--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 15:16:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/11res/rpsD/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -825.43          -827.81
2       -825.48          -828.92
--------------------------------------
TOTAL     -825.45          -828.51
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.901742    0.091404    0.388019    1.527727    0.873962   1375.92   1438.46    1.000
r(A<->C){all}   0.175366    0.021393    0.000021    0.474018    0.135516    268.45    273.78    1.000
r(A<->G){all}   0.159486    0.018451    0.000064    0.429465    0.121300     89.10    236.02    1.001
r(A<->T){all}   0.163765    0.019931    0.000023    0.446071    0.125153    176.91    188.00    1.003
r(C<->G){all}   0.165156    0.020004    0.000037    0.450170    0.129160    160.19    188.82    1.003
r(C<->T){all}   0.164775    0.020301    0.000113    0.446831    0.125995    142.82    232.74    1.000
r(G<->T){all}   0.171452    0.021909    0.000011    0.469094    0.129492     95.88    120.17    1.010
pi(A){all}      0.217930    0.000285    0.186038    0.251278    0.217836   1082.65   1095.13    1.000
pi(C){all}      0.291273    0.000340    0.254464    0.326423    0.290762   1345.43   1358.52    1.000
pi(G){all}      0.304685    0.000352    0.267899    0.340114    0.304274   1163.26   1285.33    1.000
pi(T){all}      0.186112    0.000248    0.157413    0.218566    0.185981   1120.30   1160.47    1.000
alpha{1,2}      0.415517    0.223336    0.000163    1.357792    0.255930   1014.46   1208.36    1.001
alpha{3}        0.452236    0.223850    0.000138    1.357836    0.296607   1179.04   1284.75    1.000
pinvar{all}     0.997418    0.000009    0.991741    1.000000    0.998423   1126.43   1296.01    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-779.965005
Model 2: PositiveSelection	-779.965105
Model 0: one-ratio	-779.965131
Model 7: beta	-779.965005
Model 8: beta&w>1	-779.965005


Model 0 vs 1	2.520000000458822E-4

Model 2 vs 1	1.999999999497959E-4

Model 8 vs 7	0.0
>C1
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C2
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C3
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C4
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C5
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C6
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=201 

C1              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C2              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C3              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C4              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C5              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C6              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
                **************************************************

C1              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C2              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C3              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C4              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C5              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C6              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
                **************************************************

C1              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C2              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C3              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C4              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C5              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C6              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
                **************************************************

C1              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C2              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C3              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C4              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C5              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C6              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
                **************************************************

C1              K
C2              K
C3              K
C4              K
C5              K
C6              K
                *




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6030]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6030]--->[6030]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.481 Mb, Max= 30.744 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C2              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C3              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C4              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C5              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
C6              MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
                **************************************************

C1              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C2              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C3              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C4              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C5              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
C6              QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
                **************************************************

C1              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C2              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C3              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C4              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C5              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
C6              GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
                **************************************************

C1              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C2              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C3              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C4              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C5              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
C6              QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
                **************************************************

C1              K
C2              K
C3              K
C4              K
C5              K
C6              K
                *




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C2              ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C3              ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C4              ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C5              ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
C6              ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
                **************************************************

C1              CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C2              CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C3              CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C4              CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C5              CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
C6              CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
                **************************************************

C1              GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C2              GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C3              GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C4              GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C5              GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
C6              GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
                **************************************************

C1              CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C2              CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C3              CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C4              CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C5              CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
C6              CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
                **************************************************

C1              CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C2              CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C3              CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C4              CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C5              CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
C6              CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
                **************************************************

C1              AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C2              AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C3              AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C4              AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C5              AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
C6              AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
                **************************************************

C1              GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C2              GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C3              GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C4              GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C5              GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
C6              GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
                **************************************************

C1              CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C2              CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C3              CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C4              CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C5              CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
C6              CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
                **************************************************

C1              AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C2              AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C3              AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C4              AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C5              AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
C6              AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
                **************************************************

C1              CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C2              CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C3              CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C4              CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C5              CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
C6              CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
                **************************************************

C1              GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C2              GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C3              GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C4              GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C5              GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
C6              GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
                **************************************************

C1              TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C2              TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C3              TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C4              TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C5              TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
C6              TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
                **************************************************

C1              AAG
C2              AAG
C3              AAG
C4              AAG
C5              AAG
C6              AAG
                ***



>C1
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C2
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C3
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C4
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C5
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C6
ATGGCTCGTTACACTGGACCCATCACCCGCAAATCGCGCCGGCTGCGTAT
CGACCTCGTCGGCGGCGATCAGGCGTTCGAGAAGCGTCCTTACCCGCCCG
GCCAGCACGGCCGCGCGCGGATCAAGGAAAGTGAATATCTGCTGCAGCTG
CAGGAGAAGCAGAAGGCCCGCTTCACCTACGGCGTAATGGAAAAGCAGTT
CCGCCGTTACTACGAAGAGGCTGTGCGGCAACCTGGTAAGACGGGTGAGG
AATTGCTGAAGATCCTGGAAAGTCGGCTCGATAACGTGATCTACCGTGCC
GGACTGGCGCGCACCCGCCGGATGGCCCGTCAGCTTGTCAGCCACGGGCA
CTTCAGCGTCAACGGCGTGCATGTCAATGTCCCCAGCTACCGGGTGTCGC
AGTACGACATTATCGATATTCGGGACAAGTCGCTAGATACGGTGCCGTTC
CAAATCGCGCGGGAGACAGTGGGTGACCGACCGATCCCGAGCTGGTTGCA
GGTCGTTGGTGAGCATCAACGCATCCTGATCCACCAATTGCCCGAGCGTG
TGCAGATTGAAGTGCCGCTCATCGAGCAGCTGATCGTCGAGTACTACTCG
AAG
>C1
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C2
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C3
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C4
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C5
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K
>C6
MARYTGPITRKSRRLRIDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDIRDKSLDTVPF
QIARETVGDRPIPSWLQVVGEHQRILIHQLPERVQIEVPLIEQLIVEYYS
K


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 603 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579792473
      Setting output file names to "/data/11res/rpsD/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2094908471
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0651545885
      Seed = 2058883618
      Swapseed = 1579792473
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1349.542704 -- -24.965149
         Chain 2 -- -1349.542910 -- -24.965149
         Chain 3 -- -1349.542910 -- -24.965149
         Chain 4 -- -1349.542910 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1349.542832 -- -24.965149
         Chain 2 -- -1349.542910 -- -24.965149
         Chain 3 -- -1349.542910 -- -24.965149
         Chain 4 -- -1349.542910 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1349.543] (-1349.543) (-1349.543) (-1349.543) * [-1349.543] (-1349.543) (-1349.543) (-1349.543) 
        500 -- (-838.836) [-838.559] (-841.968) (-832.093) * (-838.557) (-847.573) [-833.185] (-838.972) -- 0:00:00
       1000 -- (-836.572) [-833.462] (-831.598) (-829.438) * (-845.216) (-841.631) [-834.564] (-832.211) -- 0:00:00
       1500 -- (-836.277) [-833.801] (-836.331) (-832.077) * [-838.770] (-834.865) (-843.995) (-838.484) -- 0:00:00
       2000 -- (-842.258) (-830.145) [-830.959] (-837.226) * (-838.597) [-835.164] (-838.713) (-834.124) -- 0:00:00
       2500 -- (-830.991) (-835.027) (-836.766) [-837.508] * [-832.229] (-834.741) (-845.167) (-831.750) -- 0:00:00
       3000 -- (-837.999) (-831.513) (-832.465) [-831.328] * (-835.522) (-828.328) [-835.246] (-835.156) -- 0:00:00
       3500 -- (-834.469) [-832.630] (-830.119) (-831.763) * (-835.978) [-830.611] (-831.303) (-830.703) -- 0:00:00
       4000 -- (-837.068) [-830.959] (-833.963) (-833.577) * (-846.890) [-833.344] (-833.602) (-834.654) -- 0:00:00
       4500 -- [-830.268] (-836.532) (-833.810) (-839.639) * [-834.193] (-836.328) (-833.575) (-833.860) -- 0:00:00
       5000 -- (-841.137) (-832.511) [-832.605] (-832.514) * (-842.025) [-833.151] (-831.205) (-833.338) -- 0:00:00

      Average standard deviation of split frequencies: 0.088815

       5500 -- [-833.608] (-834.417) (-837.571) (-841.350) * (-833.289) [-834.074] (-836.049) (-839.758) -- 0:00:00
       6000 -- (-838.113) [-832.162] (-835.399) (-834.445) * [-837.300] (-833.914) (-837.720) (-838.978) -- 0:00:00
       6500 -- (-835.849) (-840.394) (-833.293) [-834.635] * (-837.371) (-834.100) [-829.540] (-829.843) -- 0:00:00
       7000 -- (-841.200) [-837.582] (-839.337) (-838.147) * [-832.577] (-831.518) (-840.260) (-832.736) -- 0:00:00
       7500 -- (-838.512) (-835.358) [-831.833] (-842.593) * (-841.237) [-838.812] (-843.114) (-832.425) -- 0:00:00
       8000 -- [-836.918] (-842.686) (-833.559) (-842.195) * [-831.072] (-832.514) (-834.055) (-841.415) -- 0:00:00
       8500 -- (-833.980) [-831.077] (-829.553) (-839.693) * (-836.597) (-835.874) (-836.138) [-835.557] -- 0:00:00
       9000 -- (-835.866) [-838.395] (-833.255) (-848.249) * (-847.714) [-836.482] (-846.260) (-833.144) -- 0:00:00
       9500 -- (-840.710) (-833.882) [-830.662] (-839.684) * [-830.348] (-838.715) (-840.646) (-833.601) -- 0:00:00
      10000 -- [-837.918] (-834.623) (-836.420) (-844.420) * (-831.035) [-835.588] (-825.876) (-834.435) -- 0:00:00

      Average standard deviation of split frequencies: 0.046404

      10500 -- (-833.520) (-838.276) (-833.705) [-836.783] * (-834.632) [-830.680] (-827.140) (-837.465) -- 0:00:00
      11000 -- [-832.552] (-841.938) (-833.973) (-838.689) * (-832.721) (-838.858) [-827.333] (-831.657) -- 0:00:00
      11500 -- [-832.469] (-842.091) (-835.481) (-824.929) * (-837.954) [-837.941] (-829.578) (-835.403) -- 0:01:25
      12000 -- [-829.188] (-831.934) (-839.028) (-824.988) * [-838.227] (-830.003) (-828.964) (-839.371) -- 0:01:22
      12500 -- (-836.706) (-834.111) [-836.083] (-824.230) * (-835.291) [-835.337] (-826.461) (-835.416) -- 0:01:19
      13000 -- [-841.351] (-833.463) (-834.088) (-826.645) * [-836.887] (-833.423) (-829.833) (-836.957) -- 0:01:15
      13500 -- (-831.444) [-832.156] (-838.710) (-826.007) * [-832.228] (-832.516) (-827.144) (-840.401) -- 0:01:13
      14000 -- (-839.342) (-843.193) [-833.222] (-825.317) * (-839.751) (-835.331) [-826.575] (-835.100) -- 0:01:10
      14500 -- (-836.915) (-835.255) (-831.078) [-824.336] * (-834.408) (-837.876) (-824.801) [-830.669] -- 0:01:07
      15000 -- (-833.379) (-845.429) (-835.766) [-826.292] * (-834.244) (-833.854) [-826.660] (-833.053) -- 0:01:05

      Average standard deviation of split frequencies: 0.047140

      15500 -- (-835.728) [-838.106] (-833.229) (-825.934) * [-830.970] (-836.447) (-831.164) (-838.232) -- 0:01:03
      16000 -- (-836.087) [-834.549] (-832.266) (-825.794) * (-835.612) (-828.235) [-824.530] (-841.425) -- 0:01:01
      16500 -- (-837.433) (-832.212) (-837.183) [-825.857] * (-832.653) [-839.130] (-827.929) (-837.094) -- 0:00:59
      17000 -- [-835.025] (-832.722) (-835.490) (-824.536) * [-834.587] (-835.502) (-825.617) (-840.398) -- 0:00:57
      17500 -- (-836.604) (-835.030) (-831.671) [-826.051] * (-842.485) [-834.466] (-826.724) (-838.403) -- 0:00:56
      18000 -- [-833.886] (-836.077) (-837.851) (-831.600) * (-840.483) (-839.491) (-826.729) [-838.099] -- 0:00:54
      18500 -- (-843.692) [-835.107] (-837.329) (-825.814) * (-836.943) (-836.626) [-826.080] (-840.042) -- 0:00:53
      19000 -- [-833.484] (-840.833) (-836.198) (-824.272) * (-825.707) (-838.632) (-827.634) [-832.308] -- 0:00:51
      19500 -- (-852.247) [-836.516] (-841.541) (-826.554) * (-829.164) (-841.050) (-826.680) [-832.219] -- 0:00:50
      20000 -- [-838.460] (-840.015) (-834.612) (-824.058) * (-827.658) (-832.914) (-826.328) [-833.274] -- 0:00:49

      Average standard deviation of split frequencies: 0.042936

      20500 -- (-824.533) (-832.056) [-832.926] (-828.533) * (-826.179) (-829.222) [-826.485] (-857.480) -- 0:00:47
      21000 -- (-824.346) [-833.484] (-836.765) (-826.202) * (-826.129) (-832.303) [-827.471] (-849.590) -- 0:00:46
      21500 -- (-829.903) (-832.218) (-841.789) [-824.314] * (-827.906) (-835.093) [-827.873] (-826.957) -- 0:00:45
      22000 -- [-828.191] (-837.568) (-830.001) (-825.358) * (-826.740) (-834.269) (-827.926) [-827.784] -- 0:00:44
      22500 -- [-828.071] (-838.503) (-831.484) (-826.920) * (-826.634) (-834.584) (-827.026) [-828.428] -- 0:00:43
      23000 -- [-825.305] (-836.543) (-831.941) (-824.783) * (-825.791) (-829.587) (-824.678) [-830.184] -- 0:00:42
      23500 -- (-827.872) (-837.155) [-832.348] (-824.450) * (-826.663) [-832.365] (-826.643) (-828.599) -- 0:00:41
      24000 -- [-828.973] (-837.091) (-840.851) (-828.783) * (-825.852) (-834.648) [-826.479] (-825.012) -- 0:00:40
      24500 -- (-826.766) (-836.977) (-837.819) [-827.488] * (-826.935) (-836.166) (-824.745) [-826.526] -- 0:00:39
      25000 -- (-826.502) (-838.290) [-840.026] (-828.547) * (-830.691) (-842.954) (-824.787) [-824.936] -- 0:00:39

      Average standard deviation of split frequencies: 0.039125

      25500 -- (-826.403) [-836.224] (-839.875) (-828.792) * (-825.776) (-839.317) [-823.953] (-825.665) -- 0:00:38
      26000 -- (-826.637) [-836.856] (-838.345) (-828.564) * (-825.678) [-826.944] (-824.861) (-831.108) -- 0:00:37
      26500 -- (-824.648) [-830.871] (-841.736) (-825.681) * (-827.140) (-826.683) (-825.240) [-824.933] -- 0:01:13
      27000 -- (-824.447) (-838.820) (-837.103) [-825.806] * (-826.566) [-826.675] (-825.720) (-830.621) -- 0:01:12
      27500 -- (-824.327) (-830.889) [-835.530] (-824.114) * [-827.415] (-826.911) (-826.176) (-824.776) -- 0:01:10
      28000 -- (-826.324) [-834.681] (-833.405) (-827.638) * (-827.706) (-828.607) [-825.378] (-824.622) -- 0:01:09
      28500 -- (-824.124) (-827.983) (-838.947) [-825.413] * (-826.411) (-828.476) [-824.368] (-829.020) -- 0:01:08
      29000 -- (-824.372) (-835.475) [-836.299] (-824.782) * [-830.405] (-824.574) (-826.092) (-824.155) -- 0:01:06
      29500 -- [-824.398] (-840.103) (-834.654) (-824.894) * [-826.870] (-827.232) (-825.517) (-824.033) -- 0:01:05
      30000 -- (-825.328) (-839.053) (-841.748) [-827.178] * [-824.690] (-826.685) (-826.944) (-825.436) -- 0:01:04

      Average standard deviation of split frequencies: 0.041261

      30500 -- (-831.034) (-830.708) [-835.678] (-827.466) * (-827.240) (-825.983) (-825.806) [-825.120] -- 0:01:03
      31000 -- [-827.073] (-829.300) (-843.388) (-826.121) * [-825.508] (-831.370) (-824.768) (-825.564) -- 0:01:02
      31500 -- (-826.739) (-829.576) [-838.463] (-826.422) * (-825.444) (-825.197) [-824.619] (-825.195) -- 0:01:01
      32000 -- [-825.173] (-833.755) (-843.627) (-824.402) * (-826.486) (-830.109) (-826.142) [-827.244] -- 0:01:00
      32500 -- (-826.182) [-829.137] (-834.662) (-825.532) * [-825.877] (-826.996) (-825.505) (-825.449) -- 0:00:59
      33000 -- (-823.959) (-831.197) (-832.170) [-824.113] * (-826.489) (-832.129) (-826.645) [-823.836] -- 0:00:58
      33500 -- (-830.520) (-828.740) (-835.277) [-823.915] * (-828.358) (-825.879) (-827.046) [-824.794] -- 0:00:57
      34000 -- (-826.690) (-834.124) [-836.474] (-825.281) * [-826.876] (-828.396) (-826.377) (-825.042) -- 0:00:56
      34500 -- (-824.863) [-836.718] (-833.979) (-824.991) * (-828.147) (-826.025) [-825.457] (-826.460) -- 0:00:55
      35000 -- (-826.093) (-833.029) [-829.934] (-825.211) * (-826.278) (-826.358) (-824.953) [-824.490] -- 0:00:55

      Average standard deviation of split frequencies: 0.033770

      35500 -- [-826.113] (-838.723) (-849.809) (-826.438) * (-825.711) (-825.643) (-826.407) [-824.267] -- 0:00:54
      36000 -- (-824.485) (-839.855) (-837.656) [-825.377] * (-827.646) (-826.757) [-825.011] (-824.376) -- 0:00:53
      36500 -- [-825.007] (-833.953) (-836.489) (-826.908) * (-825.067) (-827.758) [-825.013] (-824.670) -- 0:00:52
      37000 -- (-829.654) (-841.479) [-833.016] (-827.865) * (-825.734) (-827.510) [-825.252] (-825.403) -- 0:00:52
      37500 -- (-829.948) [-829.457] (-847.908) (-825.435) * [-827.959] (-825.734) (-823.979) (-825.296) -- 0:00:51
      38000 -- (-825.980) [-834.501] (-829.619) (-824.690) * (-826.640) (-828.210) (-827.273) [-832.917] -- 0:00:50
      38500 -- [-826.456] (-838.284) (-840.670) (-826.654) * (-824.475) (-832.685) [-830.090] (-826.769) -- 0:00:49
      39000 -- (-828.250) [-831.488] (-833.914) (-824.877) * [-823.934] (-831.470) (-829.629) (-829.856) -- 0:00:49
      39500 -- [-826.624] (-834.228) (-837.937) (-825.502) * (-823.852) [-825.616] (-828.780) (-824.607) -- 0:00:48
      40000 -- (-831.694) (-842.687) (-835.041) [-825.187] * (-827.639) (-826.375) (-826.439) [-828.938] -- 0:00:48

      Average standard deviation of split frequencies: 0.031725

      40500 -- (-832.287) (-842.541) (-836.449) [-824.635] * (-825.193) (-825.040) (-826.439) [-829.091] -- 0:00:47
      41000 -- (-827.255) [-838.730] (-840.719) (-825.189) * [-824.893] (-826.829) (-824.664) (-829.534) -- 0:00:46
      41500 -- (-830.806) (-835.229) [-841.213] (-824.603) * (-826.505) [-825.319] (-824.005) (-828.431) -- 0:00:46
      42000 -- (-825.512) (-834.578) (-825.837) [-826.470] * (-824.700) (-825.894) [-824.086] (-828.003) -- 0:00:45
      42500 -- (-827.081) (-835.524) [-826.020] (-824.995) * (-825.007) (-824.555) [-826.573] (-828.847) -- 0:00:45
      43000 -- [-827.647] (-830.326) (-826.563) (-826.945) * (-825.733) (-827.356) (-829.759) [-824.745] -- 0:01:06
      43500 -- (-828.615) (-831.820) [-826.965] (-825.101) * (-824.832) (-826.383) (-828.195) [-825.325] -- 0:01:05
      44000 -- (-828.653) (-832.508) [-825.576] (-826.034) * (-824.481) (-827.394) (-827.574) [-824.281] -- 0:01:05
      44500 -- (-828.565) (-832.364) (-826.136) [-826.061] * (-825.419) (-827.532) (-825.272) [-824.472] -- 0:01:04
      45000 -- [-827.400] (-835.192) (-831.809) (-826.969) * (-825.301) (-828.487) (-826.649) [-825.197] -- 0:01:03

      Average standard deviation of split frequencies: 0.030278

      45500 -- (-826.042) [-838.027] (-827.816) (-825.850) * (-825.521) (-827.741) [-827.126] (-828.361) -- 0:01:02
      46000 -- (-825.594) (-837.406) [-826.461] (-827.125) * (-825.642) (-825.677) (-825.449) [-824.868] -- 0:01:02
      46500 -- (-831.033) (-837.857) (-827.910) [-825.951] * (-825.199) (-825.425) (-824.134) [-825.187] -- 0:01:01
      47000 -- (-828.110) (-834.611) [-826.937] (-825.201) * (-825.197) (-826.824) [-824.041] (-824.909) -- 0:01:00
      47500 -- (-827.857) [-842.502] (-828.641) (-830.493) * (-827.860) [-827.596] (-826.218) (-827.513) -- 0:01:00
      48000 -- (-824.528) [-835.567] (-826.109) (-827.304) * [-826.777] (-824.612) (-825.572) (-829.643) -- 0:00:59
      48500 -- [-827.072] (-837.416) (-825.862) (-826.446) * [-827.122] (-825.901) (-825.947) (-824.930) -- 0:00:58
      49000 -- (-826.534) (-840.396) (-827.275) [-829.862] * (-827.478) [-825.053] (-828.640) (-825.278) -- 0:00:58
      49500 -- (-824.904) [-832.559] (-826.329) (-833.269) * (-826.934) (-827.035) [-826.629] (-825.634) -- 0:00:57
      50000 -- (-825.632) (-848.155) (-826.211) [-826.706] * (-828.185) [-827.218] (-824.721) (-825.704) -- 0:00:57

      Average standard deviation of split frequencies: 0.032564

      50500 -- (-825.687) [-829.351] (-824.745) (-826.512) * [-825.400] (-830.526) (-824.783) (-826.026) -- 0:00:56
      51000 -- (-827.013) (-830.206) (-824.460) [-827.434] * (-825.706) (-826.522) [-826.967] (-825.658) -- 0:00:55
      51500 -- [-828.449] (-834.584) (-825.598) (-827.761) * (-825.963) (-830.507) (-826.553) [-825.450] -- 0:00:55
      52000 -- (-826.143) [-836.099] (-825.059) (-826.648) * [-824.777] (-830.106) (-824.775) (-826.427) -- 0:00:54
      52500 -- (-824.230) [-839.891] (-825.406) (-828.586) * (-831.466) (-826.686) [-824.621] (-826.156) -- 0:00:54
      53000 -- (-826.297) (-835.820) (-826.809) [-826.849] * (-830.118) (-827.699) [-825.149] (-827.605) -- 0:00:53
      53500 -- (-825.199) (-837.566) (-827.871) [-824.535] * (-824.798) (-826.900) (-825.115) [-823.880] -- 0:00:53
      54000 -- (-826.994) [-828.868] (-827.494) (-824.698) * (-828.042) [-826.560] (-827.551) (-824.574) -- 0:00:52
      54500 -- [-828.893] (-828.726) (-825.488) (-825.344) * (-825.256) (-825.320) (-828.982) [-824.978] -- 0:00:52
      55000 -- (-825.379) (-827.772) [-824.141] (-827.347) * (-825.178) (-829.138) [-826.445] (-826.337) -- 0:00:51

      Average standard deviation of split frequencies: 0.026189

      55500 -- [-824.490] (-824.161) (-824.118) (-826.699) * (-824.482) [-826.826] (-826.466) (-827.988) -- 0:00:51
      56000 -- (-825.224) [-824.643] (-825.066) (-827.346) * [-824.240] (-827.999) (-829.394) (-826.390) -- 0:00:50
      56500 -- [-824.731] (-826.920) (-826.763) (-825.076) * (-825.275) [-825.813] (-830.403) (-825.626) -- 0:00:50
      57000 -- (-824.204) [-824.742] (-824.472) (-826.071) * (-824.860) [-830.555] (-829.363) (-826.341) -- 0:00:49
      57500 -- (-824.524) (-825.239) [-826.776] (-826.502) * (-826.080) (-830.639) (-829.016) [-826.152] -- 0:00:49
      58000 -- (-827.726) [-824.413] (-828.725) (-826.904) * [-824.792] (-825.988) (-825.770) (-826.048) -- 0:00:48
      58500 -- (-826.328) (-824.730) [-833.670] (-828.421) * (-826.584) [-825.420] (-826.173) (-824.285) -- 0:00:48
      59000 -- [-824.891] (-824.903) (-826.478) (-830.626) * (-825.167) (-825.756) (-828.782) [-825.532] -- 0:00:47
      59500 -- (-828.883) (-824.428) (-826.910) [-828.331] * (-826.628) [-825.262] (-831.246) (-827.818) -- 0:00:47
      60000 -- [-829.374] (-825.811) (-829.064) (-825.197) * [-825.172] (-824.746) (-828.035) (-828.581) -- 0:01:02

      Average standard deviation of split frequencies: 0.025140

      60500 -- (-829.395) (-824.723) (-824.873) [-825.540] * [-827.153] (-828.284) (-828.081) (-826.582) -- 0:01:02
      61000 -- (-825.293) (-825.634) (-825.906) [-826.449] * (-826.981) (-827.870) (-829.121) [-825.020] -- 0:01:01
      61500 -- (-825.918) (-825.815) (-826.978) [-825.375] * [-826.110] (-825.302) (-827.527) (-826.259) -- 0:01:01
      62000 -- (-826.390) (-824.971) [-825.719] (-825.091) * (-824.777) (-824.537) [-827.541] (-824.502) -- 0:01:00
      62500 -- (-826.420) [-827.053] (-824.702) (-824.266) * (-826.501) [-824.239] (-830.894) (-824.173) -- 0:01:00
      63000 -- (-827.816) (-829.510) [-825.508] (-827.490) * (-829.647) (-825.858) (-828.876) [-825.822] -- 0:00:59
      63500 -- (-824.996) (-828.495) [-825.791] (-827.684) * (-826.169) [-824.684] (-828.649) (-825.152) -- 0:00:58
      64000 -- (-829.529) [-825.765] (-826.897) (-827.216) * (-826.073) (-827.447) (-825.348) [-825.068] -- 0:00:58
      64500 -- (-829.710) (-824.520) [-828.031] (-824.589) * [-825.176] (-824.757) (-825.932) (-825.059) -- 0:00:58
      65000 -- [-830.731] (-826.989) (-830.606) (-825.211) * (-824.910) (-826.613) [-824.667] (-827.213) -- 0:00:57

      Average standard deviation of split frequencies: 0.026784

      65500 -- [-826.844] (-825.342) (-829.246) (-825.179) * [-826.370] (-824.447) (-824.776) (-825.820) -- 0:00:57
      66000 -- (-825.073) [-825.993] (-827.364) (-827.945) * (-826.000) [-824.746] (-825.766) (-826.248) -- 0:00:56
      66500 -- (-828.775) [-827.651] (-828.663) (-825.769) * (-826.985) (-824.054) (-824.909) [-825.925] -- 0:00:56
      67000 -- [-826.093] (-826.140) (-829.789) (-828.395) * (-826.463) (-826.512) (-826.306) [-825.999] -- 0:00:55
      67500 -- [-826.769] (-824.502) (-831.618) (-827.081) * [-827.428] (-827.754) (-828.161) (-824.953) -- 0:00:55
      68000 -- (-828.466) (-827.393) (-832.034) [-825.129] * [-825.591] (-826.903) (-828.674) (-827.343) -- 0:00:54
      68500 -- (-826.589) (-827.832) (-829.044) [-826.372] * (-827.750) [-827.369] (-825.002) (-827.719) -- 0:00:54
      69000 -- (-827.005) (-824.880) [-827.011] (-824.863) * (-830.772) (-829.745) [-824.440] (-824.606) -- 0:00:53
      69500 -- [-825.626] (-830.234) (-834.521) (-824.540) * [-826.449] (-824.992) (-824.715) (-825.983) -- 0:00:53
      70000 -- [-826.322] (-831.732) (-824.872) (-826.278) * (-826.695) (-824.274) (-825.422) [-826.507] -- 0:00:53

