3 3 3 3 | GAC 4 4 4 4 4 4 | GGC 6 6 6 6 6 6
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 7 7 7 7 7 7 | GGA 2 2 2 2 2 2
GTG 8 8 8 8 8 8 | GCG 4 4 4 4 4 4 | GAG 9 9 9 9 9 9 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908644_1_2090_MLBR_RS09925
position 1: T:0.11940 C:0.34826 A:0.21891 G:0.31343
position 2: T:0.28358 C:0.15423 A:0.34328 G:0.21891
position 3: T:0.15423 C:0.37313 A:0.08955 G:0.38308
Average T:0.18574 C:0.29187 A:0.21725 G:0.30514
#2: NC_002677_1_NP_302323_1_1195_rpsD
position 1: T:0.11940 C:0.34826 A:0.21891 G:0.31343
position 2: T:0.28358 C:0.15423 A:0.34328 G:0.21891
position 3: T:0.15423 C:0.37313 A:0.08955 G:0.38308
Average T:0.18574 C:0.29187 A:0.21725 G:0.30514
#3: NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475
position 1: T:0.11940 C:0.34826 A:0.21891 G:0.31343
position 2: T:0.28358 C:0.15423 A:0.34328 G:0.21891
position 3: T:0.15423 C:0.37313 A:0.08955 G:0.38308
Average T:0.18574 C:0.29187 A:0.21725 G:0.30514
#4: NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785
position 1: T:0.11940 C:0.34826 A:0.21891 G:0.31343
position 2: T:0.28358 C:0.15423 A:0.34328 G:0.21891
position 3: T:0.15423 C:0.37313 A:0.08955 G:0.38308
Average T:0.18574 C:0.29187 A:0.21725 G:0.30514
#5: NZ_CP029543_1_WP_010908644_1_2112_rpsD
position 1: T:0.11940 C:0.34826 A:0.21891 G:0.31343
position 2: T:0.28358 C:0.15423 A:0.34328 G:0.21891
position 3: T:0.15423 C:0.37313 A:0.08955 G:0.38308
Average T:0.18574 C:0.29187 A:0.21725 G:0.30514
#6: NZ_AP014567_1_WP_010908644_1_2171_rpsD
position 1: T:0.11940 C:0.34826 A:0.21891 G:0.31343
position 2: T:0.28358 C:0.15423 A:0.34328 G:0.21891
position 3: T:0.15423 C:0.37313 A:0.08955 G:0.38308
Average T:0.18574 C:0.29187 A:0.21725 G:0.30514
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 30 | TCC 0 | TAC 60 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 24 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 42
CTC 18 | CCC 24 | CAC 24 | CGC 48
CTA 6 | CCA 0 | Gln Q CAA 24 | CGA 6
CTG 54 | CCG 30 | CAG 66 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 12
ATC 72 | ACC 18 | AAC 12 | AGC 24
ATA 0 | ACA 6 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 18 | ACG 12 | AAG 54 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 12 | Asp D GAT 24 | Gly G GGT 24
GTC 42 | GCC 18 | GAC 24 | GGC 36
GTA 6 | GCA 0 | Glu E GAA 42 | GGA 12
GTG 48 | GCG 24 | GAG 54 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.11940 C:0.34826 A:0.21891 G:0.31343
position 2: T:0.28358 C:0.15423 A:0.34328 G:0.21891
position 3: T:0.15423 C:0.37313 A:0.08955 G:0.38308
Average T:0.18574 C:0.29187 A:0.21725 G:0.30514
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -779.965131 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.288748
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908644_1_2090_MLBR_RS09925: 0.000004, NC_002677_1_NP_302323_1_1195_rpsD: 0.000004, NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475: 0.000004, NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785: 0.000004, NZ_CP029543_1_WP_010908644_1_2112_rpsD: 0.000004, NZ_AP014567_1_WP_010908644_1_2171_rpsD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 1.28875
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 508.7 94.3 1.2887 0.0000 0.0000 0.0 0.0
7..2 0.000 508.7 94.3 1.2887 0.0000 0.0000 0.0 0.0
7..3 0.000 508.7 94.3 1.2887 0.0000 0.0000 0.0 0.0
7..4 0.000 508.7 94.3 1.2887 0.0000 0.0000 0.0 0.0
7..5 0.000 508.7 94.3 1.2887 0.0000 0.0000 0.0 0.0
7..6 0.000 508.7 94.3 1.2887 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -779.965005 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908644_1_2090_MLBR_RS09925: 0.000004, NC_002677_1_NP_302323_1_1195_rpsD: 0.000004, NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475: 0.000004, NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785: 0.000004, NZ_CP029543_1_WP_010908644_1_2112_rpsD: 0.000004, NZ_AP014567_1_WP_010908644_1_2171_rpsD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -779.965105 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.621545 0.225565 0.000001 1.247318
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908644_1_2090_MLBR_RS09925: 0.000004, NC_002677_1_NP_302323_1_1195_rpsD: 0.000004, NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475: 0.000004, NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785: 0.000004, NZ_CP029543_1_WP_010908644_1_2112_rpsD: 0.000004, NZ_AP014567_1_WP_010908644_1_2171_rpsD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.62154 0.22557 0.15289
w: 0.00000 1.00000 1.24732
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 508.7 94.3 0.4163 0.0000 0.0000 0.0 0.0
7..2 0.000 508.7 94.3 0.4163 0.0000 0.0000 0.0 0.0
7..3 0.000 508.7 94.3 0.4163 0.0000 0.0000 0.0 0.0
7..4 0.000 508.7 94.3 0.4163 0.0000 0.0000 0.0 0.0
7..5 0.000 508.7 94.3 0.4163 0.0000 0.0000 0.0 0.0
7..6 0.000 508.7 94.3 0.4163 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908644_1_2090_MLBR_RS09925)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908644_1_2090_MLBR_RS09925)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -779.965005 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.997172
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908644_1_2090_MLBR_RS09925: 0.000004, NC_002677_1_NP_302323_1_1195_rpsD: 0.000004, NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475: 0.000004, NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785: 0.000004, NZ_CP029543_1_WP_010908644_1_2112_rpsD: 0.000004, NZ_AP014567_1_WP_010908644_1_2171_rpsD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 0.99717
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00004
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -779.965005 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 40.392129 1.535573
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908644_1_2090_MLBR_RS09925: 0.000004, NC_002677_1_NP_302323_1_1195_rpsD: 0.000004, NZ_LVXE01000050_1_WP_010908644_1_2123_A3216_RS11475: 0.000004, NZ_LYPH01000079_1_WP_010908644_1_2656_A8144_RS12785: 0.000004, NZ_CP029543_1_WP_010908644_1_2112_rpsD: 0.000004, NZ_AP014567_1_WP_010908644_1_2171_rpsD: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 40.39213
(p1 = 0.00001) w = 1.53557
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.53557
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 508.7 94.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908644_1_2090_MLBR_RS09925)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.106 0.104 0.103 0.102 0.101 0.099 0.098 0.097 0.096 0.094
Time used: 0:25
Model 1: NearlyNeutral -779.965005 Model 2: PositiveSelection -779.965105 Model 0: one-ratio -779.965131 Model 7: beta -779.965005 Model 8: beta&w>1 -779.965005 Model 0 vs 1 2.520000000458822E-4 Model 2 vs 1 1.999999999497959E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