      Average standard deviation of split frequencies: 0.027385

      70500 -- (-825.934) [-827.147] (-825.525) (-825.422) * (-824.745) (-829.049) [-824.204] (-824.197) -- 0:00:52
      71000 -- (-825.165) (-826.140) (-824.501) [-827.574] * (-825.310) (-825.691) [-824.497] (-824.520) -- 0:00:52
      71500 -- (-826.535) (-826.715) (-830.988) [-835.332] * (-832.482) (-833.960) (-825.677) [-824.500] -- 0:00:51
      72000 -- (-827.264) (-826.281) [-828.521] (-827.731) * [-824.804] (-826.085) (-824.762) (-824.451) -- 0:00:51
      72500 -- [-828.554] (-828.712) (-829.628) (-825.658) * (-828.005) (-826.220) [-824.642] (-826.262) -- 0:00:51
      73000 -- (-829.740) (-824.256) [-827.964] (-826.918) * (-826.533) (-827.428) (-829.141) [-830.486] -- 0:00:50
      73500 -- (-826.518) [-825.478] (-825.794) (-826.354) * (-825.517) (-824.709) (-825.651) [-827.077] -- 0:00:50
      74000 -- [-824.873] (-830.855) (-827.005) (-830.740) * (-825.613) (-825.468) [-825.206] (-830.732) -- 0:00:50
      74500 -- (-825.577) [-824.828] (-827.748) (-824.621) * (-827.814) (-825.586) [-825.446] (-825.536) -- 0:00:49
      75000 -- (-824.176) (-825.406) (-829.525) [-825.207] * (-828.429) (-825.359) [-824.890] (-825.503) -- 0:00:49

      Average standard deviation of split frequencies: 0.023505

      75500 -- (-826.840) [-827.804] (-825.848) (-824.981) * (-827.593) (-825.030) (-824.757) [-825.841] -- 0:00:48
      76000 -- (-829.406) (-829.201) [-824.961] (-826.341) * [-827.391] (-826.570) (-827.581) (-827.633) -- 0:00:48
      76500 -- [-826.854] (-827.764) (-824.858) (-825.983) * (-825.791) (-827.541) (-825.165) [-827.797] -- 0:01:00
      77000 -- [-828.218] (-825.454) (-825.104) (-829.119) * (-825.692) (-828.115) (-826.742) [-827.159] -- 0:00:59
      77500 -- (-832.074) (-826.161) (-826.600) [-825.966] * [-825.804] (-827.860) (-825.286) (-829.456) -- 0:00:59
      78000 -- (-825.664) [-825.543] (-826.294) (-827.018) * [-825.550] (-833.705) (-827.903) (-827.564) -- 0:00:59
      78500 -- (-826.796) (-828.499) [-825.667] (-826.468) * [-826.616] (-829.885) (-826.173) (-825.081) -- 0:00:58
      79000 -- (-827.759) [-825.419] (-827.225) (-828.075) * (-826.253) (-828.749) [-827.260] (-826.775) -- 0:00:58
      79500 -- (-825.736) (-825.736) [-824.393] (-833.506) * [-824.562] (-829.276) (-826.119) (-824.803) -- 0:00:57
      80000 -- (-824.884) [-827.811] (-826.277) (-837.484) * (-825.205) [-827.425] (-826.245) (-825.776) -- 0:00:57

      Average standard deviation of split frequencies: 0.023068

      80500 -- (-825.404) (-829.234) [-826.949] (-831.515) * [-825.266] (-828.945) (-827.920) (-831.060) -- 0:00:57
      81000 -- (-825.190) (-825.525) [-827.364] (-828.552) * [-825.257] (-826.098) (-825.159) (-825.451) -- 0:00:56
      81500 -- (-824.916) [-827.466] (-828.731) (-825.362) * (-828.710) (-827.545) [-825.415] (-827.407) -- 0:00:56
      82000 -- (-825.742) (-825.529) (-833.308) [-826.192] * (-825.412) [-826.681] (-825.121) (-830.550) -- 0:00:55
      82500 -- [-824.718] (-824.908) (-824.733) (-826.834) * (-831.624) (-826.013) [-825.657] (-825.381) -- 0:00:55
      83000 -- (-828.625) [-824.726] (-824.787) (-827.612) * (-825.297) [-825.473] (-826.017) (-826.640) -- 0:00:55
      83500 -- [-824.576] (-827.160) (-825.061) (-829.523) * (-824.718) (-824.616) (-824.978) [-824.991] -- 0:00:54
      84000 -- (-827.229) (-825.257) [-825.135] (-829.290) * (-825.352) (-823.693) (-825.497) [-824.108] -- 0:00:54
      84500 -- (-824.836) (-828.288) [-828.343] (-827.553) * (-826.315) (-827.992) (-826.849) [-825.035] -- 0:00:54
      85000 -- (-825.638) [-827.342] (-825.479) (-828.923) * (-825.629) (-834.584) [-825.373] (-825.524) -- 0:00:53

      Average standard deviation of split frequencies: 0.022214

      85500 -- (-825.783) (-825.097) (-824.946) [-829.607] * (-826.116) (-826.523) (-824.933) [-826.177] -- 0:00:53
      86000 -- [-826.080] (-825.199) (-825.153) (-824.780) * (-825.693) [-824.737] (-824.885) (-831.255) -- 0:00:53
      86500 -- [-824.901] (-825.592) (-825.329) (-825.102) * (-825.630) [-827.401] (-826.907) (-828.952) -- 0:00:52
      87000 -- (-827.836) (-825.660) (-826.351) [-828.577] * (-826.984) (-828.993) (-827.933) [-826.387] -- 0:00:52
      87500 -- (-834.871) [-825.015] (-826.733) (-828.264) * (-827.747) (-827.422) [-826.768] (-828.512) -- 0:00:52
      88000 -- (-834.366) (-826.057) (-824.395) [-825.542] * (-825.592) (-826.376) (-827.724) [-827.765] -- 0:00:51
      88500 -- (-829.694) (-826.869) (-825.728) [-824.693] * (-825.519) (-825.972) (-830.499) [-827.937] -- 0:00:51
      89000 -- (-826.039) (-826.618) (-826.009) [-827.348] * [-825.322] (-826.077) (-827.695) (-830.942) -- 0:00:51
      89500 -- [-826.042] (-826.214) (-825.024) (-825.184) * (-825.969) (-827.053) [-825.743] (-827.694) -- 0:00:50
      90000 -- (-827.324) (-826.986) [-825.178] (-826.987) * (-826.636) [-828.843] (-825.000) (-826.987) -- 0:00:50

      Average standard deviation of split frequencies: 0.022097

      90500 -- (-827.580) (-825.919) [-824.464] (-826.167) * (-825.860) (-831.685) [-825.213] (-825.044) -- 0:00:50
      91000 -- (-825.485) (-826.820) (-825.600) [-824.898] * (-824.514) (-831.934) [-826.209] (-826.362) -- 0:00:49
      91500 -- (-826.794) (-826.071) (-825.289) [-824.431] * (-826.196) (-824.207) [-825.670] (-830.271) -- 0:00:49
      92000 -- [-832.084] (-827.803) (-826.956) (-824.242) * (-828.579) (-825.098) [-824.893] (-827.962) -- 0:00:49
      92500 -- (-828.684) (-828.510) (-824.193) [-824.879] * [-827.782] (-825.407) (-826.220) (-828.065) -- 0:00:58
      93000 -- (-827.116) [-826.917] (-824.685) (-826.447) * (-828.066) [-825.466] (-826.145) (-826.375) -- 0:00:58
      93500 -- [-827.554] (-824.269) (-826.600) (-826.556) * (-825.348) [-826.429] (-830.599) (-829.583) -- 0:00:58
      94000 -- (-825.910) (-826.244) (-825.726) [-829.889] * (-825.008) [-824.541] (-830.641) (-824.528) -- 0:00:57
      94500 -- (-826.129) (-826.575) [-825.217] (-827.834) * [-826.162] (-829.277) (-826.297) (-826.534) -- 0:00:57
      95000 -- (-829.158) (-825.122) [-823.998] (-835.695) * [-824.749] (-825.445) (-829.246) (-827.511) -- 0:00:57

      Average standard deviation of split frequencies: 0.019642

      95500 -- [-829.521] (-825.644) (-829.291) (-829.940) * (-824.807) (-825.201) [-824.419] (-825.799) -- 0:00:56
      96000 -- (-826.017) (-826.991) (-832.057) [-826.008] * (-834.474) [-826.403] (-825.593) (-825.467) -- 0:00:56
      96500 -- [-825.004] (-827.319) (-827.511) (-826.030) * [-827.042] (-825.884) (-825.711) (-829.885) -- 0:00:56
      97000 -- (-827.482) [-828.227] (-826.120) (-824.367) * (-826.583) (-826.095) (-826.955) [-825.786] -- 0:00:55
      97500 -- (-829.429) (-829.704) [-825.241] (-825.452) * (-825.165) (-826.995) [-827.074] (-826.329) -- 0:00:55
      98000 -- (-824.948) (-825.712) [-826.956] (-825.743) * [-824.551] (-824.704) (-825.232) (-826.702) -- 0:00:55
      98500 -- (-827.329) [-825.868] (-828.754) (-824.981) * (-827.789) [-825.087] (-825.649) (-825.650) -- 0:00:54
      99000 -- (-828.263) (-825.654) (-827.896) [-824.716] * (-826.847) [-824.664] (-826.632) (-825.630) -- 0:00:54
      99500 -- (-828.749) [-825.773] (-824.936) (-825.759) * (-829.547) [-825.261] (-823.994) (-826.052) -- 0:00:54
      100000 -- (-824.692) (-825.560) [-824.833] (-824.795) * (-831.046) (-826.026) (-829.417) [-825.783] -- 0:00:54

      Average standard deviation of split frequencies: 0.020384

      100500 -- [-825.689] (-826.069) (-824.319) (-827.541) * (-827.067) (-824.172) [-826.503] (-827.150) -- 0:00:53
      101000 -- (-826.554) (-826.872) [-828.245] (-826.466) * (-827.398) (-825.216) [-826.372] (-825.235) -- 0:00:53
      101500 -- (-828.727) (-825.688) [-826.836] (-824.714) * (-828.575) (-824.991) (-825.361) [-826.626] -- 0:00:53
      102000 -- (-827.740) [-825.368] (-827.581) (-826.760) * [-826.233] (-826.053) (-828.558) (-825.111) -- 0:00:52
      102500 -- (-828.029) (-825.163) (-827.906) [-826.495] * (-826.659) (-825.421) [-827.657] (-824.952) -- 0:00:52
      103000 -- (-827.626) [-825.426] (-828.492) (-827.091) * (-825.655) (-827.659) [-826.222] (-824.267) -- 0:00:52
      103500 -- (-824.232) (-825.133) [-824.619] (-824.059) * [-825.061] (-827.016) (-824.455) (-823.911) -- 0:00:51
      104000 -- (-824.213) [-825.379] (-825.805) (-826.988) * (-826.389) (-827.206) (-825.307) [-823.905] -- 0:00:51
      104500 -- (-826.177) [-825.336] (-826.106) (-826.030) * (-828.403) [-828.914] (-825.721) (-825.057) -- 0:00:51
      105000 -- (-824.215) (-825.211) [-828.204] (-827.910) * (-825.545) (-826.792) (-826.623) [-826.954] -- 0:00:51

      Average standard deviation of split frequencies: 0.020330

      105500 -- [-825.299] (-825.322) (-829.981) (-825.996) * (-825.457) (-827.432) (-826.616) [-827.024] -- 0:00:50
      106000 -- [-825.646] (-826.713) (-827.022) (-826.833) * [-825.066] (-826.356) (-826.771) (-828.872) -- 0:00:50
      106500 -- (-825.978) (-828.543) [-824.266] (-825.349) * [-826.595] (-826.143) (-824.571) (-831.966) -- 0:00:50
      107000 -- [-826.039] (-828.515) (-825.008) (-827.419) * [-824.979] (-824.577) (-827.700) (-826.557) -- 0:00:50
      107500 -- (-825.604) (-828.145) (-825.853) [-824.831] * (-826.551) [-824.531] (-826.355) (-827.799) -- 0:00:49
      108000 -- (-826.608) [-826.192] (-824.999) (-824.240) * [-825.534] (-829.003) (-826.431) (-826.348) -- 0:00:49
      108500 -- [-827.679] (-827.403) (-824.947) (-827.272) * [-826.619] (-827.883) (-825.771) (-826.132) -- 0:00:49
      109000 -- (-825.000) (-831.125) [-827.102] (-826.713) * (-825.613) [-824.909] (-824.142) (-827.086) -- 0:00:49
      109500 -- (-824.850) (-830.258) (-826.017) [-826.609] * [-824.905] (-830.981) (-830.000) (-826.283) -- 0:00:56
      110000 -- (-824.398) [-827.221] (-826.297) (-827.757) * [-825.885] (-827.198) (-825.693) (-826.296) -- 0:00:56

      Average standard deviation of split frequencies: 0.021085

      110500 -- (-824.782) [-827.770] (-826.332) (-829.082) * (-828.196) (-824.941) [-824.279] (-826.541) -- 0:00:56
      111000 -- [-825.930] (-823.898) (-827.163) (-829.814) * (-825.724) (-827.025) (-827.561) [-825.348] -- 0:00:56
      111500 -- (-826.999) (-826.144) (-827.000) [-826.762] * [-825.324] (-826.576) (-827.777) (-824.504) -- 0:00:55
      112000 -- (-827.003) [-824.330] (-825.613) (-826.125) * [-824.141] (-826.668) (-825.966) (-824.947) -- 0:00:55
      112500 -- (-824.565) [-824.456] (-826.536) (-826.379) * (-824.163) (-825.481) (-826.913) [-827.644] -- 0:00:55
      113000 -- (-824.540) [-824.465] (-827.856) (-827.852) * (-826.025) (-827.430) [-826.808] (-833.691) -- 0:00:54
      113500 -- (-826.990) (-826.192) [-826.423] (-825.359) * (-827.785) (-827.676) [-829.758] (-826.465) -- 0:00:54
      114000 -- [-826.313] (-826.192) (-827.237) (-825.696) * (-828.063) (-833.040) (-831.778) [-825.153] -- 0:00:54
      114500 -- (-826.750) (-825.784) (-828.047) [-830.665] * [-825.731] (-826.540) (-826.807) (-828.088) -- 0:00:54
      115000 -- (-826.468) (-824.533) (-825.665) [-825.996] * (-824.406) (-825.190) [-824.908] (-824.274) -- 0:00:53

      Average standard deviation of split frequencies: 0.021797

      115500 -- (-826.302) (-825.313) [-828.062] (-825.892) * (-826.688) [-827.028] (-830.080) (-824.747) -- 0:00:53
      116000 -- [-824.201] (-827.237) (-824.972) (-827.603) * [-825.437] (-826.923) (-834.492) (-825.498) -- 0:00:53
      116500 -- (-826.397) (-825.619) [-832.253] (-827.811) * (-826.401) (-825.451) (-826.717) [-825.023] -- 0:00:53
      117000 -- (-824.534) (-828.870) [-825.924] (-828.281) * (-827.032) [-825.501] (-824.895) (-824.915) -- 0:00:52
      117500 -- (-825.700) (-829.017) (-828.646) [-827.829] * (-827.929) (-825.336) (-824.920) [-828.913] -- 0:00:52
      118000 -- [-826.890] (-827.126) (-828.436) (-825.788) * (-826.102) (-827.062) [-825.114] (-827.530) -- 0:00:52
      118500 -- (-829.288) [-828.500] (-826.085) (-828.522) * (-826.059) (-826.271) (-825.035) [-826.955] -- 0:00:52
      119000 -- (-830.010) (-825.597) [-823.933] (-828.885) * (-829.525) (-826.371) (-826.715) [-824.902] -- 0:00:51
      119500 -- (-830.793) (-825.365) (-825.170) [-826.510] * (-826.143) (-826.956) [-827.450] (-830.017) -- 0:00:51
      120000 -- (-831.567) (-828.977) [-826.106] (-826.626) * [-824.603] (-828.062) (-826.434) (-827.929) -- 0:00:51

      Average standard deviation of split frequencies: 0.022659

      120500 -- (-828.899) (-828.357) [-824.523] (-825.070) * [-824.222] (-825.672) (-826.416) (-826.420) -- 0:00:51
      121000 -- (-824.663) (-824.682) [-827.160] (-825.953) * (-824.849) (-825.550) [-826.658] (-825.469) -- 0:00:50
      121500 -- (-825.554) [-827.656] (-830.235) (-826.370) * (-826.871) (-826.293) [-827.772] (-825.378) -- 0:00:50
      122000 -- (-825.072) [-826.295] (-826.473) (-824.620) * (-826.012) (-826.135) (-825.264) [-825.864] -- 0:00:50
      122500 -- (-825.225) (-828.108) [-827.050] (-824.928) * (-825.348) [-825.074] (-827.287) (-824.498) -- 0:00:50
      123000 -- (-828.570) [-830.061] (-828.664) (-824.304) * [-826.063] (-826.266) (-825.854) (-828.200) -- 0:00:49
      123500 -- (-824.883) [-828.190] (-832.322) (-824.076) * [-825.436] (-827.478) (-825.328) (-825.357) -- 0:00:49
      124000 -- [-824.737] (-828.097) (-826.735) (-826.062) * (-825.867) [-827.675] (-824.088) (-828.761) -- 0:00:49
      124500 -- [-824.580] (-828.590) (-826.511) (-824.597) * (-827.929) (-826.168) [-825.406] (-826.507) -- 0:00:49
      125000 -- (-825.907) [-828.140] (-826.956) (-826.835) * (-829.416) (-826.025) [-825.650] (-825.721) -- 0:00:49

      Average standard deviation of split frequencies: 0.022982

      125500 -- (-827.481) [-828.350] (-827.142) (-828.326) * (-825.663) (-826.728) [-825.989] (-832.114) -- 0:00:48
      126000 -- (-826.745) [-827.971] (-830.448) (-825.442) * (-832.141) (-824.804) (-824.441) [-827.064] -- 0:00:55
      126500 -- (-825.522) [-826.111] (-827.527) (-832.093) * [-825.492] (-826.130) (-825.224) (-824.251) -- 0:00:55
      127000 -- (-825.235) [-827.704] (-826.621) (-830.852) * (-827.428) [-826.202] (-825.671) (-824.321) -- 0:00:54
      127500 -- [-824.986] (-824.749) (-824.771) (-825.744) * (-825.240) [-825.667] (-825.452) (-825.161) -- 0:00:54
      128000 -- (-828.436) [-824.626] (-825.065) (-825.975) * (-824.409) [-826.122] (-826.796) (-824.736) -- 0:00:54
      128500 -- (-826.069) [-826.267] (-824.667) (-826.978) * (-824.749) [-827.667] (-826.243) (-824.192) -- 0:00:54
      129000 -- [-825.803] (-828.826) (-824.688) (-824.901) * [-824.666] (-827.212) (-829.914) (-823.892) -- 0:00:54
      129500 -- [-824.412] (-826.488) (-826.015) (-824.922) * (-823.778) (-826.702) [-829.382] (-824.047) -- 0:00:53
      130000 -- (-825.523) [-824.607] (-826.365) (-827.712) * [-823.895] (-825.451) (-827.142) (-824.424) -- 0:00:53

      Average standard deviation of split frequencies: 0.022187

      130500 -- (-824.765) [-825.319] (-826.688) (-831.783) * (-825.081) (-824.473) [-825.501] (-824.800) -- 0:00:53
      131000 -- [-824.309] (-828.372) (-826.775) (-833.321) * (-823.975) (-827.099) [-825.751] (-824.017) -- 0:00:53
      131500 -- (-823.998) (-828.908) (-824.460) [-828.915] * (-826.221) [-825.670] (-829.150) (-824.565) -- 0:00:52
      132000 -- (-824.715) (-832.806) (-824.830) [-825.230] * (-831.117) (-824.594) (-825.852) [-826.202] -- 0:00:52
      132500 -- [-825.730] (-831.172) (-825.022) (-825.340) * (-827.658) (-825.640) (-831.192) [-824.356] -- 0:00:52
      133000 -- (-828.905) (-828.288) (-824.407) [-825.100] * (-825.138) (-826.625) [-827.227] (-826.887) -- 0:00:52
      133500 -- [-824.873] (-826.731) (-825.604) (-825.635) * [-825.040] (-825.134) (-826.195) (-825.150) -- 0:00:51
      134000 -- [-826.454] (-825.512) (-825.001) (-824.752) * (-825.487) (-825.674) (-824.907) [-823.923] -- 0:00:51
      134500 -- [-825.588] (-826.765) (-826.574) (-825.761) * (-824.424) (-826.319) [-824.822] (-826.717) -- 0:00:51
      135000 -- [-828.196] (-825.166) (-827.050) (-827.216) * (-825.143) [-826.501] (-825.547) (-825.486) -- 0:00:51

      Average standard deviation of split frequencies: 0.020451

      135500 -- (-827.540) [-826.271] (-825.355) (-828.739) * [-825.639] (-826.815) (-824.946) (-826.391) -- 0:00:51
      136000 -- (-825.493) (-831.238) (-825.289) [-827.768] * [-825.284] (-829.303) (-825.040) (-826.362) -- 0:00:50
      136500 -- [-825.132] (-825.799) (-825.484) (-826.844) * (-824.817) (-829.441) [-825.091] (-826.773) -- 0:00:50
      137000 -- [-825.140] (-829.192) (-826.958) (-831.345) * (-824.673) (-824.636) (-825.371) [-824.902] -- 0:00:50
      137500 -- (-825.884) (-825.817) [-825.952] (-829.978) * (-824.357) (-824.888) (-826.779) [-826.752] -- 0:00:50
      138000 -- (-825.040) [-825.179] (-827.047) (-825.915) * (-830.762) [-824.843] (-825.167) (-826.986) -- 0:00:49
      138500 -- (-828.504) [-825.878] (-826.821) (-826.804) * (-829.365) (-827.901) (-825.199) [-825.863] -- 0:00:49
      139000 -- (-825.342) [-824.951] (-826.658) (-827.502) * (-829.544) (-827.012) (-824.777) [-826.294] -- 0:00:49
      139500 -- (-825.196) (-824.653) [-825.835] (-825.008) * (-827.744) (-829.235) [-824.446] (-827.337) -- 0:00:49
      140000 -- (-824.256) (-825.790) (-826.134) [-827.497] * [-824.481] (-830.266) (-824.385) (-827.280) -- 0:00:49

      Average standard deviation of split frequencies: 0.021038

      140500 -- (-826.562) (-828.325) (-826.278) [-827.148] * (-827.571) [-826.340] (-826.338) (-826.782) -- 0:00:48
      141000 -- (-826.621) (-826.467) (-825.455) [-827.840] * (-826.979) (-824.735) [-824.572] (-825.625) -- 0:00:48
      141500 -- [-825.271] (-826.751) (-825.336) (-827.558) * (-827.262) [-824.763] (-824.560) (-827.068) -- 0:00:48
      142000 -- [-825.348] (-826.189) (-826.024) (-826.532) * [-826.725] (-824.304) (-824.531) (-828.868) -- 0:00:48
      142500 -- (-825.439) [-824.831] (-824.325) (-825.409) * (-826.065) (-824.380) [-825.895] (-826.978) -- 0:00:54
      143000 -- [-825.660] (-824.745) (-830.707) (-825.262) * (-829.086) [-826.247] (-825.083) (-826.163) -- 0:00:53
      143500 -- (-826.537) (-826.127) (-825.172) [-824.792] * (-830.039) [-825.868] (-826.741) (-825.193) -- 0:00:53
      144000 -- (-825.982) (-824.520) [-825.891] (-825.356) * (-825.027) [-827.450] (-826.127) (-825.792) -- 0:00:53
      144500 -- (-826.884) [-823.706] (-825.548) (-826.842) * [-824.848] (-827.083) (-826.610) (-829.800) -- 0:00:53
      145000 -- [-825.915] (-824.928) (-829.527) (-826.241) * [-828.042] (-824.668) (-825.945) (-825.727) -- 0:00:53

      Average standard deviation of split frequencies: 0.017758

      145500 -- [-824.854] (-825.272) (-828.862) (-826.079) * (-830.369) (-833.487) (-825.626) [-825.943] -- 0:00:52
      146000 -- [-825.735] (-825.485) (-826.510) (-833.854) * (-832.745) (-830.861) (-824.601) [-826.923] -- 0:00:52
      146500 -- [-826.240] (-825.185) (-824.860) (-829.841) * (-826.926) (-825.942) [-824.765] (-826.664) -- 0:00:52
      147000 -- (-827.210) [-825.182] (-827.609) (-828.272) * (-826.550) (-825.004) (-827.259) [-826.681] -- 0:00:52
      147500 -- (-826.493) (-824.843) (-827.286) [-830.003] * (-827.560) [-826.883] (-829.643) (-825.926) -- 0:00:52
      148000 -- (-827.531) (-825.823) [-829.490] (-829.129) * [-827.170] (-823.898) (-828.224) (-834.313) -- 0:00:51
      148500 -- (-826.768) [-825.551] (-829.991) (-825.845) * (-828.353) (-825.395) [-828.457] (-830.457) -- 0:00:51
      149000 -- (-826.577) [-826.799] (-824.753) (-826.645) * (-824.839) (-825.531) (-826.474) [-826.225] -- 0:00:51
      149500 -- (-826.547) [-826.614] (-824.948) (-826.365) * (-827.027) (-831.953) (-827.080) [-825.542] -- 0:00:51
      150000 -- (-826.456) (-825.791) (-826.243) [-825.632] * [-825.692] (-828.769) (-826.545) (-823.925) -- 0:00:51

      Average standard deviation of split frequencies: 0.017785

      150500 -- (-826.966) (-827.401) [-825.188] (-824.993) * (-825.711) (-832.343) (-824.481) [-824.933] -- 0:00:50
      151000 -- (-827.639) (-825.754) [-826.109] (-827.890) * (-827.260) (-826.725) (-825.300) [-824.852] -- 0:00:50
      151500 -- (-827.483) [-824.883] (-825.421) (-828.793) * (-828.640) [-826.478] (-825.705) (-828.723) -- 0:00:50
      152000 -- (-827.481) (-825.334) (-829.407) [-827.273] * (-824.916) [-825.570] (-825.415) (-827.338) -- 0:00:50
      152500 -- (-826.234) [-825.091] (-825.579) (-826.314) * (-825.438) [-827.171] (-824.604) (-825.866) -- 0:00:50
      153000 -- (-826.228) (-826.450) [-825.325] (-826.362) * [-824.626] (-825.824) (-825.145) (-828.854) -- 0:00:49
      153500 -- (-825.346) (-829.594) [-825.773] (-827.223) * (-824.564) (-824.560) (-825.840) [-829.924] -- 0:00:49
      154000 -- [-824.437] (-827.840) (-825.192) (-825.477) * [-824.796] (-824.657) (-826.414) (-826.583) -- 0:00:49
      154500 -- [-827.573] (-828.560) (-825.263) (-825.025) * (-825.472) (-826.792) (-825.327) [-829.066] -- 0:00:49
      155000 -- [-825.830] (-828.481) (-825.015) (-825.674) * (-826.972) [-827.611] (-824.266) (-826.325) -- 0:00:49

      Average standard deviation of split frequencies: 0.017527

      155500 -- (-825.667) (-827.990) [-824.082] (-828.894) * (-826.071) (-827.701) (-824.639) [-824.291] -- 0:00:48
      156000 -- (-824.781) (-824.945) (-825.522) [-824.726] * (-825.914) (-826.770) [-823.767] (-825.199) -- 0:00:48
      156500 -- (-826.180) [-827.990] (-825.319) (-828.239) * (-824.560) [-825.642] (-825.439) (-828.009) -- 0:00:48
      157000 -- [-827.087] (-828.585) (-824.956) (-825.741) * (-825.773) (-828.991) (-829.037) [-825.184] -- 0:00:48
      157500 -- [-825.176] (-829.591) (-825.019) (-827.113) * [-824.843] (-828.875) (-824.766) (-827.246) -- 0:00:48
      158000 -- (-826.155) [-826.059] (-825.746) (-826.103) * (-829.793) (-826.578) [-826.830] (-827.481) -- 0:00:47
      158500 -- (-825.461) (-827.886) [-827.515] (-825.473) * [-829.720] (-826.327) (-824.822) (-825.493) -- 0:00:47
      159000 -- [-824.619] (-823.859) (-826.902) (-824.980) * (-829.658) [-827.217] (-823.907) (-825.583) -- 0:00:52
      159500 -- (-827.037) [-824.892] (-825.639) (-826.086) * (-827.530) (-825.523) [-824.464] (-824.968) -- 0:00:52
      160000 -- (-826.011) [-826.454] (-824.550) (-829.208) * (-824.415) (-826.108) (-824.612) [-827.041] -- 0:00:52

      Average standard deviation of split frequencies: 0.016724

      160500 -- (-830.834) (-826.174) [-824.825] (-827.826) * (-827.469) (-827.137) (-827.456) [-826.720] -- 0:00:52
      161000 -- (-826.396) [-825.063] (-826.750) (-826.707) * (-823.884) (-828.298) (-829.429) [-824.856] -- 0:00:52
      161500 -- (-825.931) [-828.280] (-824.693) (-824.695) * [-825.621] (-826.112) (-827.703) (-825.054) -- 0:00:51
      162000 -- (-825.795) [-828.100] (-824.942) (-825.774) * [-827.012] (-828.023) (-826.043) (-825.695) -- 0:00:51
      162500 -- (-826.225) (-827.971) [-825.165] (-824.765) * (-827.118) (-829.691) [-825.580] (-825.454) -- 0:00:51
      163000 -- (-825.746) (-828.060) (-826.328) [-826.387] * (-830.290) (-825.570) [-828.307] (-828.224) -- 0:00:51
      163500 -- (-826.166) [-828.032] (-827.073) (-827.526) * [-827.780] (-825.861) (-827.338) (-828.328) -- 0:00:51
      164000 -- (-826.446) (-826.203) (-832.095) [-827.313] * (-826.561) (-827.266) [-825.243] (-828.893) -- 0:00:50
      164500 -- (-825.506) (-824.836) [-824.691] (-825.846) * (-826.350) (-828.114) [-825.353] (-826.754) -- 0:00:50
      165000 -- (-826.558) [-824.781] (-826.895) (-829.098) * (-825.604) (-825.780) [-827.729] (-826.507) -- 0:00:50

      Average standard deviation of split frequencies: 0.015551

      165500 -- (-824.363) [-828.435] (-826.142) (-828.885) * (-829.004) [-827.128] (-827.993) (-827.642) -- 0:00:50
      166000 -- [-824.803] (-824.812) (-825.130) (-826.358) * [-824.956] (-827.976) (-825.871) (-830.033) -- 0:00:50
      166500 -- (-827.189) (-827.740) [-826.232] (-825.482) * (-826.859) (-824.664) [-825.595] (-827.482) -- 0:00:50
      167000 -- (-826.845) (-828.897) [-824.824] (-825.852) * (-825.657) (-824.756) [-827.660] (-826.500) -- 0:00:49
      167500 -- [-826.015] (-824.111) (-824.550) (-827.533) * (-825.095) [-824.661] (-832.687) (-824.533) -- 0:00:49
      168000 -- [-826.191] (-824.677) (-826.162) (-826.289) * (-826.371) (-826.277) (-829.870) [-823.890] -- 0:00:49
      168500 -- [-828.254] (-823.874) (-826.062) (-824.641) * [-826.348] (-826.760) (-824.468) (-828.164) -- 0:00:49
      169000 -- (-825.409) [-825.300] (-825.888) (-825.024) * (-826.914) (-825.433) [-826.252] (-827.330) -- 0:00:49
      169500 -- (-826.366) (-824.831) (-824.109) [-825.907] * (-826.681) (-826.300) (-830.784) [-824.417] -- 0:00:48
      170000 -- [-826.575] (-824.296) (-828.201) (-827.580) * (-826.805) [-827.717] (-826.646) (-830.199) -- 0:00:48

      Average standard deviation of split frequencies: 0.016435

      170500 -- (-827.075) [-825.829] (-824.738) (-824.937) * (-825.705) (-824.911) (-827.339) [-825.155] -- 0:00:48
      171000 -- (-826.733) (-825.624) (-827.526) [-825.287] * (-827.088) (-824.847) [-826.079] (-824.680) -- 0:00:48
      171500 -- (-827.314) (-827.259) (-826.276) [-824.823] * (-826.016) [-827.139] (-827.193) (-826.923) -- 0:00:48
      172000 -- [-825.514] (-824.297) (-826.973) (-824.409) * [-825.712] (-825.787) (-831.482) (-828.924) -- 0:00:48
      172500 -- (-825.503) (-824.599) [-825.251] (-826.397) * [-824.105] (-825.778) (-826.045) (-829.279) -- 0:00:47
      173000 -- (-826.579) (-824.875) (-827.750) [-827.609] * [-825.198] (-824.766) (-824.794) (-825.770) -- 0:00:47
      173500 -- (-824.381) (-827.530) (-826.089) [-827.701] * (-827.667) [-824.704] (-824.519) (-828.081) -- 0:00:47
      174000 -- (-824.341) (-824.514) (-825.067) [-827.934] * (-825.251) (-824.218) (-824.877) [-827.575] -- 0:00:47
      174500 -- (-827.064) (-824.521) (-823.814) [-829.667] * (-823.912) [-825.121] (-824.309) (-827.912) -- 0:00:47
      175000 -- (-826.109) (-825.386) [-828.047] (-824.235) * (-827.594) (-826.857) (-827.197) [-829.098] -- 0:00:47

      Average standard deviation of split frequencies: 0.016353

      175500 -- (-825.858) (-826.430) [-827.208] (-826.122) * [-826.028] (-825.779) (-827.156) (-824.815) -- 0:00:51
      176000 -- [-826.446] (-826.973) (-827.663) (-827.929) * (-826.083) (-824.912) (-825.486) [-825.867] -- 0:00:51
      176500 -- (-824.193) (-827.519) [-825.792] (-825.206) * [-829.312] (-827.779) (-825.711) (-824.910) -- 0:00:51
      177000 -- [-826.109] (-827.309) (-828.071) (-824.280) * (-826.174) [-826.483] (-827.778) (-824.717) -- 0:00:51
      177500 -- (-826.605) (-824.235) (-827.553) [-826.934] * [-827.192] (-827.066) (-828.280) (-828.665) -- 0:00:50
      178000 -- [-826.016] (-831.424) (-825.106) (-829.109) * [-825.600] (-825.205) (-827.452) (-828.801) -- 0:00:50
      178500 -- (-825.616) (-829.738) [-825.295] (-827.576) * (-829.545) (-825.762) [-824.998] (-825.885) -- 0:00:50
      179000 -- [-825.162] (-830.027) (-828.398) (-826.112) * (-824.549) (-828.056) (-827.958) [-827.333] -- 0:00:50
      179500 -- [-825.052] (-828.905) (-824.966) (-825.439) * (-824.774) (-825.792) [-824.413] (-824.797) -- 0:00:50
      180000 -- [-826.490] (-825.730) (-826.377) (-825.439) * (-824.324) [-826.951] (-826.516) (-829.125) -- 0:00:50

      Average standard deviation of split frequencies: 0.017352

      180500 -- (-824.940) (-824.558) (-825.974) [-825.106] * (-824.088) [-826.266] (-828.390) (-826.852) -- 0:00:49
      181000 -- (-829.170) (-826.969) (-825.185) [-825.515] * (-827.489) (-826.220) (-827.263) [-826.603] -- 0:00:49
      181500 -- (-829.851) (-825.676) [-825.892] (-826.303) * (-824.740) (-827.006) [-826.537] (-825.010) -- 0:00:49
      182000 -- [-825.299] (-825.454) (-824.107) (-826.974) * (-826.247) (-826.238) [-826.822] (-828.352) -- 0:00:49
      182500 -- [-823.908] (-825.577) (-825.645) (-825.779) * (-826.160) (-826.046) [-827.186] (-826.935) -- 0:00:49
      183000 -- (-826.218) (-828.613) [-825.557] (-827.332) * (-826.346) (-829.332) (-827.342) [-826.289] -- 0:00:49
      183500 -- [-824.519] (-830.746) (-825.286) (-827.410) * (-824.588) [-825.690] (-826.362) (-826.120) -- 0:00:48
      184000 -- (-825.887) [-827.118] (-824.965) (-826.991) * (-824.090) [-825.969] (-827.159) (-829.221) -- 0:00:48
      184500 -- (-824.592) (-826.253) [-826.079] (-825.469) * (-825.726) (-824.834) (-828.745) [-827.824] -- 0:00:48
      185000 -- [-826.534] (-825.384) (-824.909) (-825.479) * (-825.293) (-824.525) (-827.954) [-827.087] -- 0:00:48

      Average standard deviation of split frequencies: 0.019431

      185500 -- (-831.486) (-826.152) [-829.841] (-826.377) * [-825.273] (-836.429) (-829.808) (-825.644) -- 0:00:48
      186000 -- [-825.421] (-833.870) (-826.909) (-826.622) * (-825.100) (-825.110) (-828.948) [-825.952] -- 0:00:48
      186500 -- (-826.045) (-837.967) [-824.629] (-828.563) * (-831.870) (-825.624) (-832.263) [-826.267] -- 0:00:47
      187000 -- (-827.082) (-828.318) (-824.677) [-825.768] * (-829.427) [-825.715] (-827.389) (-826.560) -- 0:00:47
      187500 -- (-826.115) (-828.640) [-826.940] (-827.749) * (-828.088) [-824.448] (-828.770) (-828.938) -- 0:00:47
      188000 -- (-827.788) (-825.084) [-826.683] (-824.010) * [-826.430] (-825.178) (-826.825) (-826.067) -- 0:00:47
      188500 -- (-827.178) (-827.783) [-825.308] (-824.666) * [-826.033] (-824.644) (-828.538) (-824.641) -- 0:00:47
      189000 -- [-826.747] (-825.255) (-826.645) (-824.548) * (-827.428) (-826.326) [-825.984] (-825.902) -- 0:00:47
      189500 -- (-830.397) (-825.425) (-824.507) [-824.668] * (-828.947) (-828.083) (-827.021) [-829.823] -- 0:00:47
      190000 -- (-825.152) (-826.519) [-827.006] (-825.111) * (-829.186) (-827.808) [-828.781] (-826.748) -- 0:00:46

      Average standard deviation of split frequencies: 0.018484

      190500 -- (-825.226) (-826.522) (-825.620) [-824.439] * [-825.886] (-826.059) (-830.183) (-824.882) -- 0:00:46
      191000 -- (-826.229) (-831.745) (-825.310) [-824.186] * (-824.698) (-827.185) [-828.242] (-826.144) -- 0:00:46
      191500 -- (-824.097) [-829.036] (-827.624) (-825.271) * [-826.133] (-825.263) (-827.039) (-825.437) -- 0:00:46
      192000 -- (-825.478) (-827.261) (-826.017) [-826.784] * [-824.263] (-825.253) (-828.518) (-826.960) -- 0:00:46
      192500 -- [-826.377] (-826.641) (-826.683) (-827.273) * (-824.535) (-829.361) [-825.359] (-829.938) -- 0:00:50
      193000 -- (-826.267) [-826.326] (-825.471) (-826.648) * (-826.881) (-828.763) [-824.723] (-829.787) -- 0:00:50
      193500 -- [-827.494] (-825.717) (-827.560) (-828.779) * (-827.829) [-826.752] (-828.881) (-827.066) -- 0:00:50
      194000 -- [-826.352] (-827.855) (-828.814) (-828.093) * (-826.027) (-829.702) (-831.924) [-826.932] -- 0:00:49
      194500 -- (-825.528) [-825.122] (-827.988) (-827.027) * (-826.989) (-827.905) [-828.226] (-827.125) -- 0:00:49
      195000 -- (-825.985) (-826.468) (-826.316) [-827.169] * [-824.947] (-824.175) (-824.959) (-825.756) -- 0:00:49

      Average standard deviation of split frequencies: 0.018038

      195500 -- (-824.157) [-825.316] (-827.271) (-826.340) * (-826.204) (-824.284) [-826.702] (-823.834) -- 0:00:49
      196000 -- (-824.512) [-824.992] (-826.328) (-826.601) * (-825.096) (-827.070) [-824.539] (-824.955) -- 0:00:49
      196500 -- (-827.970) (-825.989) (-825.005) [-825.555] * (-827.278) (-824.185) (-824.395) [-827.577] -- 0:00:49
      197000 -- (-825.814) (-825.372) (-825.328) [-830.127] * (-827.088) [-823.941] (-824.294) (-829.066) -- 0:00:48
      197500 -- (-826.377) [-828.774] (-824.947) (-824.456) * (-826.320) (-824.874) (-828.283) [-831.193] -- 0:00:48
      198000 -- (-824.957) [-825.787] (-829.245) (-826.094) * (-827.001) (-825.874) (-827.416) [-824.413] -- 0:00:48
      198500 -- (-827.588) (-825.405) [-824.237] (-825.203) * (-826.738) (-824.317) (-824.742) [-825.096] -- 0:00:48
      199000 -- (-826.485) (-828.978) [-824.686] (-824.703) * (-826.529) [-825.064] (-828.166) (-825.288) -- 0:00:48
      199500 -- (-828.878) (-834.333) (-825.923) [-827.232] * [-825.694] (-825.418) (-825.644) (-829.091) -- 0:00:48
      200000 -- (-831.217) (-826.309) (-826.935) [-825.249] * (-825.513) (-826.231) (-827.953) [-825.062] -- 0:00:48

      Average standard deviation of split frequencies: 0.017804

      200500 -- (-831.062) (-824.563) [-830.885] (-828.120) * [-825.863] (-828.484) (-824.377) (-830.391) -- 0:00:47
      201000 -- (-827.023) [-824.455] (-828.140) (-830.185) * (-827.188) [-828.222] (-824.978) (-827.531) -- 0:00:47
      201500 -- [-826.342] (-824.810) (-827.716) (-832.008) * (-834.130) [-826.428] (-827.092) (-826.007) -- 0:00:47
      202000 -- [-826.627] (-827.290) (-824.508) (-824.658) * (-830.614) (-828.013) [-828.260] (-825.751) -- 0:00:47
      202500 -- [-826.451] (-826.858) (-825.080) (-826.965) * (-826.646) [-825.245] (-824.640) (-828.284) -- 0:00:47
      203000 -- (-825.539) (-827.647) [-826.566] (-826.755) * (-828.036) (-825.726) [-828.015] (-834.609) -- 0:00:47
      203500 -- (-825.864) (-831.665) [-825.271] (-824.678) * [-825.943] (-828.188) (-825.511) (-826.573) -- 0:00:46
      204000 -- (-828.549) [-824.104] (-826.751) (-825.243) * (-826.022) (-825.413) (-826.448) [-824.571] -- 0:00:46
      204500 -- (-825.469) [-825.749] (-827.451) (-826.151) * (-825.445) (-826.816) (-828.784) [-826.244] -- 0:00:46
      205000 -- [-825.730] (-833.241) (-823.840) (-825.459) * [-827.210] (-827.338) (-825.445) (-825.728) -- 0:00:46

      Average standard deviation of split frequencies: 0.018668

      205500 -- (-826.153) (-828.568) (-825.229) [-824.924] * [-827.354] (-827.028) (-829.071) (-828.021) -- 0:00:46
      206000 -- (-828.821) (-828.719) (-825.924) [-825.512] * (-826.045) [-827.003] (-825.951) (-825.146) -- 0:00:46
      206500 -- (-824.659) [-825.830] (-829.007) (-824.928) * (-827.920) [-825.388] (-825.117) (-825.698) -- 0:00:46
      207000 -- [-824.806] (-827.432) (-828.289) (-825.831) * (-824.829) [-827.094] (-827.835) (-825.701) -- 0:00:45
      207500 -- (-827.119) (-825.954) [-827.461] (-827.055) * [-826.004] (-825.959) (-826.508) (-827.092) -- 0:00:45
      208000 -- (-825.830) (-824.865) (-824.848) [-824.950] * (-826.700) [-831.569] (-824.104) (-827.833) -- 0:00:45
      208500 -- (-827.412) (-824.836) (-825.690) [-825.167] * [-826.056] (-826.372) (-825.233) (-826.535) -- 0:00:45
      209000 -- (-825.490) (-824.860) (-825.392) [-827.264] * (-827.057) [-826.424] (-824.378) (-825.551) -- 0:00:49
      209500 -- (-827.626) [-830.491] (-826.372) (-829.120) * (-826.268) [-824.795] (-826.236) (-830.972) -- 0:00:49
      210000 -- (-824.647) (-830.291) [-826.653] (-827.304) * [-829.338] (-827.429) (-824.828) (-828.592) -- 0:00:48

      Average standard deviation of split frequencies: 0.017404

      210500 -- (-825.182) (-825.407) [-826.468] (-828.701) * (-826.531) (-826.614) (-824.444) [-825.625] -- 0:00:48
      211000 -- (-829.710) (-827.288) [-824.895] (-827.685) * (-826.765) (-831.126) (-824.235) [-828.016] -- 0:00:48
      211500 -- (-827.246) (-828.830) [-825.422] (-824.489) * (-825.202) (-825.542) [-826.047] (-828.722) -- 0:00:48
      212000 -- (-824.801) (-828.991) [-825.272] (-828.892) * (-825.195) (-829.203) (-827.580) [-825.345] -- 0:00:48
      212500 -- (-829.695) (-825.972) (-828.942) [-827.045] * [-827.711] (-827.186) (-826.605) (-826.163) -- 0:00:48
      213000 -- (-827.193) (-827.234) [-826.126] (-825.821) * [-826.282] (-825.691) (-825.715) (-826.486) -- 0:00:48
      213500 -- (-824.964) (-829.509) [-825.217] (-825.880) * (-825.721) [-825.794] (-826.653) (-829.640) -- 0:00:47
      214000 -- (-825.017) (-824.817) (-824.798) [-826.333] * (-825.529) [-826.268] (-826.274) (-826.470) -- 0:00:47
      214500 -- [-828.352] (-825.172) (-826.454) (-826.140) * (-827.435) [-825.900] (-831.324) (-831.759) -- 0:00:47
      215000 -- (-824.129) (-826.196) (-825.157) [-825.139] * [-828.345] (-826.233) (-829.246) (-825.056) -- 0:00:47

      Average standard deviation of split frequencies: 0.016732

      215500 -- (-828.972) [-825.209] (-825.789) (-829.986) * (-828.779) (-825.093) (-826.099) [-824.914] -- 0:00:47
      216000 -- (-825.100) [-826.433] (-829.058) (-828.712) * [-824.873] (-826.271) (-829.824) (-825.849) -- 0:00:47
      216500 -- (-826.048) (-831.328) (-829.292) [-827.808] * (-825.456) (-825.332) (-828.592) [-827.130] -- 0:00:47
      217000 -- (-825.222) (-830.251) [-826.237] (-825.705) * (-825.348) [-824.303] (-824.250) (-826.482) -- 0:00:46
      217500 -- (-825.679) (-831.099) (-825.256) [-825.410] * (-824.982) (-827.972) (-826.514) [-826.812] -- 0:00:46
      218000 -- (-825.194) (-827.406) (-825.430) [-826.544] * [-826.677] (-827.364) (-825.407) (-825.382) -- 0:00:46
      218500 -- (-830.933) [-827.151] (-827.177) (-824.809) * (-825.580) [-826.937] (-824.425) (-826.830) -- 0:00:46
      219000 -- [-824.917] (-825.408) (-825.556) (-827.874) * (-825.415) (-825.236) (-826.409) [-826.586] -- 0:00:46
      219500 -- [-826.793] (-826.665) (-833.613) (-825.869) * (-827.101) (-824.855) [-827.386] (-827.504) -- 0:00:46
      220000 -- (-825.140) (-828.478) [-826.378] (-829.336) * (-829.620) [-827.217] (-824.085) (-828.130) -- 0:00:46

      Average standard deviation of split frequencies: 0.015429

      220500 -- [-826.239] (-831.660) (-827.248) (-827.391) * (-828.372) (-824.729) [-825.873] (-826.002) -- 0:00:45
      221000 -- (-828.238) (-826.293) (-826.865) [-827.882] * (-829.181) [-824.151] (-825.905) (-825.140) -- 0:00:45
      221500 -- (-825.555) [-830.827] (-824.796) (-828.242) * [-825.811] (-828.195) (-826.820) (-830.602) -- 0:00:45
      222000 -- (-825.632) [-830.756] (-827.653) (-829.088) * [-824.995] (-826.156) (-829.137) (-826.792) -- 0:00:45
      222500 -- (-825.325) [-826.539] (-824.874) (-825.705) * [-825.947] (-825.339) (-826.448) (-825.864) -- 0:00:45
      223000 -- [-826.765] (-826.192) (-825.132) (-824.506) * [-825.355] (-827.607) (-825.723) (-830.297) -- 0:00:45
      223500 -- [-825.435] (-827.659) (-827.264) (-825.135) * (-825.169) (-826.918) (-827.470) [-826.418] -- 0:00:45
      224000 -- [-826.967] (-826.856) (-827.750) (-825.570) * (-824.815) (-827.815) (-826.563) [-826.520] -- 0:00:45
      224500 -- (-826.464) (-829.951) (-826.168) [-825.485] * (-828.569) (-826.100) (-825.676) [-824.215] -- 0:00:44
      225000 -- (-831.026) (-828.588) [-825.305] (-827.273) * (-825.057) [-825.578] (-825.570) (-825.202) -- 0:00:44

      Average standard deviation of split frequencies: 0.013284

      225500 -- (-826.787) (-826.932) [-825.762] (-828.363) * (-825.392) (-831.023) [-823.966] (-830.299) -- 0:00:48
      226000 -- (-829.752) (-825.229) (-826.181) [-827.872] * [-824.259] (-824.423) (-824.796) (-826.134) -- 0:00:47
      226500 -- (-826.730) (-825.582) (-825.095) [-827.675] * (-826.074) (-825.871) (-825.439) [-824.977] -- 0:00:47
      227000 -- (-827.095) (-825.641) (-825.776) [-823.986] * (-825.641) [-826.170] (-826.843) (-827.356) -- 0:00:47
      227500 -- (-830.919) (-827.869) (-827.821) [-825.071] * [-824.715] (-824.853) (-826.721) (-826.264) -- 0:00:47
      228000 -- (-828.056) [-829.039] (-826.673) (-825.197) * (-826.085) [-828.352] (-825.481) (-824.713) -- 0:00:47
      228500 -- [-826.866] (-829.910) (-824.457) (-825.197) * (-826.035) (-825.551) (-827.475) [-825.046] -- 0:00:47
      229000 -- (-830.304) (-826.645) [-827.849] (-825.443) * (-825.661) (-826.488) (-831.386) [-825.874] -- 0:00:47
      229500 -- (-826.168) (-827.032) (-828.982) [-825.753] * (-824.583) (-828.414) (-824.248) [-825.933] -- 0:00:47
      230000 -- [-825.952] (-824.002) (-827.207) (-827.859) * (-827.022) [-825.708] (-825.749) (-827.013) -- 0:00:46

      Average standard deviation of split frequencies: 0.012376

      230500 -- (-824.715) (-826.563) (-828.602) [-828.611] * [-825.729] (-830.125) (-823.713) (-825.207) -- 0:00:46
      231000 -- [-825.986] (-827.149) (-831.126) (-831.877) * (-829.958) (-825.436) [-825.858] (-826.099) -- 0:00:46
      231500 -- [-826.933] (-825.387) (-830.824) (-830.428) * (-828.442) (-827.281) [-825.587] (-824.752) -- 0:00:46
      232000 -- (-827.804) (-825.986) [-824.973] (-825.698) * (-827.140) [-826.158] (-826.816) (-825.544) -- 0:00:46
      232500 -- (-827.389) (-828.789) (-828.297) [-827.217] * [-824.920] (-827.962) (-825.475) (-827.118) -- 0:00:46
      233000 -- (-828.664) (-826.896) [-824.597] (-824.714) * (-824.643) (-828.483) (-825.403) [-824.781] -- 0:00:46
      233500 -- (-827.541) (-826.479) [-824.934] (-826.248) * (-825.029) (-824.683) [-824.836] (-827.054) -- 0:00:45
      234000 -- (-828.749) [-825.316] (-831.628) (-826.373) * (-824.751) (-825.752) (-824.920) [-825.543] -- 0:00:45
      234500 -- (-830.305) (-826.800) (-826.632) [-828.567] * (-824.763) (-824.882) [-825.171] (-827.003) -- 0:00:45
      235000 -- (-825.785) [-825.391] (-824.579) (-826.695) * [-827.681] (-825.407) (-825.035) (-827.893) -- 0:00:45

      Average standard deviation of split frequencies: 0.013427

      235500 -- (-831.206) (-829.502) [-824.849] (-827.685) * (-827.700) (-826.140) (-825.393) [-825.514] -- 0:00:45
      236000 -- (-827.348) (-825.519) [-828.643] (-827.844) * (-826.862) (-824.986) [-824.811] (-827.191) -- 0:00:45
      236500 -- [-825.577] (-826.608) (-828.109) (-831.306) * (-825.237) [-825.959] (-827.075) (-826.611) -- 0:00:45
      237000 -- (-823.848) (-826.543) [-826.330] (-829.613) * (-834.747) [-826.623] (-829.532) (-827.212) -- 0:00:45
      237500 -- (-824.330) (-831.482) (-831.390) [-828.706] * (-827.111) (-826.518) (-831.288) [-825.507] -- 0:00:44
      238000 -- (-827.463) [-827.686] (-826.135) (-826.150) * (-827.289) [-824.539] (-830.991) (-825.377) -- 0:00:44
      238500 -- (-828.118) (-826.946) (-829.250) [-826.823] * (-824.907) (-827.814) (-832.170) [-827.210] -- 0:00:44
      239000 -- (-833.066) (-826.985) [-826.440] (-828.582) * (-825.398) (-827.592) [-826.493] (-824.371) -- 0:00:44
      239500 -- [-827.625] (-826.122) (-824.630) (-824.847) * (-824.859) (-829.092) (-827.218) [-827.707] -- 0:00:44
      240000 -- (-828.064) (-825.732) [-829.510] (-825.847) * (-828.566) (-826.121) (-824.671) [-826.632] -- 0:00:44

      Average standard deviation of split frequencies: 0.012514

      240500 -- (-828.624) (-826.726) [-826.261] (-825.394) * [-827.318] (-829.335) (-825.569) (-824.611) -- 0:00:44
      241000 -- (-829.576) [-826.207] (-824.154) (-825.302) * (-826.836) (-827.864) (-828.045) [-828.124] -- 0:00:44
      241500 -- (-825.377) (-826.892) [-825.225] (-825.133) * [-826.323] (-827.458) (-830.687) (-825.439) -- 0:00:47
      242000 -- [-824.484] (-829.342) (-827.039) (-828.490) * [-824.366] (-825.001) (-824.254) (-824.601) -- 0:00:46
      242500 -- [-829.612] (-829.700) (-828.226) (-828.262) * (-826.712) (-825.197) [-824.502] (-826.046) -- 0:00:46
      243000 -- [-824.538] (-825.508) (-824.604) (-826.061) * (-826.863) (-824.201) [-824.502] (-826.551) -- 0:00:46
      243500 -- (-826.816) [-824.920] (-824.471) (-825.455) * (-825.372) [-826.098] (-826.237) (-825.132) -- 0:00:46
      244000 -- [-825.183] (-829.722) (-824.471) (-829.758) * (-825.116) (-828.650) [-826.220] (-828.282) -- 0:00:46
      244500 -- [-825.855] (-825.998) (-826.440) (-830.159) * (-826.463) [-826.625] (-825.924) (-827.061) -- 0:00:46
      245000 -- (-827.302) (-826.885) (-825.662) [-827.848] * (-825.076) [-824.579] (-826.358) (-825.802) -- 0:00:46

      Average standard deviation of split frequencies: 0.012809

      245500 -- (-824.459) (-825.973) (-826.121) [-826.522] * (-826.683) (-827.862) (-827.272) [-830.476] -- 0:00:46
      246000 -- (-826.184) (-825.296) [-825.734] (-829.379) * (-826.423) [-825.315] (-825.401) (-829.324) -- 0:00:45
      246500 -- (-826.073) (-825.443) [-828.523] (-827.702) * [-827.081] (-827.249) (-826.516) (-824.861) -- 0:00:45
      247000 -- [-824.755] (-828.008) (-824.782) (-827.459) * (-824.235) (-827.256) [-828.728] (-826.029) -- 0:00:45
      247500 -- (-825.815) [-827.925] (-825.697) (-831.363) * [-826.611] (-824.100) (-826.030) (-828.252) -- 0:00:45
      248000 -- [-825.986] (-827.625) (-827.149) (-825.048) * (-828.439) [-825.407] (-826.679) (-827.809) -- 0:00:45
      248500 -- (-826.280) (-826.135) (-826.791) [-830.937] * [-827.160] (-825.241) (-827.241) (-828.932) -- 0:00:45
      249000 -- [-826.931] (-828.054) (-830.039) (-829.974) * (-825.897) (-825.797) (-826.486) [-828.000] -- 0:00:45
      249500 -- (-826.779) [-827.307] (-830.873) (-824.265) * [-825.583] (-825.391) (-827.102) (-825.236) -- 0:00:45
      250000 -- (-826.263) (-826.813) [-824.807] (-823.957) * (-825.994) [-825.806] (-827.166) (-824.086) -- 0:00:45

      Average standard deviation of split frequencies: 0.011976

      250500 -- (-825.816) (-825.724) [-825.289] (-824.698) * (-827.865) [-826.864] (-825.514) (-824.836) -- 0:00:44
      251000 -- (-824.055) (-827.807) (-826.704) [-825.474] * (-829.178) [-826.337] (-828.203) (-826.930) -- 0:00:44
      251500 -- (-823.769) (-829.869) [-823.808] (-823.798) * [-826.248] (-825.314) (-826.295) (-831.670) -- 0:00:44
      252000 -- (-824.437) [-826.067] (-836.086) (-824.396) * [-825.501] (-827.172) (-825.772) (-825.022) -- 0:00:44
      252500 -- (-825.132) (-824.750) [-827.904] (-826.958) * (-827.972) (-828.237) [-824.993] (-825.414) -- 0:00:44
      253000 -- [-826.963] (-828.043) (-825.460) (-827.326) * (-826.772) (-827.133) [-827.278] (-824.932) -- 0:00:44
      253500 -- (-825.941) [-826.593] (-825.031) (-826.433) * (-826.115) (-824.655) (-827.692) [-827.373] -- 0:00:44
      254000 -- (-828.124) [-828.081] (-831.362) (-825.995) * (-827.140) [-826.372] (-829.831) (-825.344) -- 0:00:44
      254500 -- [-825.268] (-827.410) (-825.309) (-826.081) * [-827.329] (-829.616) (-828.441) (-824.986) -- 0:00:43
      255000 -- [-826.641] (-829.232) (-827.537) (-825.791) * (-825.884) (-827.170) [-825.778] (-827.858) -- 0:00:43

      Average standard deviation of split frequencies: 0.010844

      255500 -- [-829.077] (-826.424) (-827.895) (-825.578) * (-826.062) (-826.377) (-828.060) [-827.375] -- 0:00:43
      256000 -- (-826.219) (-828.105) (-825.734) [-824.169] * (-827.969) (-827.293) (-824.910) [-828.934] -- 0:00:43
      256500 -- [-824.871] (-828.334) (-827.874) (-825.015) * (-824.314) [-825.947] (-828.705) (-828.719) -- 0:00:43
      257000 -- [-824.074] (-825.401) (-827.899) (-825.869) * [-824.194] (-828.112) (-835.468) (-824.891) -- 0:00:43
      257500 -- [-825.589] (-829.444) (-826.180) (-826.476) * (-825.437) (-828.395) (-825.881) [-825.000] -- 0:00:43
      258000 -- (-830.660) (-828.551) (-827.466) [-826.886] * (-827.919) (-831.102) (-825.519) [-826.079] -- 0:00:46
      258500 -- (-829.173) (-826.776) [-824.426] (-828.331) * (-827.542) [-825.302] (-830.524) (-824.550) -- 0:00:45
      259000 -- [-826.050] (-824.691) (-824.334) (-824.597) * (-826.605) [-828.278] (-829.839) (-825.167) -- 0:00:45
      259500 -- (-827.354) (-825.609) (-824.297) [-826.456] * [-827.042] (-827.225) (-826.707) (-825.942) -- 0:00:45
      260000 -- [-825.055] (-825.403) (-825.546) (-824.529) * (-823.951) [-826.423] (-824.943) (-824.784) -- 0:00:45

      Average standard deviation of split frequencies: 0.009787

      260500 -- (-824.983) (-829.666) [-826.566] (-825.268) * (-827.361) [-826.521] (-828.132) (-826.398) -- 0:00:45
      261000 -- [-826.518] (-827.044) (-826.855) (-834.435) * [-824.398] (-829.887) (-823.976) (-827.905) -- 0:00:45
      261500 -- (-829.821) (-828.647) [-824.714] (-828.153) * (-824.317) [-826.276] (-825.701) (-825.158) -- 0:00:45
      262000 -- (-824.832) (-827.189) [-824.316] (-828.097) * [-824.492] (-826.164) (-825.698) (-825.070) -- 0:00:45
      262500 -- (-824.373) [-825.906] (-824.286) (-826.418) * (-824.465) [-826.355] (-829.477) (-828.642) -- 0:00:44
      263000 -- (-826.522) (-824.757) (-825.611) [-827.627] * [-824.292] (-827.259) (-826.555) (-824.538) -- 0:00:44
      263500 -- (-825.995) (-824.947) (-825.277) [-825.911] * (-827.649) (-828.732) [-826.789] (-825.409) -- 0:00:44
      264000 -- (-826.201) (-824.259) [-830.365] (-827.488) * (-827.915) (-830.554) [-824.915] (-827.367) -- 0:00:44
      264500 -- (-829.290) (-825.786) (-825.847) [-825.340] * (-826.486) (-827.433) [-824.806] (-830.713) -- 0:00:44
      265000 -- (-824.730) [-825.598] (-824.497) (-827.273) * (-827.442) (-828.405) [-825.343] (-824.836) -- 0:00:44

      Average standard deviation of split frequencies: 0.010042

      265500 -- (-828.205) (-824.555) [-824.281] (-826.049) * (-827.165) (-828.331) [-827.794] (-825.351) -- 0:00:44
      266000 -- (-828.623) (-825.269) (-825.947) [-826.096] * (-828.563) (-827.454) [-825.105] (-825.045) -- 0:00:44
      266500 -- (-824.246) [-826.125] (-826.480) (-825.109) * (-830.107) (-827.304) [-826.765] (-825.407) -- 0:00:44
      267000 -- (-824.279) (-830.327) (-824.801) [-824.150] * (-829.014) (-825.998) [-824.266] (-825.986) -- 0:00:43
      267500 -- (-827.929) (-825.882) [-825.851] (-827.019) * (-826.199) (-826.553) (-824.373) [-825.217] -- 0:00:43
      268000 -- (-827.867) (-825.009) [-826.153] (-829.128) * (-826.536) [-829.899] (-824.285) (-824.982) -- 0:00:43
      268500 -- (-826.106) [-825.527] (-825.862) (-825.117) * (-825.461) [-825.538] (-825.864) (-825.848) -- 0:00:43
      269000 -- (-825.070) (-826.718) [-826.313] (-830.208) * (-826.454) (-825.917) [-825.817] (-828.731) -- 0:00:43
      269500 -- (-825.232) [-828.743] (-826.546) (-828.899) * (-828.520) (-826.335) (-830.174) [-824.974] -- 0:00:43
      270000 -- (-824.779) (-825.009) [-826.573] (-824.549) * (-827.350) (-825.829) (-827.214) [-826.626] -- 0:00:43

      Average standard deviation of split frequencies: 0.009938

      270500 -- [-825.088] (-825.289) (-825.866) (-825.789) * [-825.554] (-825.960) (-826.697) (-825.343) -- 0:00:43
      271000 -- (-827.658) (-832.345) [-824.584] (-824.824) * (-824.590) [-825.062] (-825.903) (-827.598) -- 0:00:43
      271500 -- [-825.991] (-832.982) (-830.258) (-825.617) * [-825.674] (-825.973) (-829.872) (-826.344) -- 0:00:42
      272000 -- (-825.820) [-825.399] (-832.357) (-824.490) * (-826.761) [-826.137] (-825.150) (-824.973) -- 0:00:42
      272500 -- (-826.354) [-826.217] (-825.718) (-829.080) * (-824.761) [-825.838] (-825.934) (-825.711) -- 0:00:42
      273000 -- (-826.161) (-824.389) (-827.776) [-826.981] * (-828.756) [-826.705] (-826.686) (-825.482) -- 0:00:42
      273500 -- (-826.620) [-828.107] (-825.646) (-825.816) * (-829.748) (-827.637) (-823.845) [-826.430] -- 0:00:42
      274000 -- [-825.524] (-826.130) (-826.310) (-826.574) * (-826.830) (-825.176) [-824.674] (-826.414) -- 0:00:45
      274500 -- (-825.121) (-825.851) [-824.337] (-830.589) * (-826.926) [-824.635] (-824.845) (-824.918) -- 0:00:44
      275000 -- [-824.974] (-826.479) (-824.993) (-826.319) * (-825.086) [-825.838] (-824.750) (-825.673) -- 0:00:44

      Average standard deviation of split frequencies: 0.010248

      275500 -- (-824.995) (-824.817) [-824.899] (-828.888) * (-824.719) (-824.983) [-828.587] (-826.125) -- 0:00:44
      276000 -- (-825.600) [-824.839] (-824.852) (-826.351) * [-824.809] (-825.638) (-826.663) (-825.177) -- 0:00:44
      276500 -- (-824.026) [-825.446] (-824.014) (-824.981) * (-826.549) (-828.470) [-826.437] (-824.353) -- 0:00:44
      277000 -- [-825.098] (-825.446) (-826.733) (-826.409) * (-829.504) [-829.765] (-826.456) (-825.782) -- 0:00:44
      277500 -- (-826.093) [-824.189] (-824.629) (-825.735) * (-826.214) (-829.360) (-825.981) [-825.469] -- 0:00:44
      278000 -- (-826.816) [-825.014] (-823.977) (-825.023) * [-828.312] (-829.336) (-829.342) (-824.872) -- 0:00:44
      278500 -- [-827.867] (-825.000) (-823.867) (-826.192) * (-828.348) (-824.756) (-825.371) [-824.163] -- 0:00:44
      279000 -- [-824.414] (-824.782) (-824.728) (-827.019) * (-826.029) (-829.885) [-828.997] (-825.447) -- 0:00:43
      279500 -- (-825.716) (-825.593) (-830.300) [-826.227] * (-829.641) (-825.470) [-826.453] (-824.440) -- 0:00:43
      280000 -- (-825.992) (-826.151) [-827.413] (-825.883) * (-827.032) (-827.192) [-824.257] (-823.897) -- 0:00:43

      Average standard deviation of split frequencies: 0.010078

      280500 -- (-827.304) (-826.134) (-826.061) [-828.049] * (-826.377) (-825.060) (-830.374) [-826.432] -- 0:00:43
      281000 -- (-827.250) (-825.834) [-825.759] (-826.175) * (-826.346) [-825.022] (-826.029) (-824.997) -- 0:00:43
      281500 -- (-824.306) (-824.835) (-826.171) [-826.503] * (-827.701) [-827.575] (-826.465) (-829.110) -- 0:00:43
      282000 -- (-827.500) [-824.241] (-828.181) (-827.015) * (-826.527) (-829.005) (-826.204) [-825.845] -- 0:00:43
      282500 -- [-828.814] (-824.418) (-826.182) (-828.436) * (-826.525) (-827.390) [-827.707] (-826.234) -- 0:00:43
      283000 -- (-825.037) [-824.457] (-824.244) (-824.932) * (-825.580) [-827.210] (-827.706) (-825.823) -- 0:00:43
      283500 -- (-826.840) (-825.104) [-826.206] (-824.586) * (-824.434) (-826.375) [-826.233] (-824.283) -- 0:00:42
      284000 -- (-826.187) (-826.679) (-825.756) [-828.355] * (-825.864) (-825.448) [-826.187] (-824.786) -- 0:00:42
      284500 -- (-826.473) (-828.613) [-825.790] (-826.168) * [-826.767] (-826.519) (-825.401) (-825.263) -- 0:00:42
      285000 -- (-827.117) (-825.150) (-826.400) [-824.090] * (-824.842) [-826.035] (-825.584) (-826.422) -- 0:00:42

      Average standard deviation of split frequencies: 0.009981

      285500 -- (-826.353) (-828.592) (-827.050) [-826.136] * (-825.021) (-825.303) (-826.256) [-824.771] -- 0:00:42
      286000 -- (-826.341) (-828.413) [-827.413] (-826.116) * [-828.792] (-826.114) (-826.525) (-824.480) -- 0:00:42
      286500 -- (-824.144) (-825.582) [-828.272] (-825.986) * (-829.941) (-826.135) [-824.376] (-827.896) -- 0:00:42
      287000 -- [-824.453] (-825.526) (-828.741) (-826.338) * [-825.714] (-826.207) (-825.884) (-825.655) -- 0:00:42
      287500 -- [-824.502] (-824.728) (-827.013) (-826.072) * (-826.437) [-826.783] (-826.672) (-824.829) -- 0:00:42
      288000 -- (-825.004) (-828.145) (-826.852) [-825.917] * (-827.448) (-829.551) (-833.926) [-826.160] -- 0:00:42
      288500 -- (-825.003) [-830.687] (-827.200) (-835.594) * [-827.950] (-829.436) (-825.697) (-824.534) -- 0:00:41
      289000 -- [-824.739] (-826.182) (-827.342) (-833.144) * (-827.844) [-828.666] (-825.328) (-827.832) -- 0:00:44
      289500 -- (-824.395) (-831.052) (-826.225) [-824.964] * (-825.226) [-825.650] (-825.941) (-828.460) -- 0:00:44
      290000 -- [-825.627] (-829.003) (-825.131) (-827.227) * (-825.560) [-825.455] (-825.944) (-827.002) -- 0:00:44

      Average standard deviation of split frequencies: 0.010362

      290500 -- (-828.430) [-827.409] (-825.309) (-825.318) * (-825.211) (-825.254) (-826.668) [-827.598] -- 0:00:43
      291000 -- (-826.252) (-826.598) (-827.392) [-824.632] * (-826.189) (-828.803) (-826.915) [-829.041] -- 0:00:43
      291500 -- (-827.058) (-828.468) [-825.870] (-825.481) * (-828.690) [-830.047] (-831.942) (-827.452) -- 0:00:43
      292000 -- (-825.579) (-825.596) [-825.802] (-830.387) * (-828.614) (-826.096) [-826.299] (-827.273) -- 0:00:43
      292500 -- (-827.330) [-827.065] (-825.150) (-824.816) * (-830.999) (-825.068) [-826.465] (-826.529) -- 0:00:43
      293000 -- (-834.221) [-828.194] (-828.134) (-827.974) * (-828.418) [-826.063] (-826.148) (-829.458) -- 0:00:43
      293500 -- (-827.628) (-828.461) (-824.535) [-826.001] * (-829.459) [-826.340] (-825.912) (-825.503) -- 0:00:43
      294000 -- (-832.674) [-825.890] (-828.309) (-829.111) * [-827.059] (-825.011) (-826.447) (-830.874) -- 0:00:43
      294500 -- (-828.628) (-824.417) [-825.183] (-827.467) * (-825.470) (-826.489) (-825.431) [-825.461] -- 0:00:43
      295000 -- (-826.998) (-829.993) (-828.338) [-825.671] * [-826.500] (-825.143) (-830.147) (-826.611) -- 0:00:43

      Average standard deviation of split frequencies: 0.010706

      295500 -- [-827.408] (-828.109) (-828.974) (-825.770) * (-824.911) [-824.401] (-828.369) (-827.206) -- 0:00:42
      296000 -- (-825.561) (-828.255) (-825.245) [-825.958] * (-825.925) (-825.089) [-825.451] (-825.823) -- 0:00:42
      296500 -- (-826.621) [-823.925] (-825.583) (-828.372) * [-825.021] (-827.071) (-827.054) (-827.108) -- 0:00:42
      297000 -- (-827.801) (-825.044) [-825.911] (-826.338) * [-826.114] (-825.047) (-827.329) (-828.288) -- 0:00:42
      297500 -- (-826.361) [-825.746] (-828.933) (-827.227) * (-825.423) (-826.946) [-825.713] (-827.464) -- 0:00:42
      298000 -- (-829.981) (-824.072) [-824.652] (-825.943) * (-825.141) (-829.636) [-827.272] (-828.970) -- 0:00:42
      298500 -- (-826.780) [-824.244] (-825.707) (-824.383) * (-826.498) (-827.530) (-825.665) [-825.371] -- 0:00:42
      299000 -- (-828.102) (-830.054) (-826.023) [-827.746] * [-831.014] (-825.731) (-825.824) (-824.748) -- 0:00:42
      299500 -- (-824.084) [-824.360] (-829.161) (-828.287) * (-828.140) [-826.491] (-826.778) (-825.184) -- 0:00:42
      300000 -- (-826.684) (-827.120) (-827.702) [-827.322] * (-826.793) [-826.924] (-827.136) (-828.283) -- 0:00:42

      Average standard deviation of split frequencies: 0.009499

      300500 -- (-825.665) (-825.621) (-826.189) [-824.718] * (-825.720) (-824.429) (-827.433) [-833.202] -- 0:00:41
      301000 -- [-824.448] (-824.138) (-828.838) (-824.856) * (-827.547) (-824.813) [-826.175] (-830.094) -- 0:00:41
      301500 -- (-828.049) (-826.071) [-826.440] (-829.404) * (-829.538) (-824.565) [-824.815] (-825.968) -- 0:00:41
      302000 -- (-826.413) [-824.920] (-829.723) (-825.657) * (-827.531) (-825.532) [-825.155] (-825.358) -- 0:00:41
      302500 -- [-824.880] (-830.905) (-826.356) (-825.704) * [-826.401] (-827.222) (-826.225) (-825.438) -- 0:00:41
      303000 -- (-826.415) (-832.197) [-827.452] (-826.902) * (-829.187) (-826.147) [-825.099] (-824.824) -- 0:00:41
      303500 -- (-824.976) (-832.365) [-825.334] (-825.911) * (-826.538) (-826.837) [-825.253] (-825.898) -- 0:00:41
      304000 -- (-824.736) [-826.936] (-825.638) (-829.960) * (-826.579) [-824.602] (-828.285) (-827.017) -- 0:00:41
      304500 -- (-824.572) (-831.846) (-824.434) [-827.422] * (-824.618) (-825.009) (-828.432) [-825.068] -- 0:00:41
      305000 -- [-824.843] (-826.444) (-826.591) (-827.039) * (-825.224) (-824.288) [-828.936] (-825.717) -- 0:00:41

      Average standard deviation of split frequencies: 0.009515

      305500 -- (-826.389) (-827.182) [-828.778] (-827.158) * (-825.706) [-827.007] (-825.343) (-827.954) -- 0:00:43
      306000 -- [-825.576] (-827.918) (-825.910) (-826.229) * (-828.520) (-828.538) (-825.046) [-828.311] -- 0:00:43
      306500 -- (-825.750) [-828.888] (-824.549) (-828.603) * [-824.550] (-828.357) (-825.223) (-829.113) -- 0:00:42
      307000 -- (-828.603) [-826.945] (-827.235) (-826.594) * [-826.807] (-827.924) (-827.012) (-827.109) -- 0:00:42
      307500 -- (-825.855) (-827.152) (-825.836) [-830.342] * (-825.042) (-826.864) [-824.771] (-824.320) -- 0:00:42
      308000 -- (-824.945) [-831.963] (-824.467) (-827.385) * (-826.027) (-825.301) (-825.487) [-825.718] -- 0:00:42
      308500 -- (-825.233) (-826.141) [-824.825] (-825.682) * [-825.887] (-826.050) (-826.135) (-828.108) -- 0:00:42
      309000 -- (-825.713) (-829.826) (-827.547) [-825.322] * (-826.655) (-825.340) [-828.294] (-825.944) -- 0:00:42
      309500 -- (-826.182) (-832.040) [-831.379] (-826.460) * (-825.844) (-824.984) [-826.491] (-825.197) -- 0:00:42
      310000 -- (-824.499) (-825.665) [-825.106] (-825.867) * (-824.781) (-825.961) (-827.214) [-826.227] -- 0:00:42

      Average standard deviation of split frequencies: 0.009908

      310500 -- (-823.880) [-827.252] (-827.264) (-825.498) * (-827.230) (-826.672) (-828.632) [-825.565] -- 0:00:42
      311000 -- (-826.784) (-824.642) [-825.387] (-824.379) * [-826.656] (-826.308) (-827.137) (-825.487) -- 0:00:42
      311500 -- (-829.806) (-827.207) (-825.185) [-824.681] * (-825.780) [-825.722] (-826.849) (-825.626) -- 0:00:41
      312000 -- (-827.612) [-826.872] (-825.163) (-824.740) * (-825.288) (-824.283) (-823.949) [-825.882] -- 0:00:41
      312500 -- (-830.010) (-826.003) (-831.748) [-826.117] * (-826.237) [-825.462] (-824.464) (-830.841) -- 0:00:41
      313000 -- (-825.152) [-826.090] (-825.547) (-827.453) * [-824.265] (-827.718) (-824.464) (-825.524) -- 0:00:41
      313500 -- (-825.888) (-824.994) (-826.728) [-826.536] * [-826.233] (-825.649) (-825.978) (-825.964) -- 0:00:41
      314000 -- [-825.952] (-826.759) (-827.111) (-824.085) * [-828.488] (-827.780) (-827.071) (-826.398) -- 0:00:41
      314500 -- (-824.456) (-824.584) [-824.823] (-825.532) * (-824.392) (-830.551) [-825.057] (-824.376) -- 0:00:41
      315000 -- (-825.919) (-828.009) (-826.125) [-826.232] * (-826.661) (-827.722) (-825.745) [-824.813] -- 0:00:41

      Average standard deviation of split frequencies: 0.009976

      315500 -- (-825.509) (-828.010) (-826.237) [-827.551] * (-829.512) (-825.874) (-825.518) [-824.420] -- 0:00:41
      316000 -- (-825.029) (-825.049) (-827.829) [-825.035] * (-828.145) (-824.435) [-825.304] (-826.338) -- 0:00:41
      316500 -- (-825.029) (-825.192) (-830.465) [-825.967] * [-825.300] (-826.812) (-825.154) (-828.763) -- 0:00:41
      317000 -- (-824.727) (-824.073) [-827.764] (-825.967) * (-826.268) (-825.155) (-828.107) [-828.656] -- 0:00:40
      317500 -- (-824.956) [-826.778] (-827.815) (-831.393) * (-827.509) (-825.302) (-826.339) [-830.814] -- 0:00:40
      318000 -- (-826.617) (-829.997) (-825.314) [-826.240] * (-828.372) [-824.258] (-826.445) (-828.038) -- 0:00:40
      318500 -- (-827.111) (-825.144) (-824.215) [-826.731] * (-831.505) (-831.156) (-829.279) [-826.040] -- 0:00:40
      319000 -- (-827.161) (-825.276) (-824.168) [-824.340] * [-825.492] (-827.352) (-826.284) (-825.976) -- 0:00:40
      319500 -- (-828.361) (-829.365) [-824.399] (-826.056) * (-827.355) (-830.144) (-827.222) [-825.291] -- 0:00:40
      320000 -- (-824.798) (-830.980) [-826.344] (-830.078) * (-825.644) (-826.679) [-826.204] (-825.155) -- 0:00:40

      Average standard deviation of split frequencies: 0.008085

      320500 -- (-825.049) [-825.665] (-825.651) (-828.310) * (-824.331) [-829.120] (-826.406) (-824.645) -- 0:00:40
      321000 -- [-824.598] (-827.378) (-828.527) (-825.749) * (-823.991) [-830.006] (-827.120) (-824.923) -- 0:00:40
      321500 -- (-828.256) [-826.226] (-826.638) (-825.832) * [-826.942] (-825.755) (-824.735) (-825.784) -- 0:00:40
      322000 -- (-827.499) (-830.569) [-826.541] (-825.233) * (-825.801) [-824.619] (-824.735) (-827.852) -- 0:00:42
      322500 -- [-829.493] (-824.178) (-828.933) (-824.707) * [-825.465] (-824.808) (-826.356) (-826.515) -- 0:00:42
      323000 -- (-826.010) (-826.637) [-826.277] (-825.350) * (-826.477) (-826.603) [-826.166] (-825.417) -- 0:00:41
      323500 -- (-829.314) (-829.282) [-824.543] (-826.012) * [-826.378] (-824.104) (-827.158) (-824.626) -- 0:00:41
      324000 -- (-824.188) (-825.969) [-825.067] (-828.545) * (-825.972) (-824.135) (-825.640) [-824.008] -- 0:00:41
      324500 -- (-824.606) (-828.354) [-825.011] (-825.008) * (-826.707) (-824.960) [-825.799] (-832.505) -- 0:00:41
      325000 -- (-825.675) (-827.813) [-824.848] (-825.863) * (-826.596) (-825.011) (-826.257) [-826.337] -- 0:00:41

      Average standard deviation of split frequencies: 0.007411

      325500 -- (-828.121) (-824.523) [-824.222] (-825.422) * (-826.469) [-824.997] (-826.799) (-826.232) -- 0:00:41
      326000 -- (-825.439) (-825.302) (-825.481) [-828.668] * (-827.967) (-823.921) (-827.859) [-826.346] -- 0:00:41
      326500 -- (-827.541) [-824.491] (-825.407) (-825.897) * (-824.749) (-825.422) (-826.065) [-827.791] -- 0:00:41
      327000 -- (-826.624) (-826.365) [-825.588] (-825.449) * (-824.551) [-825.721] (-825.519) (-825.632) -- 0:00:41
      327500 -- (-824.456) (-826.592) [-826.745] (-827.597) * (-825.880) (-825.778) [-824.715] (-828.208) -- 0:00:41
      328000 -- (-829.327) (-825.903) (-828.428) [-826.765] * (-826.936) (-825.568) [-825.231] (-829.517) -- 0:00:40
      328500 -- (-826.755) (-829.059) (-826.842) [-824.562] * [-825.220] (-825.932) (-825.050) (-828.303) -- 0:00:40
      329000 -- (-826.732) (-825.750) (-825.186) [-824.595] * (-827.021) (-827.555) (-825.425) [-825.170] -- 0:00:40
      329500 -- (-824.846) (-826.856) (-824.658) [-825.485] * (-825.324) (-825.726) [-825.103] (-825.166) -- 0:00:40
      330000 -- (-823.978) (-824.558) (-825.791) [-826.356] * (-825.403) (-825.416) [-826.389] (-826.183) -- 0:00:40

      Average standard deviation of split frequencies: 0.006950

      330500 -- [-824.167] (-824.112) (-825.351) (-825.757) * (-825.166) [-826.170] (-826.451) (-828.070) -- 0:00:40
      331000 -- (-827.036) (-829.980) (-826.766) [-827.087] * (-826.257) (-827.197) (-828.677) [-828.456] -- 0:00:40
      331500 -- (-827.837) (-825.149) (-828.487) [-825.578] * (-827.424) [-826.388] (-826.547) (-827.655) -- 0:00:40
      332000 -- (-826.239) [-827.518] (-825.758) (-828.381) * (-826.244) [-824.956] (-824.593) (-830.253) -- 0:00:40
      332500 -- [-826.517] (-824.923) (-828.510) (-826.960) * (-825.459) (-827.903) [-826.100] (-826.718) -- 0:00:40
      333000 -- (-825.111) (-829.123) (-828.723) [-826.192] * (-826.602) (-828.878) (-828.238) [-826.187] -- 0:00:40
      333500 -- [-826.547] (-830.037) (-824.699) (-825.553) * [-825.741] (-826.266) (-830.202) (-825.820) -- 0:00:39
      334000 -- (-825.920) [-824.481] (-826.259) (-825.002) * [-825.408] (-826.824) (-829.560) (-827.449) -- 0:00:39
      334500 -- (-824.118) (-825.970) [-827.789] (-830.633) * (-826.039) [-824.153] (-829.702) (-825.290) -- 0:00:39
      335000 -- (-834.507) (-827.500) [-827.608] (-826.480) * (-824.722) (-825.881) [-825.429] (-828.766) -- 0:00:39

      Average standard deviation of split frequencies: 0.007345

      335500 -- [-827.571] (-825.246) (-824.973) (-826.550) * (-825.729) (-825.809) (-826.277) [-826.987] -- 0:00:39
      336000 -- [-826.764] (-824.619) (-829.402) (-827.473) * [-825.716] (-829.374) (-824.927) (-826.679) -- 0:00:39
      336500 -- (-825.912) (-825.810) [-828.707] (-832.402) * (-827.914) (-828.217) [-827.895] (-827.237) -- 0:00:39
      337000 -- [-825.452] (-826.298) (-825.717) (-830.090) * [-827.574] (-830.049) (-829.239) (-826.827) -- 0:00:39
      337500 -- [-826.557] (-826.655) (-825.958) (-826.519) * (-827.853) (-827.684) (-829.137) [-825.606] -- 0:00:39
      338000 -- (-826.914) (-829.700) [-824.166] (-826.271) * (-828.373) (-824.907) (-826.824) [-825.216] -- 0:00:39
      338500 -- [-827.822] (-828.418) (-825.547) (-830.008) * [-825.356] (-824.255) (-830.310) (-826.906) -- 0:00:41
      339000 -- (-825.190) (-829.765) [-827.026] (-825.845) * (-825.066) [-828.218] (-829.217) (-826.313) -- 0:00:40
      339500 -- (-830.428) (-830.309) (-828.054) [-826.373] * (-827.510) (-826.623) (-827.772) [-826.774] -- 0:00:40
      340000 -- (-828.436) (-824.408) [-825.616] (-826.398) * (-824.377) [-827.411] (-829.602) (-827.649) -- 0:00:40

      Average standard deviation of split frequencies: 0.007082

      340500 -- [-824.891] (-825.670) (-826.502) (-824.665) * (-825.940) (-825.956) [-829.234] (-830.996) -- 0:00:40
      341000 -- [-826.101] (-827.769) (-824.739) (-824.700) * [-826.536] (-824.899) (-832.647) (-825.272) -- 0:00:40
      341500 -- (-825.063) (-830.237) [-829.346] (-826.637) * (-829.033) (-826.392) (-830.316) [-826.102] -- 0:00:40
      342000 -- (-826.248) (-837.593) (-828.367) [-829.219] * [-825.661] (-824.534) (-827.052) (-826.172) -- 0:00:40
      342500 -- [-825.782] (-826.540) (-825.199) (-831.812) * (-826.493) [-825.312] (-828.245) (-826.883) -- 0:00:40
      343000 -- (-825.494) [-826.336] (-825.297) (-827.544) * (-826.684) [-825.973] (-827.407) (-828.176) -- 0:00:40
      343500 -- (-826.287) (-828.556) (-829.277) [-830.353] * (-827.949) (-825.509) [-827.833] (-828.045) -- 0:00:40
      344000 -- (-825.740) (-829.690) [-826.276] (-829.486) * [-824.900] (-831.151) (-824.590) (-825.919) -- 0:00:40
      344500 -- [-825.973] (-826.814) (-825.711) (-828.170) * (-825.048) [-827.840] (-826.461) (-825.103) -- 0:00:39
      345000 -- (-825.755) (-830.581) (-827.540) [-824.806] * (-824.964) (-824.327) [-824.805] (-825.867) -- 0:00:39

      Average standard deviation of split frequencies: 0.007373

      345500 -- (-825.190) (-826.340) (-827.254) [-825.201] * (-825.040) (-825.747) (-826.216) [-825.197] -- 0:00:39
      346000 -- [-825.492] (-828.691) (-826.093) (-826.080) * (-827.516) (-826.470) [-826.980] (-823.792) -- 0:00:39
      346500 -- [-825.187] (-826.617) (-829.031) (-824.992) * (-824.618) [-825.105] (-825.977) (-830.642) -- 0:00:39
      347000 -- (-825.599) (-824.204) (-826.459) [-825.054] * (-827.676) [-828.029] (-827.682) (-825.370) -- 0:00:39
      347500 -- (-828.433) [-823.980] (-825.983) (-827.418) * [-824.900] (-827.411) (-827.664) (-826.694) -- 0:00:39
      348000 -- (-826.267) (-824.346) (-827.936) [-826.430] * (-827.053) [-828.090] (-832.882) (-828.724) -- 0:00:39
      348500 -- (-824.872) (-824.346) (-832.058) [-826.242] * (-824.612) [-827.610] (-826.709) (-827.493) -- 0:00:39
      349000 -- (-825.364) (-825.151) [-826.745] (-826.764) * (-823.878) (-825.467) [-829.153] (-824.988) -- 0:00:39
      349500 -- (-828.755) (-827.664) [-825.938] (-824.073) * (-826.933) (-826.513) (-826.781) [-824.399] -- 0:00:39
      350000 -- (-826.109) (-835.944) [-826.637] (-824.910) * (-826.889) (-825.085) (-824.958) [-825.328] -- 0:00:39

      Average standard deviation of split frequencies: 0.007908

      350500 -- (-825.922) (-830.606) (-825.501) [-825.557] * (-828.885) (-828.130) (-826.725) [-826.749] -- 0:00:38
      351000 -- (-825.863) (-827.484) [-825.965] (-824.670) * (-830.345) [-827.862] (-825.018) (-824.917) -- 0:00:38
      351500 -- [-826.610] (-825.707) (-823.902) (-827.209) * [-830.454] (-829.861) (-826.536) (-825.630) -- 0:00:38
      352000 -- (-826.417) (-826.178) [-824.375] (-829.930) * [-826.633] (-834.312) (-828.028) (-827.195) -- 0:00:38
      352500 -- (-824.527) (-825.229) (-824.804) [-825.688] * (-825.101) (-831.125) [-829.358] (-827.471) -- 0:00:38
      353000 -- [-825.711] (-828.638) (-825.866) (-825.442) * [-826.469] (-828.610) (-826.496) (-828.511) -- 0:00:38
      353500 -- (-829.605) [-827.926] (-831.407) (-825.577) * (-824.908) [-827.771] (-824.338) (-828.074) -- 0:00:38
      354000 -- (-824.431) (-824.791) [-828.041] (-829.423) * [-824.863] (-827.855) (-824.669) (-825.030) -- 0:00:38
      354500 -- (-824.042) (-827.843) [-828.871] (-826.811) * (-826.269) (-825.096) (-826.033) [-824.312] -- 0:00:38
      355000 -- (-824.222) (-827.420) [-829.434] (-825.800) * (-824.538) (-826.218) [-825.868] (-824.170) -- 0:00:39

      Average standard deviation of split frequencies: 0.007789

      355500 -- [-824.287] (-825.242) (-825.921) (-831.293) * (-824.297) [-829.044] (-825.377) (-829.707) -- 0:00:39
      356000 -- [-825.445] (-824.864) (-826.139) (-826.144) * (-825.378) [-824.885] (-826.791) (-826.159) -- 0:00:39
      356500 -- (-825.848) (-825.584) (-829.101) [-827.900] * [-824.769] (-824.976) (-827.604) (-826.244) -- 0:00:39
      357000 -- (-824.031) (-825.770) (-828.154) [-828.062] * (-825.822) [-825.690] (-826.986) (-831.705) -- 0:00:39
      357500 -- (-824.491) [-828.816] (-830.072) (-827.528) * (-826.855) (-825.134) (-824.857) [-829.993] -- 0:00:39
      358000 -- (-825.297) (-827.145) (-828.180) [-825.948] * (-824.614) [-825.792] (-825.147) (-825.727) -- 0:00:39
      358500 -- [-826.348] (-828.753) (-828.004) (-830.935) * [-824.252] (-826.097) (-830.110) (-828.013) -- 0:00:39
      359000 -- [-824.552] (-828.034) (-828.530) (-827.518) * [-825.123] (-826.700) (-826.937) (-828.103) -- 0:00:39
      359500 -- (-826.827) (-827.820) [-830.925] (-832.233) * (-826.221) (-824.276) (-824.683) [-827.314] -- 0:00:39
      360000 -- (-825.097) [-827.428] (-824.945) (-826.621) * (-826.218) (-826.019) (-825.785) [-824.709] -- 0:00:39

      Average standard deviation of split frequencies: 0.007842

      360500 -- (-825.118) (-826.094) [-824.228] (-825.909) * (-824.548) [-829.344] (-824.970) (-825.630) -- 0:00:39
      361000 -- (-825.065) (-827.055) (-825.081) [-824.690] * (-827.972) [-827.129] (-824.374) (-826.191) -- 0:00:38
      361500 -- (-824.619) (-826.999) (-826.698) [-825.527] * (-827.116) (-826.882) (-825.842) [-826.818] -- 0:00:38
      362000 -- (-826.492) (-825.682) (-826.441) [-824.494] * [-825.002] (-824.179) (-828.935) (-825.905) -- 0:00:38
      362500 -- (-827.892) (-825.236) [-823.992] (-824.403) * (-829.649) (-825.815) [-824.380] (-825.522) -- 0:00:38
      363000 -- (-826.603) (-826.975) (-826.677) [-826.050] * (-826.449) (-828.233) (-824.702) [-824.547] -- 0:00:38
      363500 -- (-826.659) [-825.763] (-827.455) (-826.601) * [-826.532] (-824.157) (-826.147) (-824.294) -- 0:00:38
      364000 -- [-826.554] (-825.239) (-826.258) (-824.643) * [-824.301] (-826.557) (-825.065) (-826.902) -- 0:00:38
      364500 -- (-826.852) (-825.572) (-826.126) [-824.073] * (-824.969) (-826.742) [-825.381] (-826.377) -- 0:00:38
      365000 -- (-827.568) (-828.786) (-827.734) [-829.126] * (-825.816) (-825.860) (-826.586) [-824.477] -- 0:00:38

      Average standard deviation of split frequencies: 0.008229

      365500 -- [-824.585] (-827.225) (-824.520) (-827.893) * (-826.762) (-826.781) (-829.462) [-823.953] -- 0:00:38
      366000 -- (-830.429) (-825.358) (-826.215) [-826.903] * [-824.767] (-828.717) (-826.101) (-826.193) -- 0:00:38
      366500 -- (-824.324) [-827.201] (-827.607) (-825.868) * [-825.097] (-827.438) (-830.846) (-825.874) -- 0:00:38
      367000 -- (-827.158) [-826.801] (-829.737) (-826.331) * [-825.557] (-825.987) (-826.721) (-826.164) -- 0:00:37
      367500 -- [-824.527] (-827.829) (-831.009) (-824.269) * [-823.844] (-826.147) (-826.512) (-828.152) -- 0:00:37
      368000 -- (-824.015) (-826.966) [-824.373] (-824.839) * (-823.844) (-827.729) [-824.640] (-828.041) -- 0:00:37
      368500 -- (-825.899) (-826.954) (-824.626) [-826.212] * [-825.826] (-834.854) (-826.603) (-828.106) -- 0:00:37
      369000 -- (-827.269) (-824.173) [-824.624] (-824.606) * (-825.284) (-825.214) (-826.090) [-826.535] -- 0:00:37
      369500 -- [-825.180] (-824.823) (-826.067) (-825.432) * (-827.038) (-825.062) [-827.594] (-828.096) -- 0:00:37
      370000 -- (-825.013) (-825.482) [-824.569] (-827.037) * (-824.949) (-824.192) (-825.880) [-824.410] -- 0:00:37

      Average standard deviation of split frequencies: 0.008055

      370500 -- (-824.741) [-826.664] (-825.658) (-826.762) * (-824.960) [-824.656] (-827.963) (-826.037) -- 0:00:37
      371000 -- (-826.288) (-824.484) (-826.159) [-828.763] * (-826.115) [-826.334] (-827.408) (-826.617) -- 0:00:37
      371500 -- (-826.157) (-824.215) [-830.069] (-828.087) * (-825.374) (-829.625) (-827.698) [-827.544] -- 0:00:38
      372000 -- (-825.573) [-826.280] (-826.012) (-825.949) * (-829.664) (-829.148) (-826.437) [-826.167] -- 0:00:38
      372500 -- [-826.383] (-834.634) (-825.951) (-825.548) * [-829.546] (-829.332) (-826.320) (-826.180) -- 0:00:38
      373000 -- [-826.093] (-825.885) (-831.710) (-828.058) * [-826.120] (-824.766) (-825.124) (-825.387) -- 0:00:38
      373500 -- [-824.997] (-825.909) (-827.645) (-827.896) * (-831.966) (-825.725) (-825.634) [-827.293] -- 0:00:38
      374000 -- (-824.347) [-829.341] (-826.367) (-825.191) * [-828.500] (-827.147) (-824.386) (-826.217) -- 0:00:38
      374500 -- [-824.476] (-825.311) (-826.525) (-826.019) * (-826.105) (-825.433) [-824.778] (-824.471) -- 0:00:38
      375000 -- (-824.843) (-825.276) (-826.245) [-825.550] * (-825.397) [-825.569] (-825.222) (-824.459) -- 0:00:38

      Average standard deviation of split frequencies: 0.008985

      375500 -- (-825.565) (-824.079) [-824.951] (-827.397) * (-827.227) (-824.866) [-827.639] (-824.337) -- 0:00:38
      376000 -- (-826.500) [-824.962] (-825.504) (-824.053) * [-825.828] (-825.970) (-827.884) (-828.138) -- 0:00:38
      376500 -- (-827.662) (-831.163) [-825.528] (-824.628) * (-827.459) (-825.171) (-824.708) [-827.466] -- 0:00:38
      377000 -- (-825.767) (-827.489) [-825.042] (-825.311) * (-825.088) (-826.244) (-826.520) [-825.373] -- 0:00:38
      377500 -- (-825.442) (-824.924) [-824.723] (-824.914) * (-828.934) [-825.557] (-824.737) (-830.579) -- 0:00:37
      378000 -- (-826.026) (-826.159) [-828.524] (-825.583) * (-828.571) (-825.624) [-824.102] (-827.563) -- 0:00:37
      378500 -- (-824.726) [-826.000] (-830.521) (-830.701) * (-829.140) [-825.700] (-825.709) (-828.343) -- 0:00:37
      379000 -- [-825.587] (-826.099) (-825.546) (-825.888) * [-827.358] (-828.636) (-826.452) (-832.177) -- 0:00:37
      379500 -- (-828.041) (-827.187) [-828.952] (-825.053) * (-826.051) [-825.324] (-825.226) (-827.695) -- 0:00:37
      380000 -- (-825.613) [-824.752] (-828.372) (-824.529) * [-824.581] (-825.817) (-828.843) (-825.557) -- 0:00:37

      Average standard deviation of split frequencies: 0.008462

      380500 -- (-826.383) [-827.974] (-827.437) (-825.881) * [-824.798] (-826.550) (-826.672) (-825.162) -- 0:00:37
      381000 -- [-826.353] (-828.273) (-825.021) (-826.340) * [-824.447] (-824.423) (-827.006) (-825.337) -- 0:00:37
      381500 -- (-826.177) (-824.134) (-827.136) [-825.628] * (-826.481) (-826.489) (-825.799) [-826.904] -- 0:00:37
      382000 -- (-825.245) [-825.139] (-826.085) (-825.706) * (-825.485) (-829.642) (-826.445) [-825.265] -- 0:00:37
      382500 -- (-823.920) (-824.759) [-830.507] (-828.129) * (-825.900) (-825.892) (-825.642) [-825.513] -- 0:00:37
      383000 -- [-825.063] (-826.450) (-827.364) (-824.555) * [-825.492] (-826.061) (-828.353) (-825.669) -- 0:00:37
      383500 -- (-827.338) [-826.515] (-824.540) (-825.150) * (-824.692) [-826.563] (-825.051) (-826.789) -- 0:00:36
      384000 -- (-826.995) (-826.553) [-825.919] (-825.729) * (-824.567) (-824.933) (-826.727) [-824.578] -- 0:00:36
      384500 -- (-824.899) [-825.328] (-824.927) (-825.627) * (-826.048) (-823.866) (-830.200) [-824.997] -- 0:00:36
      385000 -- (-824.906) (-825.128) [-824.878] (-825.461) * (-824.757) (-824.953) [-824.635] (-826.819) -- 0:00:36

      Average standard deviation of split frequencies: 0.007938

      385500 -- (-824.998) (-826.573) [-825.486] (-825.388) * (-827.773) (-824.128) [-829.057] (-828.182) -- 0:00:36
      386000 -- (-825.189) (-826.897) (-827.390) [-827.914] * (-824.305) [-823.774] (-827.091) (-825.650) -- 0:00:36
      386500 -- (-826.369) [-825.950] (-823.893) (-827.328) * (-824.661) [-828.458] (-827.778) (-826.754) -- 0:00:36
      387000 -- [-827.180] (-824.598) (-827.338) (-830.923) * (-824.923) [-828.417] (-826.098) (-828.511) -- 0:00:36
      387500 -- (-831.590) (-825.205) (-827.782) [-826.443] * (-825.092) [-824.515] (-825.050) (-829.488) -- 0:00:36
      388000 -- [-824.982] (-825.348) (-827.037) (-824.545) * (-824.629) (-826.477) (-825.383) [-826.262] -- 0:00:37
      388500 -- (-825.635) (-826.933) (-826.906) [-826.421] * [-825.842] (-826.116) (-824.720) (-826.319) -- 0:00:37
      389000 -- (-825.999) (-827.679) (-823.982) [-825.220] * (-825.312) (-824.566) (-824.895) [-828.870] -- 0:00:37
      389500 -- (-827.034) [-824.993] (-824.088) (-825.589) * (-827.202) (-824.089) (-828.252) [-826.668] -- 0:00:37
      390000 -- (-826.891) [-827.237] (-824.796) (-825.021) * [-828.527] (-825.039) (-825.862) (-828.316) -- 0:00:37

      Average standard deviation of split frequencies: 0.006905

      390500 -- [-825.263] (-828.540) (-828.626) (-825.287) * (-826.336) (-829.243) [-825.266] (-827.630) -- 0:00:37
      391000 -- (-829.956) (-828.456) (-826.273) [-830.660] * [-826.112] (-827.196) (-825.423) (-829.691) -- 0:00:37
      391500 -- (-830.269) (-825.206) (-830.216) [-826.643] * (-827.659) (-827.668) (-826.559) [-825.088] -- 0:00:37
      392000 -- (-828.709) [-825.813] (-828.685) (-827.842) * (-827.951) [-828.609] (-827.915) (-830.266) -- 0:00:37
      392500 -- (-825.082) [-824.825] (-831.927) (-827.770) * [-824.384] (-828.357) (-825.170) (-827.438) -- 0:00:37
      393000 -- (-825.071) [-825.214] (-826.398) (-824.786) * (-825.783) [-825.705] (-825.543) (-832.135) -- 0:00:37
      393500 -- (-825.498) (-825.299) (-823.828) [-828.525] * (-826.445) (-824.366) [-825.612] (-824.626) -- 0:00:36
      394000 -- [-827.367] (-826.036) (-825.850) (-827.936) * (-829.059) (-825.822) [-825.544] (-826.865) -- 0:00:36
      394500 -- (-827.921) [-825.192] (-827.869) (-829.177) * (-828.154) [-825.333] (-825.601) (-826.766) -- 0:00:36
      395000 -- [-826.344] (-826.122) (-829.015) (-830.725) * [-828.560] (-825.617) (-824.172) (-825.056) -- 0:00:36

      Average standard deviation of split frequencies: 0.007076

      395500 -- (-825.662) (-825.994) [-824.911] (-826.674) * [-827.175] (-824.748) (-824.710) (-825.348) -- 0:00:36
      396000 -- [-826.190] (-825.050) (-827.928) (-827.970) * [-825.601] (-824.597) (-825.191) (-824.762) -- 0:00:36
      396500 -- [-826.728] (-825.919) (-825.613) (-826.046) * (-824.418) [-827.036] (-829.139) (-825.651) -- 0:00:36
      397000 -- (-830.549) (-826.220) (-828.496) [-825.658] * (-826.189) (-828.775) (-828.832) [-825.458] -- 0:00:36
      397500 -- (-826.592) (-828.762) (-825.873) [-825.469] * [-825.383] (-827.676) (-826.398) (-825.586) -- 0:00:36
      398000 -- (-825.595) (-827.195) [-826.342] (-827.905) * (-825.024) [-825.996] (-830.378) (-823.769) -- 0:00:36
      398500 -- [-825.679] (-825.300) (-825.998) (-826.482) * (-825.238) (-825.529) [-829.274] (-826.670) -- 0:00:36
      399000 -- (-824.224) (-828.876) (-829.130) [-826.739] * (-825.314) [-826.827] (-825.291) (-829.649) -- 0:00:36
      399500 -- [-825.646] (-834.637) (-828.953) (-825.455) * (-826.661) (-825.775) (-824.852) [-824.640] -- 0:00:36
      400000 -- (-825.555) (-825.043) [-825.075] (-824.502) * (-827.093) [-827.163] (-828.809) (-825.206) -- 0:00:36

      Average standard deviation of split frequencies: 0.007405

      400500 -- [-827.039] (-826.716) (-825.069) (-824.250) * (-824.844) (-825.403) (-831.271) [-824.101] -- 0:00:35
      401000 -- (-826.346) (-828.762) [-824.955] (-829.546) * (-825.612) (-825.403) [-830.833] (-825.165) -- 0:00:35
      401500 -- (-826.242) [-826.263] (-824.620) (-826.611) * (-825.535) (-825.214) [-827.278] (-824.461) -- 0:00:35
      402000 -- (-826.396) (-828.083) (-826.476) [-826.224] * [-824.220] (-825.250) (-826.915) (-826.485) -- 0:00:35
      402500 -- (-825.998) (-824.755) [-824.431] (-827.218) * [-825.217] (-827.900) (-825.402) (-825.456) -- 0:00:35
      403000 -- (-825.841) [-824.307] (-824.665) (-824.471) * (-826.094) [-825.359] (-824.645) (-824.748) -- 0:00:35
      403500 -- [-825.205] (-824.739) (-828.128) (-828.141) * (-826.349) (-824.750) [-827.595] (-824.504) -- 0:00:35
      404000 -- (-824.821) (-824.932) (-826.779) [-826.375] * (-827.922) [-825.130] (-826.903) (-829.947) -- 0:00:35
      404500 -- [-823.906] (-827.620) (-825.983) (-828.919) * (-825.541) (-826.227) [-827.943] (-827.196) -- 0:00:35
      405000 -- (-823.998) (-825.760) [-825.019] (-825.744) * (-824.369) (-825.465) (-826.181) [-825.942] -- 0:00:36

      Average standard deviation of split frequencies: 0.007171

      405500 -- [-825.308] (-825.162) (-825.312) (-825.851) * (-824.526) (-826.078) [-824.474] (-826.413) -- 0:00:36
      406000 -- [-826.495] (-826.159) (-827.595) (-824.643) * [-825.319] (-825.116) (-824.392) (-825.864) -- 0:00:36
      406500 -- [-825.910] (-825.913) (-826.194) (-825.732) * (-824.432) (-828.135) [-827.893] (-827.263) -- 0:00:36
      407000 -- (-825.444) (-825.622) [-826.679] (-826.897) * [-825.992] (-827.265) (-824.534) (-826.083) -- 0:00:36
      407500 -- (-827.282) (-828.421) [-825.615] (-832.574) * [-825.823] (-824.980) (-826.555) (-828.381) -- 0:00:36
      408000 -- (-827.357) [-827.896] (-827.315) (-829.122) * (-826.189) [-824.853] (-825.881) (-827.176) -- 0:00:36
      408500 -- (-827.311) (-825.766) [-826.291] (-828.661) * (-824.484) [-826.802] (-824.799) (-828.714) -- 0:00:36
      409000 -- (-828.106) [-826.286] (-827.903) (-827.008) * (-825.113) (-825.472) (-825.408) [-827.260] -- 0:00:36
      409500 -- [-827.194] (-828.934) (-824.394) (-826.325) * (-824.565) [-825.619] (-826.309) (-825.552) -- 0:00:36
      410000 -- [-824.806] (-826.625) (-824.441) (-827.309) * [-825.999] (-825.600) (-826.311) (-826.114) -- 0:00:35

      Average standard deviation of split frequencies: 0.007225

      410500 -- [-825.363] (-828.244) (-824.993) (-826.042) * (-830.079) (-826.293) (-826.313) [-824.501] -- 0:00:35
      411000 -- (-827.231) (-825.215) (-825.253) [-826.181] * (-826.896) [-826.128] (-826.812) (-824.597) -- 0:00:35
      411500 -- (-827.572) (-825.267) (-825.901) [-825.173] * (-828.649) [-829.200] (-826.903) (-827.548) -- 0:00:35
      412000 -- (-825.311) [-826.193] (-825.805) (-827.178) * (-825.273) (-832.327) [-825.396] (-828.546) -- 0:00:35
      412500 -- (-827.133) (-826.644) (-826.144) [-827.163] * (-827.575) (-827.005) (-827.742) [-825.976] -- 0:00:35
      413000 -- (-825.681) (-829.053) [-825.144] (-827.395) * (-825.954) (-828.610) [-827.083] (-828.170) -- 0:00:35
      413500 -- (-825.981) (-824.967) [-825.109] (-826.244) * [-828.421] (-830.688) (-832.527) (-825.542) -- 0:00:35
      414000 -- (-827.992) [-824.942] (-824.261) (-826.878) * [-825.226] (-825.882) (-833.280) (-831.315) -- 0:00:35
      414500 -- (-829.806) [-825.732] (-824.748) (-824.420) * (-826.864) (-827.964) [-827.453] (-826.961) -- 0:00:35
      415000 -- (-826.793) (-825.800) (-827.537) [-825.064] * (-828.306) (-825.516) [-828.552] (-828.575) -- 0:00:35

      Average standard deviation of split frequencies: 0.006732

      415500 -- [-824.668] (-824.076) (-828.482) (-825.222) * (-826.533) (-825.409) [-827.221] (-828.275) -- 0:00:35
      416000 -- (-829.361) (-824.756) (-829.750) [-825.264] * (-823.934) (-824.784) [-824.688] (-825.973) -- 0:00:35
      416500 -- (-826.875) (-826.998) (-829.227) [-825.139] * [-825.697] (-824.877) (-827.224) (-825.443) -- 0:00:35
      417000 -- (-825.436) [-826.217] (-825.949) (-825.786) * (-826.635) (-825.762) (-826.940) [-826.088] -- 0:00:34
      417500 -- [-827.269] (-826.955) (-826.365) (-825.113) * (-829.144) [-834.582] (-824.902) (-826.976) -- 0:00:34
      418000 -- [-825.966] (-826.731) (-826.952) (-825.397) * (-826.608) [-829.685] (-826.922) (-826.290) -- 0:00:34
      418500 -- (-826.969) (-824.452) [-825.451] (-824.788) * (-825.529) (-830.036) (-826.235) [-824.814] -- 0:00:34
      419000 -- [-825.201] (-824.158) (-825.527) (-828.560) * (-824.514) [-830.864] (-824.240) (-824.816) -- 0:00:34
      419500 -- [-824.873] (-831.979) (-828.394) (-828.080) * [-826.128] (-826.172) (-825.586) (-824.717) -- 0:00:34
      420000 -- (-826.244) (-826.078) [-825.130] (-826.273) * [-825.970] (-827.369) (-825.159) (-824.681) -- 0:00:34

      Average standard deviation of split frequencies: 0.007251

      420500 -- (-828.026) [-826.948] (-824.571) (-825.249) * (-824.520) [-824.220] (-825.911) (-824.160) -- 0:00:34
      421000 -- (-830.919) (-825.738) (-824.606) [-828.160] * (-827.229) (-826.867) (-829.613) [-826.589] -- 0:00:34
      421500 -- (-824.920) (-826.469) [-824.611] (-827.897) * (-825.761) [-826.708] (-825.183) (-832.119) -- 0:00:34
      422000 -- (-829.655) [-827.662] (-824.622) (-824.654) * (-824.371) (-826.900) (-826.251) [-826.118] -- 0:00:35
      422500 -- (-829.712) [-827.310] (-826.928) (-826.547) * [-824.719] (-825.309) (-825.787) (-829.388) -- 0:00:35
      423000 -- (-827.657) [-826.359] (-827.717) (-830.779) * (-824.628) (-825.895) (-825.903) [-829.205] -- 0:00:35
      423500 -- (-827.095) (-833.520) (-824.785) [-827.633] * (-827.074) (-829.862) [-831.356] (-826.023) -- 0:00:35
      424000 -- (-827.101) [-824.916] (-824.007) (-826.747) * (-826.330) [-825.510] (-827.581) (-825.611) -- 0:00:35
      424500 -- [-824.659] (-828.118) (-824.197) (-828.501) * (-826.831) [-825.545] (-825.386) (-826.452) -- 0:00:35
      425000 -- (-825.113) (-826.315) [-824.450] (-827.806) * (-825.630) (-826.339) [-826.165] (-826.243) -- 0:00:35

      Average standard deviation of split frequencies: 0.007746

      425500 -- (-825.620) (-825.192) [-824.305] (-825.470) * [-825.185] (-827.824) (-826.555) (-828.261) -- 0:00:35
      426000 -- [-826.098] (-823.930) (-826.255) (-824.817) * (-825.135) (-827.322) [-825.563] (-828.349) -- 0:00:35
      426500 -- [-825.856] (-824.454) (-826.015) (-825.381) * (-825.284) [-830.057] (-823.991) (-825.545) -- 0:00:34
      427000 -- (-826.338) (-824.739) [-825.445] (-824.805) * [-827.166] (-828.435) (-825.042) (-827.124) -- 0:00:34
      427500 -- (-826.338) [-826.467] (-827.482) (-825.492) * (-827.441) [-826.561] (-824.471) (-829.549) -- 0:00:34
      428000 -- (-823.999) (-824.886) (-826.802) [-825.393] * (-826.803) (-825.503) (-827.672) [-824.952] -- 0:00:34
      428500 -- (-825.921) [-824.201] (-826.732) (-828.329) * (-825.550) [-826.253] (-826.115) (-825.110) -- 0:00:34
      429000 -- (-824.533) (-824.947) [-825.416] (-827.348) * (-825.721) [-826.980] (-826.307) (-824.237) -- 0:00:34
      429500 -- (-824.099) [-825.487] (-824.608) (-827.191) * (-825.462) [-827.169] (-824.795) (-824.197) -- 0:00:34
      430000 -- (-824.901) [-824.824] (-824.608) (-825.755) * (-827.254) (-828.550) (-824.142) [-824.246] -- 0:00:34

      Average standard deviation of split frequencies: 0.008048

      430500 -- (-826.160) (-824.988) (-825.636) [-826.317] * (-825.778) (-827.223) [-826.086] (-825.503) -- 0:00:34
      431000 -- [-827.272] (-825.888) (-824.919) (-825.036) * (-826.958) [-826.237] (-826.198) (-825.755) -- 0:00:34
      431500 -- (-826.637) (-825.032) (-824.796) [-825.683] * (-827.679) (-826.779) (-826.879) [-825.542] -- 0:00:34
      432000 -- (-825.824) (-824.764) (-827.157) [-825.216] * [-826.818] (-825.301) (-826.772) (-825.900) -- 0:00:34
      432500 -- (-828.124) (-824.963) (-824.600) [-827.129] * (-828.162) (-825.709) (-827.895) [-824.735] -- 0:00:34
      433000 -- [-825.078] (-825.224) (-826.422) (-826.960) * (-827.302) [-825.872] (-826.166) (-825.296) -- 0:00:34
      433500 -- [-824.677] (-825.225) (-827.522) (-826.254) * [-826.550] (-826.275) (-826.937) (-825.388) -- 0:00:33
      434000 -- (-824.215) [-827.064] (-824.252) (-824.806) * (-825.657) [-825.330] (-825.646) (-825.625) -- 0:00:33
      434500 -- (-824.148) [-825.211] (-829.322) (-824.752) * (-825.580) (-825.747) (-824.929) [-829.282] -- 0:00:33
      435000 -- (-824.947) (-825.506) [-827.442] (-825.778) * (-827.024) (-825.596) (-825.134) [-833.274] -- 0:00:33

      Average standard deviation of split frequencies: 0.006614

      435500 -- (-827.843) [-826.393] (-827.288) (-824.555) * (-825.239) [-824.961] (-825.331) (-827.171) -- 0:00:33
      436000 -- (-827.212) [-826.082] (-830.865) (-824.259) * [-825.412] (-824.614) (-827.521) (-826.884) -- 0:00:33
      436500 -- (-829.125) [-826.095] (-827.143) (-824.442) * (-824.851) [-823.783] (-825.666) (-824.286) -- 0:00:33
      437000 -- (-826.148) (-831.646) (-829.502) [-828.885] * (-825.183) [-825.262] (-825.219) (-826.558) -- 0:00:33
      437500 -- (-825.968) (-826.596) (-826.348) [-825.802] * (-827.884) (-829.143) [-825.086] (-825.109) -- 0:00:33
      438000 -- (-829.171) (-824.404) (-826.753) [-826.623] * [-827.100] (-828.300) (-824.719) (-824.786) -- 0:00:33
      438500 -- (-824.780) (-825.169) (-830.014) [-825.739] * (-828.705) (-824.092) [-825.654] (-825.237) -- 0:00:34
      439000 -- [-825.014] (-824.978) (-829.371) (-827.332) * [-824.576] (-824.723) (-827.368) (-825.792) -- 0:00:34
      439500 -- (-830.056) (-826.806) (-827.278) [-831.027] * [-826.081] (-825.071) (-825.167) (-825.290) -- 0:00:34
      440000 -- [-828.333] (-829.291) (-824.850) (-824.719) * (-829.274) (-825.851) [-826.862] (-826.374) -- 0:00:34

      Average standard deviation of split frequencies: 0.007237

      440500 -- [-827.839] (-827.710) (-825.094) (-825.392) * (-826.312) (-824.647) (-825.627) [-828.432] -- 0:00:34
      441000 -- (-827.844) (-825.585) [-824.816] (-826.372) * (-827.372) (-824.554) (-825.036) [-825.743] -- 0:00:34
      441500 -- (-827.612) [-825.285] (-826.319) (-824.508) * (-824.900) (-827.496) [-825.491] (-828.071) -- 0:00:34
      442000 -- (-825.553) [-826.332] (-827.751) (-826.425) * [-826.291] (-828.502) (-826.705) (-828.331) -- 0:00:34
      442500 -- [-827.605] (-824.775) (-825.036) (-825.583) * (-826.814) [-828.121] (-829.791) (-828.704) -- 0:00:34
      443000 -- [-826.777] (-824.628) (-824.818) (-826.361) * (-824.743) (-827.648) (-828.354) [-826.086] -- 0:00:33
      443500 -- (-826.060) [-826.426] (-827.890) (-826.239) * (-824.574) (-826.606) (-825.161) [-830.135] -- 0:00:33
      444000 -- (-827.172) (-826.426) (-824.298) [-831.051] * (-825.169) [-826.002] (-824.551) (-827.815) -- 0:00:33
      444500 -- (-825.794) [-825.037] (-827.872) (-825.405) * [-824.564] (-828.404) (-825.207) (-827.737) -- 0:00:33
      445000 -- (-826.594) (-828.393) (-825.052) [-825.013] * (-824.685) (-827.633) [-826.809] (-827.044) -- 0:00:33

      Average standard deviation of split frequencies: 0.007692

      445500 -- (-826.913) (-828.450) (-823.753) [-824.161] * (-825.989) (-827.302) [-826.186] (-826.744) -- 0:00:33
      446000 -- (-825.495) (-833.049) (-825.796) [-825.505] * (-826.789) (-827.210) [-824.679] (-825.834) -- 0:00:33
      446500 -- (-825.371) (-826.629) (-825.833) [-826.493] * (-827.241) [-824.383] (-828.114) (-826.072) -- 0:00:33
      447000 -- (-825.703) [-826.183] (-825.035) (-826.021) * [-827.666] (-824.778) (-825.255) (-825.430) -- 0:00:33
      447500 -- (-824.964) [-828.874] (-829.332) (-826.961) * (-825.693) [-825.577] (-825.269) (-828.543) -- 0:00:33
      448000 -- (-825.413) [-823.929] (-824.836) (-827.183) * (-828.547) [-825.925] (-825.174) (-824.786) -- 0:00:33
      448500 -- (-824.650) [-825.100] (-827.331) (-827.422) * (-824.401) (-826.479) (-825.370) [-826.220] -- 0:00:33
      449000 -- (-827.531) (-825.504) [-826.026] (-826.102) * (-826.457) (-830.621) (-830.751) [-825.844] -- 0:00:33
      449500 -- (-826.148) (-828.279) (-825.222) [-825.089] * (-826.216) [-828.187] (-830.236) (-825.886) -- 0:00:33
      450000 -- [-824.290] (-827.436) (-824.890) (-824.789) * (-826.086) [-826.930] (-829.990) (-825.585) -- 0:00:33

      Average standard deviation of split frequencies: 0.007876

      450500 -- (-826.889) (-825.139) (-828.842) [-827.469] * (-831.065) (-827.273) [-828.447] (-826.493) -- 0:00:32
      451000 -- [-826.614] (-825.703) (-828.938) (-826.578) * (-827.956) (-826.769) (-825.668) [-830.467] -- 0:00:32
      451500 -- [-825.721] (-826.800) (-826.548) (-826.153) * (-827.238) [-825.535] (-830.789) (-829.677) -- 0:00:32
      452000 -- (-826.405) [-827.075] (-824.718) (-825.686) * [-827.220] (-827.917) (-832.006) (-827.371) -- 0:00:32
      452500 -- (-824.960) (-828.172) [-825.496] (-824.505) * [-827.491] (-825.298) (-828.019) (-827.663) -- 0:00:32
      453000 -- (-825.724) (-825.630) [-825.346] (-824.947) * (-827.912) (-826.045) (-825.429) [-827.972] -- 0:00:32
      453500 -- (-827.549) (-827.057) (-828.896) [-826.092] * [-825.392] (-824.768) (-826.163) (-825.536) -- 0:00:32
      454000 -- (-824.719) (-829.032) (-825.805) [-825.194] * [-827.790] (-824.135) (-824.739) (-826.036) -- 0:00:32
      454500 -- (-826.014) (-824.705) (-826.510) [-826.548] * [-825.068] (-825.041) (-828.421) (-826.935) -- 0:00:32
      455000 -- (-824.455) (-825.123) (-829.567) [-824.856] * (-825.564) [-826.538] (-825.155) (-826.163) -- 0:00:32

      Average standard deviation of split frequencies: 0.008500

      455500 -- (-828.568) (-827.243) (-827.353) [-824.961] * (-825.410) [-825.207] (-829.324) (-826.182) -- 0:00:33
      456000 -- (-827.965) (-824.802) (-824.876) [-824.628] * (-824.900) (-825.441) (-827.088) [-827.212] -- 0:00:33
      456500 -- (-827.646) (-824.653) (-829.004) [-824.650] * (-827.092) (-826.753) (-824.560) [-824.139] -- 0:00:33
      457000 -- (-825.806) (-827.945) (-825.191) [-824.413] * (-826.015) [-825.483] (-827.612) (-824.422) -- 0:00:33
      457500 -- (-825.763) (-826.064) (-826.692) [-828.290] * (-828.452) [-826.058] (-826.757) (-825.791) -- 0:00:33
      458000 -- (-825.912) (-824.991) [-824.763] (-825.263) * (-824.862) (-828.868) (-825.543) [-827.497] -- 0:00:33
      458500 -- (-832.139) [-826.341] (-825.483) (-828.410) * (-827.426) (-828.527) (-828.693) [-827.232] -- 0:00:33
      459000 -- (-829.448) [-827.388] (-825.564) (-827.196) * (-826.953) (-824.591) (-827.295) [-828.804] -- 0:00:33
      459500 -- (-826.971) (-825.079) [-825.920] (-826.790) * (-828.363) [-824.701] (-828.651) (-832.582) -- 0:00:32
      460000 -- (-826.348) (-829.928) [-827.349] (-825.554) * (-825.388) [-826.793] (-826.722) (-824.950) -- 0:00:32

      Average standard deviation of split frequencies: 0.008307

      460500 -- (-828.583) [-828.301] (-828.804) (-828.215) * (-825.133) [-825.556] (-826.834) (-827.402) -- 0:00:32
      461000 -- (-826.144) (-826.723) [-825.912] (-830.927) * (-826.998) [-825.931] (-825.566) (-832.583) -- 0:00:32
      461500 -- (-825.724) (-827.074) [-825.376] (-827.267) * (-825.124) (-826.600) (-825.314) [-826.162] -- 0:00:32
      462000 -- (-826.275) (-825.863) [-828.189] (-826.218) * (-827.296) (-827.792) [-825.947] (-825.947) -- 0:00:32
      462500 -- (-827.371) (-825.987) (-825.985) [-825.757] * [-826.082] (-828.207) (-825.244) (-829.363) -- 0:00:32
      463000 -- (-829.946) [-825.294] (-825.388) (-827.288) * (-830.607) (-826.516) [-826.033] (-826.666) -- 0:00:32
      463500 -- [-827.132] (-827.085) (-824.172) (-826.687) * (-825.179) (-826.022) [-826.191] (-826.382) -- 0:00:32
      464000 -- (-825.189) (-825.747) (-825.161) [-824.639] * (-825.519) (-825.286) [-826.631] (-824.846) -- 0:00:32
      464500 -- (-825.549) [-825.308] (-824.078) (-826.547) * (-826.130) (-824.657) (-828.620) [-825.556] -- 0:00:32
      465000 -- (-826.799) [-828.828] (-824.674) (-830.494) * (-826.856) (-826.195) [-828.155] (-824.119) -- 0:00:32

      Average standard deviation of split frequencies: 0.008271

      465500 -- (-825.550) (-828.233) [-825.053] (-825.453) * (-825.360) [-829.938] (-827.608) (-824.113) -- 0:00:32
      466000 -- (-824.303) (-825.239) [-824.089] (-824.939) * (-827.767) (-827.494) (-828.607) [-826.758] -- 0:00:32
      466500 -- (-826.239) (-826.239) [-827.781] (-825.852) * (-825.884) [-825.460] (-827.205) (-828.729) -- 0:00:32
      467000 -- (-825.741) [-826.496] (-826.482) (-825.393) * (-824.437) [-828.153] (-831.277) (-826.662) -- 0:00:31
      467500 -- [-825.275] (-825.071) (-826.847) (-826.247) * (-824.785) [-826.180] (-827.685) (-825.736) -- 0:00:31
      468000 -- (-827.774) (-825.827) [-826.980] (-824.946) * (-824.667) (-830.111) (-829.486) [-827.070] -- 0:00:31
      468500 -- (-827.326) (-829.071) (-826.654) [-827.829] * [-827.444] (-830.268) (-827.982) (-824.460) -- 0:00:31
      469000 -- (-826.559) (-824.588) [-825.650] (-827.699) * [-824.638] (-828.550) (-826.819) (-825.355) -- 0:00:31
      469500 -- (-827.457) [-829.443] (-829.305) (-825.746) * (-829.464) (-828.647) (-824.319) [-826.476] -- 0:00:31
      470000 -- (-826.214) (-830.421) [-827.035] (-828.373) * (-828.029) (-830.086) (-827.202) [-829.462] -- 0:00:31

      Average standard deviation of split frequencies: 0.008847

      470500 -- (-827.468) [-828.037] (-825.519) (-825.559) * (-824.765) (-826.732) (-831.173) [-827.669] -- 0:00:31
      471000 -- [-825.626] (-828.601) (-825.799) (-824.050) * (-826.240) [-825.636] (-833.570) (-825.816) -- 0:00:31
      471500 -- (-827.667) [-826.213] (-827.862) (-826.737) * [-823.876] (-828.691) (-826.377) (-827.197) -- 0:00:31
      472000 -- (-826.987) (-826.775) (-831.117) [-824.444] * (-826.691) [-826.656] (-824.237) (-827.325) -- 0:00:32
      472500 -- [-826.196] (-829.222) (-827.874) (-827.330) * (-826.678) (-826.910) (-827.506) [-824.990] -- 0:00:32
      473000 -- [-825.904] (-827.009) (-824.244) (-826.156) * (-824.700) [-824.354] (-825.734) (-826.871) -- 0:00:32
      473500 -- (-826.945) (-826.794) [-826.132] (-825.358) * (-824.515) (-825.552) (-829.043) [-825.612] -- 0:00:32
      474000 -- (-825.393) [-824.742] (-824.793) (-826.694) * [-825.157] (-827.061) (-825.590) (-824.772) -- 0:00:32
      474500 -- (-826.750) (-824.377) (-826.448) [-826.501] * (-827.921) [-827.144] (-828.231) (-824.496) -- 0:00:32
      475000 -- (-825.337) (-827.943) (-824.951) [-824.884] * (-826.684) [-825.451] (-824.226) (-824.461) -- 0:00:32

      Average standard deviation of split frequencies: 0.008583

      475500 -- (-825.555) [-826.441] (-826.735) (-826.313) * (-825.613) (-827.477) (-824.623) [-824.806] -- 0:00:31
      476000 -- [-828.873] (-825.560) (-826.374) (-828.610) * [-825.982] (-825.428) (-825.315) (-825.273) -- 0:00:31
      476500 -- (-826.603) [-827.388] (-827.029) (-827.045) * [-827.136] (-828.227) (-825.119) (-826.898) -- 0:00:31
      477000 -- (-828.343) (-831.195) [-826.440] (-827.353) * [-829.375] (-830.625) (-826.709) (-826.207) -- 0:00:31
      477500 -- (-832.788) (-826.772) [-826.105] (-825.273) * (-831.035) (-835.535) (-828.677) [-825.710] -- 0:00:31
      478000 -- (-828.537) [-826.926] (-826.382) (-824.300) * (-829.522) (-827.967) [-824.733] (-825.396) -- 0:00:31
      478500 -- (-827.056) (-825.659) (-825.703) [-824.711] * (-829.505) [-826.440] (-828.908) (-825.442) -- 0:00:31
      479000 -- (-828.099) (-828.545) [-825.585] (-825.485) * [-828.286] (-830.111) (-824.731) (-826.205) -- 0:00:31
      479500 -- (-829.221) (-824.923) [-825.174] (-824.864) * (-826.272) (-825.565) [-825.238] (-827.494) -- 0:00:31
      480000 -- (-826.777) (-828.624) (-824.880) [-824.337] * (-826.084) [-826.603] (-825.920) (-828.177) -- 0:00:31

      Average standard deviation of split frequencies: 0.007846

      480500 -- (-825.822) (-826.148) (-828.989) [-823.935] * (-825.680) (-829.124) [-825.708] (-825.871) -- 0:00:31
      481000 -- [-830.209] (-827.219) (-826.520) (-825.815) * (-829.793) (-825.816) (-826.202) [-827.015] -- 0:00:31
      481500 -- (-826.517) (-825.369) (-827.776) [-827.771] * (-829.372) [-825.765] (-825.444) (-825.176) -- 0:00:31
      482000 -- (-828.606) (-827.734) (-824.159) [-828.823] * [-825.741] (-825.976) (-832.400) (-828.005) -- 0:00:31
      482500 -- (-825.695) (-828.540) (-825.785) [-825.519] * (-823.786) [-826.730] (-826.630) (-826.710) -- 0:00:31
      483000 -- [-825.492] (-829.810) (-825.230) (-825.439) * (-828.190) [-830.844] (-825.400) (-826.578) -- 0:00:31
      483500 -- (-826.581) [-825.315] (-826.945) (-828.647) * (-826.451) [-824.832] (-826.462) (-826.589) -- 0:00:30
      484000 -- (-825.588) (-824.213) (-825.581) [-828.472] * (-824.740) [-826.197] (-826.294) (-827.864) -- 0:00:30
      484500 -- [-824.206] (-824.943) (-826.075) (-824.373) * (-824.840) [-825.833] (-825.600) (-825.400) -- 0:00:30
      485000 -- [-825.962] (-827.287) (-828.038) (-826.237) * (-826.491) [-827.560] (-826.780) (-827.576) -- 0:00:30

      Average standard deviation of split frequencies: 0.008568

      485500 -- (-824.512) (-825.105) [-825.503] (-827.691) * [-825.239] (-825.360) (-825.494) (-825.999) -- 0:00:30
      486000 -- (-826.121) [-824.965] (-825.579) (-824.195) * (-828.325) (-827.244) (-826.384) [-828.429] -- 0:00:30
      486500 -- [-826.470] (-827.527) (-829.285) (-828.063) * (-829.002) (-825.241) (-825.966) [-826.943] -- 0:00:30
      487000 -- [-827.895] (-828.299) (-827.067) (-825.250) * (-824.698) [-825.689] (-828.071) (-828.329) -- 0:00:30
      487500 -- (-828.767) [-826.073] (-826.829) (-824.927) * (-830.488) (-825.859) (-826.093) [-824.304] -- 0:00:30
      488000 -- (-825.390) (-826.440) (-824.250) [-824.499] * (-827.687) [-825.138] (-825.113) (-826.556) -- 0:00:30
      488500 -- (-825.273) (-825.063) (-824.502) [-827.218] * (-829.543) (-825.171) (-827.438) [-826.944] -- 0:00:31
      489000 -- [-824.299] (-826.623) (-828.770) (-824.688) * (-827.969) (-825.679) (-825.649) [-832.381] -- 0:00:31
      489500 -- [-829.101] (-825.422) (-825.954) (-826.809) * (-825.750) (-825.328) [-825.282] (-828.346) -- 0:00:31
      490000 -- (-826.661) [-825.748] (-825.905) (-827.292) * (-826.578) (-824.623) (-829.983) [-824.438] -- 0:00:31

      Average standard deviation of split frequencies: 0.008251

      490500 -- (-827.026) [-826.199] (-828.687) (-827.327) * (-826.657) (-826.373) (-826.410) [-824.120] -- 0:00:31
      491000 -- (-833.352) (-827.546) (-823.956) [-824.939] * [-825.309] (-824.371) (-824.466) (-825.824) -- 0:00:31
      491500 -- [-827.101] (-828.778) (-828.191) (-825.400) * [-826.892] (-829.259) (-828.768) (-828.056) -- 0:00:31
      492000 -- (-825.836) (-830.099) [-828.183] (-827.660) * (-825.034) (-825.923) (-826.042) [-828.799] -- 0:00:30
      492500 -- (-825.743) (-827.206) (-828.426) [-830.722] * [-824.798] (-831.225) (-825.977) (-826.709) -- 0:00:30
      493000 -- (-824.984) (-825.811) [-826.153] (-833.804) * (-826.950) [-825.394] (-827.178) (-824.719) -- 0:00:30
      493500 -- (-826.269) (-824.643) [-825.382] (-829.860) * (-828.916) [-825.200] (-828.562) (-830.029) -- 0:00:30
      494000 -- (-825.965) [-823.903] (-827.631) (-825.522) * (-829.648) (-824.870) (-827.527) [-825.921] -- 0:00:30
      494500 -- (-827.858) (-824.057) (-828.115) [-824.988] * [-825.636] (-824.404) (-828.297) (-826.565) -- 0:00:30
      495000 -- [-827.367] (-827.232) (-827.188) (-825.866) * [-824.711] (-827.592) (-830.724) (-827.267) -- 0:00:30

      Average standard deviation of split frequencies: 0.008218

      495500 -- (-832.295) [-825.042] (-827.362) (-825.129) * (-825.671) (-826.234) (-826.403) [-828.285] -- 0:00:30
      496000 -- (-825.744) (-826.652) [-826.481] (-825.232) * (-827.044) (-826.921) (-825.620) [-828.183] -- 0:00:30
      496500 -- [-826.811] (-828.994) (-825.962) (-826.582) * (-825.901) [-828.705] (-824.726) (-827.036) -- 0:00:30
      497000 -- (-830.499) (-826.014) [-823.916] (-826.644) * (-830.836) (-826.520) (-824.301) [-825.418] -- 0:00:30
      497500 -- (-826.769) [-824.939] (-824.671) (-827.410) * [-827.720] (-826.192) (-824.431) (-826.732) -- 0:00:30
      498000 -- (-826.811) (-828.048) [-825.564] (-826.675) * (-827.600) [-824.672] (-827.705) (-825.825) -- 0:00:30
      498500 -- (-830.503) [-824.544] (-830.929) (-823.932) * (-824.979) (-824.231) (-826.332) [-824.860] -- 0:00:30
      499000 -- (-830.848) [-828.432] (-825.319) (-823.932) * (-828.094) (-827.210) [-825.765] (-827.426) -- 0:00:30
      499500 -- [-827.077] (-826.118) (-825.395) (-825.712) * (-830.159) (-826.843) [-825.212] (-828.509) -- 0:00:30
      500000 -- (-825.516) (-826.659) (-826.885) [-824.795] * (-829.384) (-828.339) [-825.543] (-833.185) -- 0:00:30

      Average standard deviation of split frequencies: 0.007976

      500500 -- [-826.311] (-826.773) (-826.508) (-829.733) * [-826.826] (-828.009) (-828.786) (-828.502) -- 0:00:29
      501000 -- (-825.492) (-825.365) [-827.089] (-825.024) * (-825.043) [-829.234] (-829.933) (-827.087) -- 0:00:29
      501500 -- (-826.220) (-829.239) [-827.331] (-825.024) * (-828.968) (-826.082) (-827.053) [-827.304] -- 0:00:29
      502000 -- (-830.171) (-828.236) [-829.030] (-825.826) * (-824.107) (-826.574) (-825.780) [-826.520] -- 0:00:29
      502500 -- (-825.814) (-827.516) (-828.302) [-825.279] * (-825.148) (-824.630) [-826.051] (-829.697) -- 0:00:29
      503000 -- (-829.638) [-827.755] (-825.593) (-831.326) * (-824.435) (-827.707) (-826.903) [-829.087] -- 0:00:29
      503500 -- (-827.157) [-828.536] (-825.663) (-830.887) * (-827.763) (-825.423) (-827.025) [-826.760] -- 0:00:29
      504000 -- (-825.696) (-825.943) [-825.462] (-825.644) * (-826.816) (-825.423) [-825.636] (-824.344) -- 0:00:29
      504500 -- [-825.492] (-828.869) (-825.918) (-825.324) * [-825.483] (-828.713) (-831.409) (-825.735) -- 0:00:29
      505000 -- (-826.056) [-827.523] (-824.708) (-824.022) * (-826.543) [-828.989] (-825.660) (-827.304) -- 0:00:30

      Average standard deviation of split frequencies: 0.007946

      505500 -- (-828.358) [-826.593] (-826.451) (-825.212) * [-824.697] (-830.120) (-827.284) (-824.753) -- 0:00:30
      506000 -- (-827.723) (-825.316) [-827.149] (-826.812) * (-824.231) (-824.125) (-826.258) [-825.021] -- 0:00:30
      506500 -- (-830.020) [-824.128] (-828.958) (-828.328) * (-824.501) (-824.834) (-827.933) [-826.515] -- 0:00:30
      507000 -- (-826.640) (-824.376) [-825.117] (-830.784) * (-824.938) (-825.270) (-827.031) [-830.979] -- 0:00:30
      507500 -- (-827.227) (-825.570) [-827.616] (-828.705) * (-826.148) (-824.142) [-827.461] (-826.022) -- 0:00:30
      508000 -- (-827.239) (-824.425) (-828.175) [-826.386] * (-824.873) (-824.195) [-826.229] (-824.796) -- 0:00:30
      508500 -- [-826.391] (-825.189) (-836.756) (-825.965) * (-824.354) (-824.674) [-828.319] (-825.644) -- 0:00:29
      509000 -- (-827.526) (-824.708) [-825.378] (-824.931) * (-826.812) (-824.197) (-825.401) [-826.099] -- 0:00:29
      509500 -- (-826.271) (-826.901) [-826.842] (-825.454) * [-825.186] (-825.215) (-828.020) (-824.893) -- 0:00:29
      510000 -- (-825.827) (-829.139) (-827.061) [-824.542] * [-825.372] (-825.774) (-826.941) (-825.617) -- 0:00:29

      Average standard deviation of split frequencies: 0.008254

      510500 -- (-830.720) (-826.391) [-825.987] (-824.915) * [-827.131] (-825.700) (-824.946) (-825.305) -- 0:00:29
      511000 -- [-826.853] (-824.975) (-824.459) (-830.648) * (-825.387) (-824.293) (-827.335) [-824.350] -- 0:00:29
      511500 -- (-824.207) (-827.217) (-826.080) [-828.186] * (-825.277) (-824.903) [-825.487] (-824.193) -- 0:00:29
      512000 -- [-824.062] (-826.126) (-834.706) (-828.864) * (-825.168) (-825.575) [-826.445] (-826.456) -- 0:00:29
      512500 -- (-825.909) (-826.639) [-825.354] (-831.267) * [-825.677] (-829.106) (-826.095) (-829.648) -- 0:00:29
      513000 -- (-827.581) (-824.754) (-825.898) [-825.810] * (-824.587) (-829.200) (-824.109) [-825.687] -- 0:00:29
      513500 -- [-828.228] (-825.294) (-828.845) (-827.360) * (-825.281) (-830.935) [-825.489] (-827.567) -- 0:00:29
      514000 -- (-825.131) (-826.474) (-825.349) [-827.186] * (-825.179) (-824.449) [-825.018] (-828.634) -- 0:00:29
      514500 -- (-824.173) (-828.345) (-824.859) [-827.419] * (-825.495) (-824.973) (-824.778) [-825.806] -- 0:00:29
      515000 -- (-827.430) (-824.222) (-828.729) [-828.914] * (-825.403) (-825.041) [-826.919] (-825.853) -- 0:00:29

      Average standard deviation of split frequencies: 0.008706

      515500 -- (-828.068) (-828.374) [-825.515] (-827.094) * [-825.049] (-826.240) (-826.765) (-824.723) -- 0:00:29
      516000 -- (-827.782) (-827.653) (-828.269) [-829.526] * (-828.989) [-826.583] (-828.786) (-825.980) -- 0:00:29
      516500 -- [-828.304] (-826.461) (-824.794) (-825.839) * [-828.243] (-827.362) (-827.910) (-827.498) -- 0:00:29
      517000 -- [-825.147] (-826.538) (-826.096) (-825.450) * (-828.895) [-826.039] (-832.204) (-825.752) -- 0:00:28
      517500 -- [-825.274] (-827.867) (-826.185) (-826.446) * (-829.765) [-824.581] (-827.552) (-825.735) -- 0:00:28
      518000 -- [-827.846] (-827.733) (-827.425) (-826.656) * (-827.187) (-826.106) (-827.519) [-824.529] -- 0:00:28
      518500 -- (-827.188) (-826.591) [-825.728] (-824.391) * [-824.582] (-824.871) (-830.175) (-824.354) -- 0:00:28
      519000 -- (-826.612) (-826.327) [-826.762] (-828.166) * (-827.821) [-823.877] (-829.859) (-827.132) -- 0:00:28
      519500 -- (-829.003) [-824.984] (-824.353) (-826.840) * (-826.504) (-826.112) (-828.866) [-826.241] -- 0:00:28
      520000 -- [-824.660] (-827.885) (-824.340) (-824.129) * (-826.596) (-826.620) [-827.695] (-825.600) -- 0:00:29

      Average standard deviation of split frequencies: 0.008681

      520500 -- (-824.502) (-825.180) (-826.737) [-826.126] * (-824.602) (-826.472) (-824.020) [-826.904] -- 0:00:29
      521000 -- (-825.434) (-826.157) (-825.339) [-824.891] * (-830.790) (-826.433) [-826.708] (-825.275) -- 0:00:29
      521500 -- (-824.408) (-831.285) (-826.281) [-825.825] * (-825.147) [-824.950] (-825.113) (-826.889) -- 0:00:29
      522000 -- (-828.461) (-831.399) [-829.700] (-825.935) * [-824.428] (-833.688) (-825.280) (-823.930) -- 0:00:29
      522500 -- (-824.748) (-824.237) (-827.218) [-826.960] * [-824.336] (-828.652) (-829.181) (-825.512) -- 0:00:29
      523000 -- (-827.761) (-829.503) [-827.503] (-826.581) * (-827.451) (-824.479) (-825.895) [-827.048] -- 0:00:29
      523500 -- (-825.971) (-827.456) [-826.907] (-828.657) * [-827.827] (-828.184) (-827.238) (-827.843) -- 0:00:29
      524000 -- (-825.554) (-825.676) [-826.691] (-828.418) * (-826.357) (-825.029) (-826.046) [-829.634] -- 0:00:29
      524500 -- [-824.145] (-826.625) (-825.364) (-827.487) * [-824.659] (-828.459) (-825.311) (-826.205) -- 0:00:29
      525000 -- (-826.424) (-826.124) (-825.797) [-825.239] * (-825.653) [-827.716] (-826.779) (-829.672) -- 0:00:28

      Average standard deviation of split frequencies: 0.008804

      525500 -- (-828.265) [-829.368] (-825.221) (-826.299) * (-825.405) [-825.156] (-824.708) (-826.423) -- 0:00:28
      526000 -- [-826.022] (-828.437) (-825.425) (-825.779) * (-826.146) (-830.672) [-827.246] (-825.444) -- 0:00:28
      526500 -- (-826.871) (-825.295) [-826.327] (-825.148) * (-825.060) (-830.569) [-828.310] (-824.789) -- 0:00:28
      527000 -- (-829.413) (-825.644) (-824.593) [-825.118] * (-825.069) (-824.638) [-825.868] (-827.683) -- 0:00:28
      527500 -- (-828.026) (-824.339) [-824.709] (-825.511) * (-824.249) (-826.389) [-825.272] (-829.758) -- 0:00:28
      528000 -- (-828.235) (-826.824) (-825.606) [-825.431] * (-824.841) (-825.923) (-826.197) [-824.987] -- 0:00:28
      528500 -- (-827.543) (-827.707) (-825.034) [-826.564] * (-832.791) (-825.042) (-825.913) [-826.532] -- 0:00:28
      529000 -- [-826.575] (-832.720) (-826.553) (-832.128) * [-826.857] (-825.278) (-826.269) (-827.436) -- 0:00:28
      529500 -- (-825.565) (-825.713) [-826.496] (-824.988) * (-826.546) (-825.820) [-826.019] (-828.026) -- 0:00:28
      530000 -- [-826.491] (-830.565) (-828.528) (-826.379) * [-825.641] (-826.135) (-825.474) (-827.782) -- 0:00:28

      Average standard deviation of split frequencies: 0.008094

      530500 -- [-829.885] (-827.358) (-824.715) (-827.503) * [-825.938] (-828.710) (-828.249) (-826.528) -- 0:00:28
      531000 -- [-827.060] (-826.037) (-825.143) (-826.236) * (-827.574) (-827.562) [-827.197] (-825.891) -- 0:00:28
      531500 -- (-829.664) (-824.305) (-825.453) [-830.712] * (-824.773) [-825.837] (-826.968) (-829.792) -- 0:00:28
      532000 -- [-826.369] (-827.181) (-826.635) (-828.565) * (-828.302) [-825.204] (-827.203) (-827.343) -- 0:00:28
      532500 -- (-825.690) (-825.133) [-825.032] (-826.459) * (-829.116) (-829.554) (-825.893) [-826.896] -- 0:00:28
      533000 -- (-825.149) (-824.403) (-825.720) [-824.313] * (-828.276) [-825.465] (-825.958) (-827.006) -- 0:00:28
      533500 -- (-825.468) [-824.396] (-835.523) (-830.395) * [-826.063] (-827.743) (-827.508) (-829.270) -- 0:00:27
      534000 -- (-826.434) [-829.415] (-826.166) (-826.446) * (-831.700) [-828.313] (-829.452) (-828.104) -- 0:00:27
      534500 -- (-825.296) (-824.295) (-827.396) [-827.264] * [-828.590] (-830.989) (-827.309) (-825.197) -- 0:00:27
      535000 -- (-827.082) (-824.638) [-829.390] (-825.161) * (-828.840) (-827.393) (-826.771) [-824.938] -- 0:00:27

      Average standard deviation of split frequencies: 0.008588

      535500 -- (-825.992) [-825.462] (-825.812) (-825.178) * (-829.517) (-826.746) (-826.224) [-827.464] -- 0:00:27
      536000 -- (-825.781) (-827.597) (-827.433) [-824.433] * (-825.557) [-829.764] (-826.508) (-827.416) -- 0:00:27
      536500 -- (-826.387) [-824.032] (-824.378) (-825.410) * (-826.812) (-830.562) (-827.120) [-824.884] -- 0:00:28
      537000 -- [-828.511] (-824.108) (-824.721) (-824.021) * (-825.730) (-827.349) [-824.193] (-824.668) -- 0:00:28
      537500 -- (-826.641) (-824.483) [-826.489] (-824.458) * (-825.410) [-825.978] (-827.789) (-826.285) -- 0:00:28
      538000 -- [-825.289] (-829.625) (-829.907) (-829.819) * (-830.368) (-826.508) [-824.436] (-824.531) -- 0:00:28
      538500 -- [-825.722] (-826.852) (-828.629) (-826.201) * (-827.779) [-826.749] (-828.008) (-823.993) -- 0:00:28
      539000 -- (-827.418) (-826.044) (-826.254) [-827.056] * (-825.725) (-827.513) (-827.185) [-823.992] -- 0:00:28
      539500 -- [-825.452] (-824.018) (-827.297) (-828.587) * (-828.506) (-832.191) [-826.867] (-824.192) -- 0:00:28
      540000 -- (-830.262) (-828.326) (-824.481) [-827.110] * (-825.368) (-830.274) (-825.488) [-824.633] -- 0:00:28

      Average standard deviation of split frequencies: 0.008257

      540500 -- [-826.966] (-824.926) (-828.881) (-827.247) * (-826.920) (-823.948) (-826.947) [-826.806] -- 0:00:28
      541000 -- [-828.530] (-824.273) (-828.186) (-827.942) * (-826.037) [-824.193] (-829.847) (-831.478) -- 0:00:27
      541500 -- [-827.315] (-825.264) (-830.161) (-831.028) * (-826.246) [-828.878] (-826.329) (-828.531) -- 0:00:27
      542000 -- (-828.803) (-826.176) (-828.223) [-825.238] * (-827.055) (-825.584) (-826.387) [-824.844] -- 0:00:27
      542500 -- (-825.997) [-826.192] (-827.566) (-824.047) * [-824.214] (-825.891) (-825.378) (-826.952) -- 0:00:27
      543000 -- (-826.394) [-826.591] (-826.546) (-828.515) * (-824.432) (-828.025) (-828.655) [-826.605] -- 0:00:27
      543500 -- (-824.546) (-827.034) [-825.541] (-825.913) * [-826.923] (-824.170) (-827.916) (-825.084) -- 0:00:27
      544000 -- [-825.233] (-830.260) (-828.776) (-827.619) * (-827.934) (-824.001) (-828.435) [-826.824] -- 0:00:27
      544500 -- (-826.728) (-831.992) (-827.562) [-827.023] * (-824.588) (-827.094) [-827.514] (-825.301) -- 0:00:27
      545000 -- (-825.761) (-827.604) (-825.957) [-825.100] * (-828.963) (-824.600) (-826.235) [-826.080] -- 0:00:27

      Average standard deviation of split frequencies: 0.007770

      545500 -- (-824.361) [-828.246] (-824.724) (-824.896) * (-826.886) (-825.550) (-830.996) [-826.061] -- 0:00:27
      546000 -- [-824.050] (-826.511) (-824.578) (-825.000) * (-825.998) (-830.305) (-826.929) [-830.472] -- 0:00:27
      546500 -- (-824.569) (-824.560) [-824.468] (-830.265) * (-825.363) (-826.477) [-826.415] (-832.237) -- 0:00:27
      547000 -- [-824.328] (-824.341) (-825.694) (-831.392) * (-828.882) (-826.960) (-824.949) [-825.934] -- 0:00:27
      547500 -- [-825.645] (-824.578) (-825.427) (-825.602) * [-825.435] (-826.880) (-825.376) (-827.192) -- 0:00:27
      548000 -- (-829.674) (-826.281) [-825.400] (-826.079) * [-825.863] (-827.731) (-824.001) (-825.093) -- 0:00:27
      548500 -- (-830.423) [-826.041] (-824.335) (-826.015) * (-826.335) (-825.517) (-824.225) [-826.933] -- 0:00:27
      549000 -- (-827.878) (-828.456) (-825.146) [-827.209] * (-825.134) (-825.893) [-825.188] (-827.646) -- 0:00:27
      549500 -- (-825.038) (-826.582) [-825.889] (-830.989) * (-827.306) (-828.920) (-828.656) [-827.760] -- 0:00:27
      550000 -- (-825.456) (-827.318) [-824.681] (-828.759) * [-828.667] (-829.242) (-827.846) (-824.996) -- 0:00:27

      Average standard deviation of split frequencies: 0.007514

      550500 -- (-825.887) [-828.209] (-824.496) (-832.106) * (-824.999) (-829.337) (-826.765) [-825.436] -- 0:00:26
      551000 -- [-827.559] (-825.799) (-824.676) (-827.457) * (-827.188) [-826.406] (-828.388) (-827.810) -- 0:00:26
      551500 -- (-828.141) (-824.853) [-826.149] (-825.746) * [-825.376] (-825.005) (-828.655) (-828.594) -- 0:00:26
      552000 -- (-828.727) [-826.366] (-828.181) (-826.413) * (-824.942) (-825.348) [-824.590] (-826.006) -- 0:00:26
      552500 -- (-826.522) [-827.723] (-830.815) (-825.701) * (-824.044) (-827.363) (-826.653) [-826.270] -- 0:00:26
      553000 -- (-825.910) (-827.520) [-828.189] (-825.962) * [-825.868] (-829.765) (-826.941) (-826.460) -- 0:00:26
      553500 -- (-825.300) (-827.909) [-826.169] (-827.655) * (-824.392) (-830.467) (-827.605) [-826.291] -- 0:00:27
      554000 -- (-825.436) (-826.490) [-825.745] (-827.884) * (-826.501) (-827.438) [-827.955] (-826.029) -- 0:00:27
      554500 -- (-825.553) (-829.698) (-827.226) [-824.579] * (-825.270) (-828.895) [-827.548] (-828.510) -- 0:00:27
      555000 -- (-827.572) (-824.859) [-827.140] (-824.572) * (-826.349) (-824.426) (-826.063) [-829.443] -- 0:00:27

      Average standard deviation of split frequencies: 0.008243

      555500 -- (-828.046) [-824.967] (-825.618) (-826.225) * (-832.687) (-823.950) [-824.899] (-826.629) -- 0:00:27
      556000 -- (-830.601) (-827.696) [-826.443] (-826.254) * (-826.321) (-825.193) [-826.654] (-825.963) -- 0:00:27
      556500 -- [-827.804] (-826.119) (-837.439) (-827.218) * (-825.061) (-825.161) [-824.569] (-827.044) -- 0:00:27
      557000 -- (-832.090) [-826.573] (-828.585) (-825.011) * (-826.920) (-827.147) (-826.558) [-826.640] -- 0:00:27
      557500 -- (-824.224) [-826.648] (-826.378) (-827.900) * (-827.141) (-825.385) (-824.470) [-829.070] -- 0:00:26
      558000 -- [-825.863] (-825.092) (-828.813) (-827.974) * (-824.958) (-826.694) (-829.210) [-825.174] -- 0:00:26
      558500 -- [-825.257] (-824.529) (-827.439) (-828.774) * [-825.730] (-826.736) (-825.853) (-824.826) -- 0:00:26
      559000 -- [-824.562] (-827.375) (-824.405) (-828.070) * [-829.936] (-825.196) (-824.434) (-823.868) -- 0:00:26
      559500 -- (-826.611) [-826.330] (-825.448) (-826.982) * (-828.066) (-825.152) [-825.126] (-826.767) -- 0:00:26
      560000 -- (-824.883) (-826.329) [-825.639] (-826.833) * (-825.334) [-825.153] (-824.980) (-825.557) -- 0:00:26

      Average standard deviation of split frequencies: 0.008062

      560500 -- (-826.092) [-827.510] (-828.735) (-827.071) * (-825.370) (-829.139) [-827.579] (-825.081) -- 0:00:26
      561000 -- [-824.133] (-834.703) (-826.526) (-825.852) * (-832.261) (-824.593) (-827.652) [-824.077] -- 0:00:26
      561500 -- [-825.556] (-827.550) (-825.564) (-826.442) * (-829.809) (-832.920) [-824.311] (-828.233) -- 0:00:26
      562000 -- (-825.489) (-831.176) (-831.415) [-826.362] * (-825.954) (-828.022) [-825.425] (-829.008) -- 0:00:26
      562500 -- (-830.647) (-824.868) [-827.047] (-824.674) * [-825.930] (-829.192) (-825.164) (-825.063) -- 0:00:26
      563000 -- (-825.076) (-828.207) (-824.332) [-824.359] * (-827.156) [-827.809] (-826.509) (-824.545) -- 0:00:26
      563500 -- [-824.757] (-831.114) (-826.517) (-824.243) * [-824.974] (-824.486) (-827.563) (-827.998) -- 0:00:26
      564000 -- (-828.539) (-832.499) [-825.706] (-824.759) * (-827.858) (-826.638) (-824.521) [-824.745] -- 0:00:26
      564500 -- (-827.211) (-827.904) (-824.226) [-824.714] * (-825.008) (-825.476) [-826.359] (-824.710) -- 0:00:26
      565000 -- (-824.017) [-828.423] (-825.235) (-824.928) * [-826.361] (-824.797) (-828.228) (-828.659) -- 0:00:26

      Average standard deviation of split frequencies: 0.008468

      565500 -- (-830.091) [-827.902] (-827.243) (-829.041) * (-828.741) (-827.181) [-827.282] (-829.251) -- 0:00:26
      566000 -- (-827.134) (-826.906) [-829.007] (-826.420) * [-827.655] (-825.752) (-828.277) (-824.766) -- 0:00:26
      566500 -- (-829.527) (-827.894) [-826.014] (-829.567) * [-827.619] (-824.932) (-825.930) (-826.285) -- 0:00:26
      567000 -- [-827.495] (-828.966) (-827.768) (-825.639) * (-826.465) [-824.240] (-826.161) (-826.217) -- 0:00:25
      567500 -- [-825.213] (-825.211) (-825.177) (-824.566) * (-826.865) (-825.433) (-828.464) [-826.314] -- 0:00:25
      568000 -- [-825.068] (-825.035) (-824.399) (-825.135) * [-827.130] (-825.122) (-827.344) (-825.536) -- 0:00:25
      568500 -- (-831.962) [-826.929] (-826.000) (-825.127) * (-826.088) (-825.723) (-824.736) [-824.918] -- 0:00:25
      569000 -- (-826.272) (-825.244) [-824.233] (-824.856) * (-825.955) (-825.287) [-825.004] (-824.627) -- 0:00:25
      569500 -- (-826.665) (-826.810) [-825.239] (-828.152) * (-828.170) (-824.848) (-825.730) [-825.887] -- 0:00:25
      570000 -- [-825.248] (-828.933) (-828.641) (-827.900) * (-825.797) [-827.705] (-826.033) (-824.470) -- 0:00:26

      Average standard deviation of split frequencies: 0.008720

      570500 -- [-825.216] (-831.632) (-825.077) (-825.416) * [-824.258] (-829.364) (-826.975) (-825.356) -- 0:00:26
      571000 -- [-827.041] (-830.426) (-824.882) (-825.177) * (-825.354) (-828.021) (-826.225) [-825.810] -- 0:00:26
      571500 -- [-825.931] (-823.939) (-824.571) (-825.714) * (-824.713) [-827.087] (-825.519) (-824.507) -- 0:00:26
      572000 -- (-831.168) [-826.814] (-827.385) (-825.065) * [-825.609] (-826.333) (-824.844) (-831.945) -- 0:00:26
      572500 -- (-828.680) (-823.895) (-827.014) [-824.975] * (-825.927) (-830.412) [-825.621] (-827.749) -- 0:00:26
      573000 -- (-828.719) (-824.981) [-827.089] (-826.433) * (-826.979) [-825.545] (-824.871) (-826.419) -- 0:00:26
      573500 -- (-826.703) (-829.761) [-825.153] (-824.480) * (-825.725) (-827.345) [-825.765] (-827.823) -- 0:00:26
      574000 -- (-825.066) (-831.893) [-826.095] (-824.483) * [-825.146] (-827.194) (-825.387) (-824.832) -- 0:00:25
      574500 -- (-824.840) (-824.022) [-826.179] (-826.386) * (-824.653) (-824.619) [-824.397] (-826.445) -- 0:00:25
      575000 -- [-826.041] (-825.629) (-826.054) (-831.075) * (-826.085) (-824.872) (-827.153) [-828.200] -- 0:00:25

      Average standard deviation of split frequencies: 0.008473

      575500 -- (-825.528) (-826.896) [-825.662] (-826.296) * (-825.549) (-824.657) (-829.136) [-829.472] -- 0:00:25
      576000 -- (-827.596) [-826.155] (-827.139) (-825.614) * (-824.984) (-834.977) [-826.834] (-827.672) -- 0:00:25
      576500 -- [-826.163] (-826.974) (-824.321) (-827.867) * (-827.466) (-828.834) (-825.730) [-826.541] -- 0:00:25
      577000 -- (-831.991) [-825.671] (-826.573) (-824.406) * (-826.007) (-827.791) (-826.532) [-826.716] -- 0:00:25
      577500 -- (-826.524) (-827.070) (-826.573) [-826.266] * (-826.382) (-824.628) [-826.311] (-826.306) -- 0:00:25
      578000 -- (-825.853) [-824.638] (-824.799) (-826.244) * (-828.072) (-824.452) (-824.550) [-824.720] -- 0:00:25
      578500 -- [-828.128] (-826.174) (-827.450) (-828.554) * (-831.009) (-824.303) [-824.894] (-829.913) -- 0:00:25
      579000 -- (-824.802) [-829.957] (-827.852) (-826.353) * (-826.887) [-824.216] (-827.869) (-826.291) -- 0:00:25
      579500 -- (-824.822) (-829.556) [-829.885] (-825.857) * (-825.467) (-827.665) [-826.542] (-826.999) -- 0:00:25
      580000 -- [-826.016] (-827.077) (-831.459) (-825.443) * [-827.627] (-826.966) (-828.660) (-825.790) -- 0:00:25

      Average standard deviation of split frequencies: 0.008739

      580500 -- (-826.204) [-825.297] (-827.429) (-827.160) * (-825.049) (-826.440) (-826.651) [-825.267] -- 0:00:25
      581000 -- (-827.644) (-825.582) [-826.125] (-825.096) * [-826.028] (-830.358) (-826.220) (-826.551) -- 0:00:25
      581500 -- (-825.014) (-825.552) [-829.580] (-832.980) * (-825.748) [-825.488] (-826.000) (-824.677) -- 0:00:25
      582000 -- (-824.826) [-828.869] (-832.155) (-824.215) * (-826.306) (-826.823) (-826.461) [-826.485] -- 0:00:25
      582500 -- (-825.650) (-831.983) (-826.810) [-824.224] * [-826.145] (-824.592) (-824.254) (-826.249) -- 0:00:25
      583000 -- (-824.132) [-827.462] (-825.797) (-825.821) * (-825.261) (-830.369) [-825.693] (-828.093) -- 0:00:25
      583500 -- (-824.607) [-828.345] (-825.686) (-827.214) * [-825.136] (-825.676) (-824.650) (-825.409) -- 0:00:24
      584000 -- (-825.965) [-825.662] (-828.465) (-825.923) * (-827.100) (-825.592) [-828.258] (-824.461) -- 0:00:24
      584500 -- (-824.336) [-825.580] (-825.768) (-825.942) * (-824.649) (-825.928) [-824.921] (-830.606) -- 0:00:24
      585000 -- (-827.239) (-826.372) (-826.237) [-824.004] * (-824.536) (-824.861) (-825.128) [-828.329] -- 0:00:24

      Average standard deviation of split frequencies: 0.008565

      585500 -- (-827.561) (-830.449) [-827.450] (-828.064) * (-826.968) [-825.113] (-826.904) (-827.094) -- 0:00:24
      586000 -- [-824.793] (-825.300) (-828.269) (-824.349) * (-825.031) (-824.760) [-825.169] (-825.789) -- 0:00:24
      586500 -- (-825.371) (-825.811) (-826.680) [-824.179] * (-825.544) (-824.767) [-826.875] (-827.017) -- 0:00:25
      587000 -- (-830.164) (-828.115) (-827.993) [-827.104] * (-827.478) [-824.926] (-826.207) (-824.893) -- 0:00:25
      587500 -- (-829.124) (-828.965) [-824.819] (-826.204) * (-828.867) (-827.889) [-825.579] (-826.732) -- 0:00:25
      588000 -- (-827.671) (-826.057) [-825.039] (-825.511) * (-825.027) [-825.016] (-825.208) (-825.586) -- 0:00:25
      588500 -- (-825.288) (-826.090) (-825.061) [-825.708] * (-825.264) (-828.665) [-825.662] (-825.586) -- 0:00:25
      589000 -- (-828.365) [-826.798] (-826.828) (-824.665) * (-824.391) (-824.850) (-826.868) [-825.041] -- 0:00:25
      589500 -- [-826.074] (-827.225) (-829.416) (-825.570) * (-823.790) [-824.324] (-826.467) (-824.319) -- 0:00:25
      590000 -- [-828.667] (-824.632) (-831.443) (-827.464) * (-829.195) [-824.946] (-825.467) (-825.691) -- 0:00:25

      Average standard deviation of split frequencies: 0.007746

      590500 -- [-826.322] (-825.916) (-826.403) (-827.469) * [-824.938] (-825.816) (-825.450) (-824.088) -- 0:00:24
      591000 -- [-827.785] (-828.012) (-828.137) (-826.643) * (-827.199) [-825.157] (-828.479) (-825.662) -- 0:00:24
      591500 -- (-833.080) [-827.633] (-826.220) (-826.609) * (-829.054) [-825.321] (-826.320) (-830.114) -- 0:00:24
      592000 -- [-828.647] (-824.062) (-825.954) (-825.220) * (-828.759) [-825.136] (-830.761) (-826.343) -- 0:00:24
      592500 -- [-828.573] (-824.635) (-825.957) (-825.164) * (-827.476) [-824.790] (-826.848) (-825.891) -- 0:00:24
      593000 -- (-826.643) (-824.501) (-826.716) [-824.561] * (-826.543) (-829.976) (-827.710) [-824.384] -- 0:00:24
      593500 -- (-825.843) (-825.429) [-826.064] (-827.244) * (-824.999) (-826.315) (-827.670) [-827.209] -- 0:00:24
      594000 -- (-829.273) [-824.810] (-825.711) (-824.602) * (-827.693) (-825.206) (-826.522) [-827.679] -- 0:00:24
      594500 -- (-829.119) (-824.192) (-830.233) [-825.078] * [-832.730] (-826.969) (-826.700) (-827.676) -- 0:00:24
      595000 -- (-826.296) (-825.532) (-827.263) [-829.107] * (-832.184) (-825.735) (-825.920) [-826.135] -- 0:00:24

      Average standard deviation of split frequencies: 0.008096

      595500 -- (-826.051) [-826.764] (-829.788) (-828.471) * (-824.794) (-826.773) [-827.376] (-826.800) -- 0:00:24
      596000 -- (-826.232) [-828.400] (-826.815) (-826.936) * (-825.688) (-826.486) (-827.131) [-829.618] -- 0:00:24
      596500 -- (-824.497) (-828.574) [-825.876] (-825.776) * [-827.469] (-827.768) (-827.347) (-828.507) -- 0:00:24
      597000 -- (-825.675) (-833.160) [-824.642] (-828.571) * (-824.563) (-830.747) (-825.412) [-825.989] -- 0:00:24
      597500 -- (-825.251) (-827.212) (-825.819) [-826.614] * [-830.544] (-827.412) (-825.156) (-824.032) -- 0:00:24
      598000 -- (-824.608) [-825.491] (-824.853) (-826.872) * (-825.685) [-826.969] (-824.462) (-825.070) -- 0:00:24
      598500 -- (-824.814) (-826.106) (-828.808) [-825.804] * (-825.109) [-826.832] (-825.892) (-824.009) -- 0:00:24
      599000 -- (-825.656) (-825.288) (-826.160) [-824.092] * (-831.286) [-825.453] (-824.888) (-828.104) -- 0:00:24
      599500 -- (-825.678) (-827.853) [-826.240] (-824.349) * [-830.925] (-823.865) (-824.655) (-825.991) -- 0:00:24
      600000 -- [-825.285] (-825.637) (-826.251) (-828.887) * (-828.619) (-826.282) [-825.220] (-826.411) -- 0:00:24

      Average standard deviation of split frequencies: 0.008217

      600500 -- (-831.595) [-827.296] (-825.226) (-824.374) * (-826.255) (-825.801) [-826.362] (-825.542) -- 0:00:23
      601000 -- [-826.724] (-828.664) (-824.686) (-825.521) * (-825.350) (-824.561) (-825.998) [-826.462] -- 0:00:23
      601500 -- (-824.996) (-826.760) [-825.601] (-827.121) * (-830.790) (-825.385) [-828.706] (-829.023) -- 0:00:23
      602000 -- [-827.138] (-828.400) (-826.845) (-826.015) * [-831.374] (-824.625) (-827.068) (-825.110) -- 0:00:23
      602500 -- (-826.576) [-825.536] (-826.126) (-825.168) * (-825.908) (-824.930) [-825.036] (-825.816) -- 0:00:23
      603000 -- [-825.402] (-823.943) (-826.324) (-827.868) * [-824.460] (-825.920) (-826.059) (-826.516) -- 0:00:24
      603500 -- (-825.755) [-824.870] (-825.205) (-825.871) * (-829.507) [-826.903] (-826.720) (-828.055) -- 0:00:24
      604000 -- (-826.622) (-824.610) (-824.900) [-826.521] * (-830.516) [-824.218] (-827.570) (-826.779) -- 0:00:24
      604500 -- (-828.001) (-825.160) (-827.301) [-826.073] * [-828.251] (-827.950) (-825.413) (-826.917) -- 0:00:24
      605000 -- [-828.635] (-827.661) (-830.550) (-825.718) * (-829.096) (-826.290) (-828.681) [-827.110] -- 0:00:24

      Average standard deviation of split frequencies: 0.007779

      605500 -- [-827.557] (-826.239) (-829.681) (-827.083) * [-826.973] (-828.512) (-828.108) (-827.335) -- 0:00:24
      606000 -- (-827.921) [-828.902] (-825.462) (-826.013) * (-825.245) (-827.649) [-826.118] (-826.499) -- 0:00:24
      606500 -- [-825.301] (-824.501) (-826.017) (-826.444) * (-825.097) (-828.100) (-826.738) [-826.096] -- 0:00:24
      607000 -- (-828.265) [-825.296] (-824.936) (-827.126) * (-824.514) (-825.947) (-824.135) [-827.279] -- 0:00:23
      607500 -- [-828.014] (-827.584) (-825.595) (-828.406) * (-825.503) (-825.662) [-824.135] (-825.009) -- 0:00:23
      608000 -- (-824.923) (-825.322) [-825.197] (-824.832) * (-832.571) (-827.501) (-826.705) [-826.394] -- 0:00:23
      608500 -- [-825.583] (-826.022) (-825.415) (-828.906) * (-830.461) (-828.788) (-825.969) [-826.074] -- 0:00:23
      609000 -- (-827.464) (-824.877) [-826.131] (-827.475) * (-824.512) [-830.754] (-829.345) (-826.247) -- 0:00:23
      609500 -- [-824.932] (-825.912) (-827.212) (-826.343) * (-826.307) [-824.880] (-828.025) (-826.017) -- 0:00:23
      610000 -- (-826.169) [-825.880] (-827.263) (-827.430) * (-828.588) (-827.134) (-831.904) [-824.911] -- 0:00:23

      Average standard deviation of split frequencies: 0.007629

      610500 -- [-828.432] (-824.322) (-824.268) (-826.321) * (-826.595) [-826.545] (-828.380) (-828.667) -- 0:00:23
      611000 -- [-828.059] (-826.991) (-825.200) (-828.503) * [-826.246] (-824.429) (-833.022) (-825.563) -- 0:00:23
      611500 -- (-828.388) (-827.850) [-829.764] (-825.250) * [-825.683] (-826.226) (-828.059) (-827.977) -- 0:00:23
      612000 -- [-826.849] (-829.230) (-826.810) (-824.919) * (-825.958) (-825.807) [-825.765] (-825.392) -- 0:00:23
      612500 -- [-827.056] (-824.984) (-827.741) (-824.835) * (-826.797) (-826.015) (-825.484) [-825.028] -- 0:00:23
      613000 -- (-825.439) (-826.340) (-827.349) [-826.244] * [-825.440] (-824.576) (-826.682) (-825.573) -- 0:00:23
      613500 -- (-827.843) [-826.340] (-826.495) (-824.492) * (-824.675) (-824.538) (-824.902) [-827.125] -- 0:00:23
      614000 -- (-826.307) (-830.938) [-828.177] (-824.743) * [-827.128] (-826.449) (-826.380) (-826.052) -- 0:00:23
      614500 -- (-828.981) [-827.089] (-828.360) (-824.725) * (-826.950) (-824.221) (-827.405) [-825.082] -- 0:00:23
      615000 -- (-829.492) [-828.116] (-829.073) (-826.356) * (-825.854) [-825.162] (-826.083) (-825.508) -- 0:00:23

      Average standard deviation of split frequencies: 0.007383

      615500 -- [-828.585] (-824.869) (-829.994) (-826.509) * [-824.612] (-826.788) (-826.083) (-825.412) -- 0:00:23
      616000 -- [-827.883] (-825.393) (-829.799) (-824.352) * [-824.443] (-826.351) (-827.804) (-825.335) -- 0:00:23
      616500 -- (-831.119) [-825.742] (-825.181) (-824.528) * (-828.010) (-829.056) (-824.286) [-824.900] -- 0:00:23
      617000 -- (-827.277) (-826.001) (-826.328) [-824.358] * [-826.745] (-825.229) (-824.827) (-827.323) -- 0:00:22
      617500 -- (-824.388) [-825.705] (-833.871) (-824.149) * (-828.989) (-827.665) (-827.559) [-825.740] -- 0:00:22
      618000 -- (-825.159) [-827.708] (-826.896) (-825.476) * (-824.166) (-825.291) (-829.106) [-828.292] -- 0:00:22
      618500 -- (-828.862) (-827.435) (-825.547) [-827.124] * [-824.734] (-827.023) (-829.207) (-828.624) -- 0:00:22
      619000 -- (-827.164) (-824.525) [-828.328] (-825.395) * (-827.543) [-830.074] (-828.644) (-824.668) -- 0:00:22
      619500 -- (-825.552) (-827.552) [-828.274] (-825.739) * (-828.225) (-828.834) [-826.555] (-824.674) -- 0:00:22
      620000 -- (-826.338) [-825.104] (-829.518) (-824.739) * (-828.632) [-824.248] (-827.200) (-825.067) -- 0:00:23

      Average standard deviation of split frequencies: 0.007643

      620500 -- (-825.870) (-825.778) (-832.640) [-825.495] * (-824.235) (-831.755) [-826.594] (-831.112) -- 0:00:23
      621000 -- (-825.025) (-829.657) [-829.923] (-824.948) * (-824.406) (-829.864) (-824.480) [-828.084] -- 0:00:23
      621500 -- (-825.861) [-824.915] (-829.371) (-825.368) * (-828.841) (-830.901) [-825.329] (-836.524) -- 0:00:23
      622000 -- (-824.681) [-826.205] (-828.152) (-826.534) * (-824.359) [-824.838] (-826.360) (-831.992) -- 0:00:23
      622500 -- (-825.047) [-826.642] (-826.504) (-827.599) * [-825.884] (-826.099) (-828.019) (-833.869) -- 0:00:23
      623000 -- (-825.019) (-824.260) (-824.728) [-826.042] * (-826.336) (-831.459) [-825.919] (-826.479) -- 0:00:22
      623500 -- [-827.249] (-825.768) (-825.405) (-830.531) * [-826.906] (-826.308) (-827.539) (-823.761) -- 0:00:22
      624000 -- [-825.791] (-825.288) (-825.160) (-828.169) * (-830.299) (-825.516) [-827.512] (-824.797) -- 0:00:22
      624500 -- [-824.461] (-825.782) (-825.025) (-824.671) * (-829.667) (-824.316) (-827.281) [-824.626] -- 0:00:22
      625000 -- (-831.096) (-825.291) [-825.475] (-828.881) * (-825.490) (-826.279) [-827.062] (-826.185) -- 0:00:22

      Average standard deviation of split frequencies: 0.007154

      625500 -- (-826.001) (-827.670) (-829.793) [-828.731] * (-827.004) (-829.713) (-831.893) [-826.304] -- 0:00:22
      626000 -- (-829.045) (-825.746) [-828.889] (-826.968) * (-825.580) [-826.007] (-829.748) (-826.325) -- 0:00:22
      626500 -- (-824.722) (-826.833) (-824.951) [-826.048] * (-829.922) [-826.554] (-826.788) (-825.278) -- 0:00:22
      627000 -- [-824.307] (-824.393) (-825.795) (-826.547) * (-823.878) (-827.379) (-832.877) [-824.338] -- 0:00:22
      627500 -- (-824.958) (-828.086) [-830.233] (-826.134) * [-825.515] (-827.449) (-831.682) (-826.817) -- 0:00:22
      628000 -- [-823.955] (-826.289) (-826.314) (-827.640) * [-826.727] (-827.122) (-824.778) (-827.656) -- 0:00:22
      628500 -- (-829.097) [-826.300] (-826.495) (-825.753) * (-825.427) (-828.853) [-824.840] (-826.217) -- 0:00:22
      629000 -- (-827.342) [-827.024] (-831.390) (-825.686) * (-828.063) (-826.253) [-826.148] (-828.278) -- 0:00:22
      629500 -- (-832.248) [-827.746] (-827.888) (-827.716) * [-828.201] (-826.068) (-827.238) (-824.936) -- 0:00:22
      630000 -- [-827.289] (-826.426) (-830.128) (-825.790) * (-827.253) (-825.889) (-825.015) [-825.110] -- 0:00:22

      Average standard deviation of split frequencies: 0.007255

      630500 -- (-825.661) [-828.510] (-831.320) (-827.272) * [-827.053] (-826.261) (-827.944) (-825.166) -- 0:00:22
      631000 -- (-825.177) (-828.991) [-827.469] (-826.260) * [-824.844] (-826.008) (-831.134) (-824.865) -- 0:00:22
      631500 -- (-827.343) (-833.245) (-826.549) [-826.458] * (-825.134) [-826.476] (-825.468) (-825.313) -- 0:00:22
      632000 -- (-829.547) (-829.315) (-824.441) [-824.431] * (-826.000) (-826.072) (-824.776) [-827.548] -- 0:00:22
      632500 -- (-828.975) (-825.526) [-829.031] (-825.999) * (-824.748) [-825.535] (-825.001) (-827.724) -- 0:00:22
      633000 -- (-825.522) (-825.872) [-827.071] (-824.371) * (-825.074) (-824.596) (-827.185) [-824.078] -- 0:00:22
      633500 -- (-825.997) (-825.924) (-828.162) [-828.072] * (-827.606) [-824.211] (-825.835) (-825.320) -- 0:00:21
      634000 -- (-825.305) (-824.713) (-826.317) [-826.943] * (-829.794) (-827.369) [-825.981] (-826.601) -- 0:00:21
      634500 -- [-828.852] (-825.044) (-827.506) (-828.098) * (-830.301) (-827.281) [-825.753] (-825.967) -- 0:00:21
      635000 -- (-826.443) [-826.440] (-826.550) (-829.662) * [-829.190] (-827.709) (-830.988) (-826.637) -- 0:00:21

      Average standard deviation of split frequencies: 0.007063

      635500 -- (-825.492) [-825.449] (-825.112) (-825.227) * (-826.537) (-827.298) (-826.001) [-826.948] -- 0:00:21
      636000 -- [-824.780] (-828.201) (-830.253) (-824.434) * (-825.080) (-826.305) [-825.238] (-825.209) -- 0:00:21
      636500 -- (-824.738) (-825.884) (-825.014) [-830.259] * (-828.866) (-828.695) (-826.324) [-825.497] -- 0:00:22
      637000 -- [-825.129] (-825.213) (-826.898) (-827.678) * (-828.325) (-832.630) (-825.967) [-823.980] -- 0:00:22
      637500 -- (-827.312) (-825.617) [-827.452] (-827.156) * (-830.007) [-824.353] (-824.645) (-825.033) -- 0:00:22
      638000 -- (-826.249) [-824.227] (-825.324) (-828.692) * (-826.398) (-827.750) [-824.067] (-825.386) -- 0:00:22
      638500 -- (-827.932) [-827.831] (-826.674) (-824.974) * (-828.344) (-825.712) [-824.045] (-826.011) -- 0:00:22
      639000 -- [-824.271] (-825.514) (-827.459) (-825.402) * (-827.207) (-825.817) [-825.865] (-827.607) -- 0:00:22
      639500 -- (-829.693) (-823.807) [-825.100] (-824.855) * [-825.962] (-824.574) (-825.631) (-825.627) -- 0:00:21
      640000 -- (-833.839) [-824.525] (-825.506) (-824.089) * (-829.759) (-827.683) (-826.632) [-826.617] -- 0:00:21

      Average standard deviation of split frequencies: 0.006944

      640500 -- (-828.400) (-825.893) [-826.251] (-826.020) * (-829.303) (-825.283) (-829.580) [-824.532] -- 0:00:21
      641000 -- (-826.673) (-826.131) (-825.083) [-827.481] * (-828.016) (-824.829) (-824.752) [-825.337] -- 0:00:21
      641500 -- (-825.168) [-825.224] (-824.834) (-826.084) * [-825.124] (-825.137) (-824.482) (-825.257) -- 0:00:21
      642000 -- (-824.358) [-825.435] (-824.834) (-828.113) * (-825.397) [-827.708] (-824.967) (-827.135) -- 0:00:21
      642500 -- [-824.819] (-826.808) (-825.778) (-827.233) * (-824.345) (-827.388) (-824.723) [-828.424] -- 0:00:21
      643000 -- [-827.318] (-827.646) (-825.518) (-826.962) * (-824.986) [-826.904] (-823.988) (-828.958) -- 0:00:21
      643500 -- (-828.545) [-826.683] (-825.072) (-827.536) * [-824.769] (-826.499) (-824.461) (-828.505) -- 0:00:21
      644000 -- [-825.130] (-826.702) (-828.519) (-827.061) * (-829.671) (-825.714) [-827.079] (-825.635) -- 0:00:21
      644500 -- (-826.367) [-825.724] (-827.835) (-825.847) * [-825.623] (-827.657) (-828.400) (-824.703) -- 0:00:21
      645000 -- (-828.543) [-825.416] (-829.498) (-825.117) * [-827.182] (-824.693) (-825.476) (-824.445) -- 0:00:21

      Average standard deviation of split frequencies: 0.006659

      645500 -- (-825.344) (-825.096) [-826.864] (-825.384) * (-824.953) (-824.884) (-825.863) [-824.553] -- 0:00:21
      646000 -- [-826.343] (-827.427) (-826.537) (-824.474) * (-824.790) (-827.358) [-826.372] (-824.948) -- 0:00:21
      646500 -- (-824.798) [-830.880] (-827.045) (-828.420) * [-826.875] (-830.595) (-829.000) (-824.868) -- 0:00:21
      647000 -- (-827.213) [-827.852] (-830.619) (-826.242) * (-827.316) (-828.396) [-826.049] (-825.131) -- 0:00:21
      647500 -- (-824.953) (-826.907) [-826.502] (-824.813) * (-827.819) (-831.233) (-825.425) [-825.781] -- 0:00:21
      648000 -- [-827.854] (-828.573) (-827.791) (-825.241) * [-827.313] (-827.238) (-825.016) (-824.893) -- 0:00:21
      648500 -- [-826.247] (-832.805) (-827.392) (-826.931) * [-829.230] (-824.540) (-824.823) (-825.864) -- 0:00:21
      649000 -- (-825.233) [-825.504] (-825.641) (-827.252) * (-826.332) (-826.069) (-831.204) [-825.392] -- 0:00:21
      649500 -- [-828.736] (-825.971) (-825.467) (-825.262) * [-825.496] (-826.376) (-826.327) (-824.826) -- 0:00:21
      650000 -- [-827.986] (-825.525) (-825.562) (-825.273) * (-828.576) (-825.911) (-826.333) [-824.666] -- 0:00:21

      Average standard deviation of split frequencies: 0.006656

      650500 -- (-825.362) [-825.804] (-824.843) (-825.469) * [-827.821] (-826.094) (-832.569) (-829.677) -- 0:00:20
      651000 -- (-826.218) [-828.130] (-824.566) (-825.006) * (-825.199) [-825.477] (-828.996) (-827.489) -- 0:00:20
      651500 -- [-823.904] (-832.247) (-824.933) (-825.915) * [-826.703] (-829.761) (-825.897) (-829.025) -- 0:00:20
      652000 -- [-823.823] (-827.131) (-825.192) (-827.162) * [-826.299] (-825.919) (-824.783) (-827.459) -- 0:00:20
      652500 -- (-827.363) [-825.169] (-825.640) (-830.764) * (-825.481) [-825.998] (-826.400) (-827.407) -- 0:00:20
      653000 -- (-826.432) (-825.167) (-827.419) [-825.193] * [-825.586] (-825.882) (-824.191) (-827.108) -- 0:00:20
      653500 -- (-826.870) (-826.381) (-826.218) [-826.480] * (-825.354) (-827.419) (-826.280) [-827.023] -- 0:00:21
      654000 -- (-826.612) (-828.271) (-825.636) [-824.259] * (-825.152) (-827.058) [-828.861] (-825.855) -- 0:00:21
      654500 -- [-829.376] (-827.585) (-832.702) (-824.661) * (-824.370) (-825.313) (-827.609) [-825.681] -- 0:00:21
      655000 -- (-827.459) [-827.613] (-836.206) (-825.159) * (-824.281) (-825.524) (-825.448) [-825.477] -- 0:00:21

      Average standard deviation of split frequencies: 0.006288

      655500 -- (-827.927) (-825.821) (-826.528) [-824.564] * (-823.978) (-824.723) [-826.021] (-827.176) -- 0:00:21
      656000 -- [-828.628] (-826.709) (-828.313) (-823.994) * (-824.476) (-823.868) (-825.489) [-827.149] -- 0:00:20
      656500 -- (-828.735) [-826.725] (-825.205) (-828.134) * (-825.048) [-826.023] (-824.652) (-826.386) -- 0:00:20
      657000 -- (-826.794) (-825.650) [-826.516] (-827.963) * (-825.211) [-824.636] (-825.865) (-824.950) -- 0:00:20
      657500 -- (-829.476) (-825.870) (-825.623) [-825.109] * (-824.529) [-824.165] (-833.688) (-829.251) -- 0:00:20
      658000 -- [-824.684] (-829.596) (-825.993) (-825.576) * [-824.696] (-826.449) (-824.766) (-825.822) -- 0:00:20
      658500 -- [-824.875] (-829.774) (-828.826) (-824.980) * [-827.565] (-825.293) (-827.283) (-824.679) -- 0:00:20
      659000 -- [-826.867] (-831.828) (-824.939) (-823.919) * (-826.615) (-826.737) (-827.069) [-825.004] -- 0:00:20
      659500 -- (-833.562) [-826.451] (-828.504) (-823.950) * [-828.347] (-826.984) (-826.597) (-825.150) -- 0:00:20
      660000 -- [-828.537] (-831.442) (-825.392) (-824.104) * [-828.447] (-825.772) (-826.060) (-826.358) -- 0:00:20

      Average standard deviation of split frequencies: 0.006957

      660500 -- (-829.379) (-827.471) (-826.894) [-826.229] * (-826.488) (-825.438) (-828.246) [-825.379] -- 0:00:20
      661000 -- (-827.073) (-827.897) (-826.486) [-826.587] * [-825.675] (-832.250) (-830.702) (-826.998) -- 0:00:20
      661500 -- (-827.711) (-824.572) [-826.527] (-826.139) * (-824.401) (-830.656) (-830.656) [-827.532] -- 0:00:20
      662000 -- (-825.896) [-827.649] (-826.172) (-825.669) * (-828.022) [-824.816] (-829.059) (-825.289) -- 0:00:20
      662500 -- (-825.394) (-824.798) [-829.970] (-824.888) * (-831.777) (-824.224) [-824.181] (-826.741) -- 0:00:20
      663000 -- (-826.552) (-826.974) [-824.855] (-825.599) * (-825.783) (-826.834) (-826.786) [-827.071] -- 0:00:20
      663500 -- [-825.869] (-827.444) (-824.210) (-824.457) * (-826.636) (-825.772) [-823.801] (-825.448) -- 0:00:20
      664000 -- (-825.008) (-827.208) [-824.912] (-825.051) * (-825.476) [-825.862] (-829.874) (-825.145) -- 0:00:20
      664500 -- (-823.945) (-830.533) [-824.186] (-825.107) * (-825.499) (-830.937) (-828.409) [-827.557] -- 0:00:20
      665000 -- (-824.298) (-827.620) [-825.442] (-824.124) * (-828.800) [-828.462] (-825.725) (-826.644) -- 0:00:20

      Average standard deviation of split frequencies: 0.006813

      665500 -- (-825.883) (-829.005) [-824.784] (-824.754) * (-824.684) (-829.148) [-825.607] (-826.030) -- 0:00:20
      666000 -- (-828.461) [-824.972] (-826.755) (-825.066) * [-826.178] (-828.707) (-832.651) (-824.384) -- 0:00:20
      666500 -- (-830.905) (-827.843) [-825.060] (-826.157) * (-830.009) [-825.104] (-831.973) (-824.284) -- 0:00:20
      667000 -- (-828.589) (-825.358) (-824.469) [-825.158] * (-826.131) [-826.135] (-831.269) (-825.980) -- 0:00:19
      667500 -- (-824.883) (-825.721) (-824.215) [-826.538] * (-826.015) (-824.554) [-825.551] (-826.087) -- 0:00:19
      668000 -- [-824.147] (-827.774) (-823.851) (-828.017) * (-825.573) (-827.156) [-824.578] (-827.379) -- 0:00:19
      668500 -- (-825.196) [-827.215] (-826.161) (-829.812) * (-824.630) (-825.641) [-825.742] (-827.047) -- 0:00:19
      669000 -- (-825.023) (-826.880) (-827.353) [-826.520] * [-825.394] (-824.662) (-824.793) (-833.069) -- 0:00:19
      669500 -- (-826.475) (-826.460) [-826.136] (-827.072) * [-826.136] (-827.136) (-824.750) (-824.547) -- 0:00:19
      670000 -- (-825.207) (-828.591) [-825.452] (-825.547) * (-828.731) [-824.177] (-827.253) (-827.179) -- 0:00:20

      Average standard deviation of split frequencies: 0.006985

      670500 -- (-827.038) (-828.091) [-825.348] (-826.453) * (-828.125) (-824.975) [-825.218] (-830.628) -- 0:00:20
      671000 -- (-825.560) (-824.641) (-827.746) [-825.793] * (-825.258) (-827.428) [-825.329] (-826.846) -- 0:00:20
      671500 -- (-825.336) (-825.100) [-826.252] (-825.656) * (-824.808) [-824.736] (-825.529) (-825.648) -- 0:00:20
      672000 -- (-828.920) (-826.444) (-826.508) [-825.232] * (-825.141) [-824.587] (-824.469) (-828.131) -- 0:00:20
      672500 -- (-825.985) [-826.355] (-828.729) (-825.538) * (-827.400) [-824.712] (-826.614) (-825.935) -- 0:00:19
      673000 -- (-825.985) (-826.706) [-828.576] (-826.288) * (-825.290) (-825.620) (-825.948) [-826.461] -- 0:00:19
      673500 -- (-825.723) (-824.671) (-834.499) [-827.072] * (-825.244) (-827.783) [-825.149] (-824.129) -- 0:00:19
      674000 -- (-824.405) (-824.633) [-827.596] (-827.479) * (-825.810) (-830.397) [-825.105] (-826.842) -- 0:00:19
      674500 -- (-824.221) (-832.102) [-826.043] (-825.423) * (-826.222) (-826.080) (-824.205) [-827.794] -- 0:00:19
      675000 -- (-829.429) (-840.569) (-825.589) [-827.935] * (-824.339) [-825.151] (-827.185) (-826.349) -- 0:00:19

      Average standard deviation of split frequencies: 0.006843

      675500 -- (-825.868) [-827.788] (-829.398) (-828.688) * (-824.075) [-824.314] (-828.890) (-825.515) -- 0:00:19
      676000 -- (-829.055) (-833.879) (-829.733) [-825.000] * [-825.752] (-827.182) (-825.376) (-825.605) -- 0:00:19
      676500 -- (-824.181) (-834.891) [-828.525] (-825.760) * [-827.350] (-824.409) (-827.622) (-826.516) -- 0:00:19
      677000 -- [-823.935] (-831.731) (-825.893) (-826.184) * (-833.284) [-825.583] (-832.197) (-826.585) -- 0:00:19
      677500 -- [-823.987] (-829.887) (-825.282) (-824.421) * [-827.756] (-830.052) (-824.830) (-830.645) -- 0:00:19
      678000 -- (-824.050) [-823.910] (-824.729) (-824.445) * [-825.231] (-831.438) (-827.167) (-825.324) -- 0:00:19
      678500 -- [-823.909] (-826.388) (-824.901) (-826.194) * (-824.197) [-825.603] (-827.181) (-826.727) -- 0:00:19
      679000 -- [-825.566] (-828.105) (-824.851) (-825.566) * [-824.437] (-826.596) (-826.867) (-825.334) -- 0:00:19
      679500 -- (-826.238) (-825.247) (-826.676) [-824.010] * (-824.927) (-825.218) [-826.517] (-827.463) -- 0:00:19
      680000 -- (-825.494) (-824.036) (-824.336) [-825.219] * [-825.156] (-824.138) (-826.516) (-825.065) -- 0:00:19

      Average standard deviation of split frequencies: 0.006602

      680500 -- (-827.291) (-825.780) [-825.056] (-825.080) * (-825.951) [-824.512] (-826.851) (-825.189) -- 0:00:19
      681000 -- (-825.712) [-827.741] (-825.702) (-824.995) * (-827.444) (-824.294) [-830.300] (-825.095) -- 0:00:19
      681500 -- (-830.607) [-825.815] (-825.653) (-826.943) * (-825.880) [-826.760] (-826.899) (-824.714) -- 0:00:19
      682000 -- (-827.372) (-824.867) (-825.516) [-827.088] * (-824.157) (-824.767) (-827.544) [-824.600] -- 0:00:19
      682500 -- [-825.378] (-825.413) (-827.042) (-829.793) * (-826.652) (-824.198) (-830.119) [-828.617] -- 0:00:19
      683000 -- (-831.399) (-824.242) [-824.326] (-825.790) * [-826.735] (-824.444) (-827.692) (-826.105) -- 0:00:19
      683500 -- (-829.975) [-824.635] (-824.603) (-825.130) * [-825.019] (-826.371) (-828.538) (-824.270) -- 0:00:18
      684000 -- (-829.578) (-823.917) (-825.359) [-825.089] * [-824.714] (-825.724) (-829.077) (-826.385) -- 0:00:18
      684500 -- (-828.960) [-824.516] (-827.722) (-828.554) * (-825.759) (-824.388) (-827.174) [-826.811] -- 0:00:18
      685000 -- (-826.542) (-825.100) [-826.825] (-825.966) * [-825.034] (-824.301) (-826.895) (-826.097) -- 0:00:18

      Average standard deviation of split frequencies: 0.006551

      685500 -- [-825.782] (-827.636) (-826.023) (-825.183) * (-833.203) [-827.